Your browser is old and dusty. Try Google Chrome!

Details for slr1546

ORF slr1546
Accession NP_440792.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -242 -228 1.37622 0.191
NP_440557.1_1 Forward -391 -372 -2.16383 0.284
NP_440795.1_7 Reverse -384 -391 7.51227 0.24
NP_441453.1_4 Reverse -262 -270 5.32929 0.147
NP_442151.1_6 Forward -23 -9 5.50613 0.274
NP_442151.1_10 Reverse -353 -371 13.7855 0.289
NP_441818.1_1 Forward -22 -11 9.10461 0.255
NP_442752.1_4 Reverse -365 -372 12.4288 0.0388
NP_442752.1_4 Reverse -14 -21 10.5605 0.1
NP_443027.1_4 Reverse -381 -391 10.5998 0.124
NP_442909.1_7 Forward -242 -228 5.40719 0.286
NP_440061.1_9 Forward -149 -135 7.66879 0.198
NP_440061.1_9 Reverse -205 -219 5.21053 0.293
NP_442762.1_3 Reverse -229 -248 12.3892 0.225
NP_442762.1_10 Forward -146 -127 -10.7186 0.257
NP_442762.1_10 Reverse -121 -140 -10.7186 0.257
NP_442097.1_2 Reverse -378 -397 11.0125 0.189
NP_440011.1_1 Forward -143 -124 10.8159 0.297
NP_440856.1_7 Forward -174 -155 -9.047 0.282
NP_441083.1_3 Forward -142 -132 15.8108 0.123
NP_441083.1_5 Reverse -262 -272 -0.118297 0.256
NP_442889.1_8 Reverse -259 -273 6.98048 0.167
NP_442570.1_3 Forward -175 -156 2.3594 0.189
NP_442570.1_3 Forward -149 -130 -3.73712 0.225
NP_442570.1_3 Reverse -129 -148 -9.53865 0.299
NP_442601.1_9 Forward -59 -40 14.1591 0.117
NP_440747.1_10 Forward -377 -365 -4.38592 0.0974
NP_440747.1_10 Forward -66 -54 -12.0557 0.199
NP_441486.1_1 Forward -274 -260 2.5562 0.0812
NP_441695.1_8 Reverse -126 -140 12.0943 0.237
NP_441634.1_8 Reverse -49 -63 2.2612 0.169
NP_440376.1_1 Forward -271 -262 4.0313 0.182
NP_440376.1_1 Forward -173 -164 1.76968 0.242
NP_442191.1_4 Reverse -356 -370 11.187 0.268
NP_441763.1_10 Forward -361 -342 4.71854 0.3
NP_440141.1_8 Reverse -369 -388 11.0125 0.208
NP_441256.1_1 Forward -234 -215 2.16274 0.145
NP_441256.1_1 Forward -237 -218 -9.44032 0.284
NP_442057.1_5 Forward -36 -18 13.4527 0.229
NP_442816.1_7 Forward -42 -23 5.0129 0.256
NP_441162.1_3 Forward -21 -2 10.3242 0.214
NP_439990.1_8 Forward -319 -300 -2.85214 0.283
NP_442376.1_2 Forward -353 -334 -11.2103 0.286
NP_442911.1_2 Reverse -166 -185 -4.32711 0.132
NP_442911.1_2 Forward -193 -174 -8.752 0.242
NP_440153.1_8 Forward -63 -50 -1.25902 0.222
NP_443055.1_6 Reverse -14 -32 0.0184138 0.251
NP_443044.1_1 Reverse -199 -218 4.81767 0.279
NP_442995.1_5 Forward -188 -169 11.3075 0.211
NP_441099.1_5 Forward -247 -228 -9.34199 0.219
NP_440809.1_9 Forward -335 -317 -7.45401 0.225
NP_441294.1_7 Reverse -258 -272 13.1862 0.0727
NP_442438.1_10 Reverse -309 -323 -0.393733 0.259
NP_441000.1_5 Forward -295 -276 5.89851 0.248
NP_442771.1_1 Reverse -12 -30 -10.3056 0.254
NP_440147.1_4 Reverse -181 -194 3.95252 0.175
NP_441295.1_4 Forward -379 -360 -3.3438 0.29
NP_441550.1_8 Reverse -260 -270 7.25606 0.169
NP_441550.1_8 Forward -273 -263 5.38779 0.252
NP_441916.1_10 Reverse -376 -395 4.22769 0.223
NP_441041.1_4 Reverse -48 -67 -3.04881 0.119
NP_441041.1_4 Forward -359 -340 -12.2919 0.262
NP_441041.1_7 Forward -195 -183 5.57123 0.25
NP_442004.1_6 Forward -398 -384 2.2612 0.271
NP_441725.1_5 Forward -22 -12 -1.10161 0.288
NP_440260.1_8 Forward -175 -157 -7.15901 0.295
NP_441087.1_6 Reverse -346 -364 -0.76823 0.26
NP_441644.1_6 Reverse -262 -272 5.19112 0.204
NP_442215.1_2 Forward -59 -43 1.5335 0.132
NP_442215.1_2 Forward -25 -9 -7.51295 0.297
NP_442177.1_5 Reverse -80 -94 7.86607 0.291
NP_442029.1_6 Reverse -148 -167 7.66927 0.223
NP_442029.1_6 Reverse -84 -103 4.52268 0.268
NP_440929.1_8 Reverse -262 -271 11.8978 0.0185
NP_442933.1_1 Forward -41 -22 7.49569 0.253
NP_442933.1_2 Reverse -23 -41 10.2196 0.257
NP_442554.1_8 Forward -270 -260 2.33998 0.274
NP_441762.1_7 Reverse -173 -185 -5.86088 0.246
NP_442142.1_4 Forward -57 -44 9.65513 0.0903
NP_442142.1_4 Reverse -38 -51 4.24695 0.227
NP_440122.1_2 Reverse -118 -137 -0.39387 0.273
NP_440919.1_7 Reverse -121 -139 6.70422 0.241
NP_441523.1_6 Forward -378 -359 6.68596 0.21
NP_443009.1_5 Reverse -163 -174 5.95804 0.18
NP_443009.1_5 Reverse -40 -51 5.56471 0.197
NP_443009.1_5 Forward -375 -364 4.48308 0.244
NP_441715.1_4 Forward -182 -172 7.84651 0.107
NP_440183.1_3 Reverse -340 -359 19.8792 0.141
NP_441015.1_10 Forward -145 -126 -11.5053 0.298
NP_440265.1_8 Forward -188 -170 14.8671 0.219
NP_441876.1_9 Forward -27 -17 11.9759 0.269
NP_441826.1_2 Reverse -8 -22 1.08123 0.164
NP_442719.1_2 Forward -192 -174 -11.8796 0.297
NP_441612.1_2 Reverse -383 -393 6.51622 0.287
NP_442227.1_2 Forward -235 -216 -1.37718 0.262
NP_441290.1_4 Forward -63 -44 8.75091 0.16
NP_442542.1_9 Forward -57 -43 11.7003 0.111
NP_442050.1_1 Reverse -365 -384 8.06259 0.255
NP_441114.1_3 Forward -145 -136 7.66954 0.231
NP_440558.1_2 Reverse -123 -142 -2.0655 0.222
NP_440558.1_2 Forward -96 -77 -2.95047 0.232
NP_440558.1_2 Forward -144 -125 -6.1954 0.272
NP_441878.1_6 Forward -136 -126 0.373358 0.144
NP_441878.1_6 Reverse -131 -141 0.373358 0.144
NP_441036.1_8 Reverse -364 -374 6.46988 0.229
NP_442066.2_4 Reverse -41 -60 -8.16202 0.294
NP_441433.1_8 Forward -230 -211 8.45592 0.161
NP_441433.1_8 Reverse -133 -152 -1.96717 0.263
NP_440595.1_8 Reverse -365 -384 9.53756 0.271
NP_441116.1_9 Reverse -376 -390 11.701 0.272
NP_440276.1_2 Reverse -95 -114 10.3906 0.255
NP_442464.1_5 Reverse -264 -283 18.2451 0.177
NP_442347.1_2 Reverse -263 -272 3.7363 0.284
NP_442347.1_10 Forward -379 -365 16.7152 0.182
NP_442645.1_2 Forward -305 -286 -18.1918 0.27
NP_442645.1_2 Forward -209 -190 -22.125 0.29
NP_441411.1_3 Forward -190 -171 15.8307 0.0676
NP_441037.1_4 Reverse -260 -270 12.3855 0.103
NP_441633.1_3 Forward -273 -260 -6.86388 0.277
NP_441728.2_4 Reverse -102 -121 11.8883 0.279
NP_440899.1_2 Forward -374 -355 5.11187 0.298
NP_442802.1_2 Forward -366 -347 18.2882 0.203
NP_441007.1_10 Reverse -49 -62 -0.570702 0.287
NP_442334.1_2 Reverse -307 -324 -5.46769 0.205
NP_440256.1_1 Reverse -38 -57 1.37609 0.0761
NP_441512.1_4 Reverse -379 -398 9.83255 0.237
NP_441559.1_8 Forward -178 -164 14.7492 0.0574
NP_441559.1_8 Reverse -159 -173 -5.90027 0.271
NP_441559.1_8 Reverse -334 -348 -6.58858 0.279
NP_441559.1_8 Reverse -169 -183 -7.47356 0.294
NP_441559.1_8 Reverse -360 -374 -7.57189 0.295
NP_440915.1_5 Reverse -49 -68 15.1034 0.283
NP_440915.1_6 Forward -177 -163 -1.96703 0.254
NP_441296.1_9 Forward -391 -378 9.06515 0.286
NP_440717.1_3 Forward -20 -6 18.3868 0.156
NP_442785.1_7 Reverse -260 -274 8.55439 0.297
NP_440702.1_2 Forward -46 -27 -8.35868 0.294
NP_440695.1_6 Reverse -207 -221 10.9931 0.265
NP_439985.1_7 Forward -174 -155 10.4225 0.18
NP_441340.1_5 Forward -270 -263 3.97235 0.274
NP_440194.1_3 Forward -281 -262 1.0811 0.277
NP_440586.1_8 Reverse -263 -270 5.8403 0.283
NP_440586.1_9 Forward -223 -204 4.916 0.288
NP_440192.1_5 Reverse -47 -66 5.50599 0.234
NP_441262.1_3 Forward -271 -264 5.34899 0.181
NP_443051.1_1 Reverse -261 -270 -1.18024 0.297
NP_439937.1_9 Forward -175 -158 -15.2031 0.287
NP_440926.1_5 Reverse -121 -140 7.57094 0.276
NP_440408.1_7 Reverse -365 -384 10.1275 0.253
NP_440408.1_7 Forward -63 -44 9.3409 0.262
NP_440439.1_1 Reverse -362 -375 3.26421 0.118
NP_440372.1_2 Forward -270 -263 4.26735 0.221
NP_440271.1_2 Reverse -213 -232 2.26107 0.284
NP_441789.1_7 Reverse -155 -174 -4.32786 0.28
NP_442285.1_7 Forward -379 -360 6.98095 0.275
NP_440316.1_10 Forward -136 -126 8.73149 0.239
NP_442488.1_9 Reverse -155 -174 15.6341 0.19
NP_441803.1_2 Forward -179 -160 -1.18052 0.294
NP_441803.1_2 Forward -62 -43 -1.18052 0.294
NP_439977.1_7 Forward -308 -289 13.47 0.262
NP_441572.1_7 Reverse -8 -27 -4.91709 0.245
NP_442887.1_6 Reverse -229 -248 14.3558 0.0717
NP_442384.1_10 Forward -374 -361 5.82081 0.118
NP_442384.1_10 Reverse -262 -275 0.904263 0.275
NP_441877.1_9 Reverse -266 -283 2.49712 0.29
NP_442244.1_6 Reverse -359 -378 -1.57384 0.299
NP_440163.1_2 Forward -240 -221 17.5998 0.298
NP_440344.1_10 Reverse -255 -272 -12.9408 0.269
NP_440282.1_10 Forward -145 -126 -8.26035 0.26
NP_440531.1_6 Reverse -254 -273 -4.03212 0.273
NP_440297.1_9 Forward -22 -12 -0.216628 0.282
NP_440297.1_9 Reverse -15 -25 -0.511621 0.289
NP_441592.1_4 Forward -135 -116 -0.295539 0.243
NP_442553.1_7 Reverse -122 -136 16.6175 0.255
NP_440834.1_2 Forward -177 -158 14.4533 0.275
NP_441894.1_1 Reverse -212 -231 -5.40875 0.263
NP_440888.1_2 Forward -173 -159 9.93039 0.11
NP_442454.1_2 Forward -309 -290 6.54077 0.291
NP_442454.1_5 Forward -55 -36 13.3716 0.244
NP_440792.1_1 Forward -200 -181 36.3819 0.00000227
NP_440792.1_2 Forward -224 -205 27.3355 0.00173
NP_440792.1_3 Forward -170 -151 30.4821 0.000404
NP_440792.1_4 Forward -149 -130 32.7437 0.00000687
NP_440792.1_5 Forward -263 -244 19.764 0.0754
NP_440792.1_6 Forward -353 -334 30.3837 0.000296
NP_440792.1_7 Forward -239 -225 24.189 0.019
NP_440792.1_8 Forward -323 -304 31.8587 0.0000134
NP_440792.1_9 Forward -118 -99 21.6091 0.121
NP_440792.1_10 Forward -296 -277 23.3039 0.0332
NP_442277.1_7 Reverse -25 -41 -1.04361 0.264
NP_442033.1_10 Forward -175 -156 -5.80207 0.18
NP_441551.1_5 Forward -145 -129 5.76105 0.297
NP_441178.1_6 Reverse -117 -136 5.99684 0.268
NP_441469.1_8 Forward -184 -175 7.76787 0.227
NP_441462.1_2 Forward -271 -261 -1.00328 0.274
NP_443062.1_1 Forward -392 -374 6.20575 0.206
NP_443062.1_6 Forward -39 -20 5.01433 0.211
NP_442204.1_1 Reverse -10 -21 -0.432984 0.299
NP_440673.1_3 Reverse -43 -50 10.5605 0.123
NP_440673.1_7 Reverse -43 -62 0.196116 0.272
NP_441714.1_2 Forward -295 -277 21.2586 0.0905
NP_441714.1_3 Reverse -334 -352 13.7847 0.211
NP_440436.1_4 Forward -373 -364 9.34074 0.0871
NP_440436.1_4 Reverse -42 -51 7.47246 0.129
NP_442086.1_6 Forward -192 -173 11.3075 0.255
NP_442412.1_1 Forward -113 -94 14.9083 0.294
NP_441893.1_8 Reverse -300 -319 14.5524 0.256
NP_440314.1_9 Forward -191 -172 -9.34199 0.264
NP_441004.1_2 Reverse -127 -146 -4.13045 0.288
NP_441004.1_9 Reverse -169 -187 14.0215 0.227
NP_442366.1_3 Reverse -364 -382 -2.63579 0.231
NP_442206.1_10 Reverse -262 -277 -0.216765 0.287
NP_442206.1_10 Forward -368 -353 -0.315096 0.29
NP_441851.1_10 Reverse -261 -271 4.89658 0.24
NP_442622.1_3 Reverse -154 -173 -2.55715 0.215
NP_442515.1_1 Reverse -19 -33 0.392915 0.193
NP_440593.1_3 Reverse -43 -62 1.27776 0.19
NP_440593.1_3 Forward -379 -360 -3.24547 0.233
NP_441661.1_3 Forward -200 -183 -5.27103 0.268
NP_442314.1_4 Reverse -132 -150 12.8022 0.189
NP_442843.1_1 Forward -191 -172 -4.6221 0.239
NP_442843.1_1 Reverse -139 -158 -8.45701 0.255
NP_441124.1_5 Forward -122 -112 11.7668 0.245
NP_440588.1_2 Forward -273 -254 -5.50708 0.252
NP_439950.1_1 Reverse -144 -153 13.5694 0.266
NP_440023.1_7 Forward -347 -328 13.0775 0.265
NP_442006.1_2 Forward -135 -118 -5.36936 0.143
NP_442006.1_2 Forward -136 -119 -17.8574 0.283
NP_442729.1_5 Forward -130 -120 8.33817 0.248
NP_442443.1_1 Reverse -130 -149 -5.01543 0.28
NP_442344.1_7 Forward -191 -172 -9.83364 0.27
NP_440629.1_9 Forward -192 -173 6.09597 0.196
NP_441328.2_8 Reverse -181 -200 15.5349 0.268
NP_440559.1_1 Forward -270 -261 5.01461 0.161
NP_441659.2_8 Reverse -262 -272 2.33998 0.205
NP_442749.1_2 Reverse -73 -92 11.8975 0.219
NP_442913.1_10 Forward -365 -346 2.65439 0.123
NP_439956.1_7 Forward -179 -160 2.0644 0.276
NP_441923.1_7 Reverse -159 -178 10.4225 0.214
NP_440459.1_2 Forward -59 -42 11.0519 0.183
NP_440010.1_3 Forward -138 -119 -4.91709 0.25
NP_440010.1_10 Forward -383 -364 6.29264 0.226
NP_441888.1_7 Reverse -169 -183 9.83269 0.136
NP_441888.1_7 Reverse -178 -192 0.392915 0.299
NP_441112.1_2 Forward -161 -142 14.4541 0.125
NP_442162.1_9 Reverse -263 -270 3.4807 0.246
NP_442162.1_9 Forward -270 -263 3.38237 0.276
NP_440671.1_4 Reverse -8 -22 10.1277 0.164
NP_440671.1_5 Forward -62 -48 13.7653 0.293
NP_441973.1_1 Forward -383 -368 1.15987 0.235
NP_440875.1_9 Reverse -357 -367 8.27469 0.233
NP_440590.1_4 Forward -373 -360 -0.177378 0.179
NP_442497.1_10 Forward -270 -261 0.589713 0.153
NP_441239.1_9 Forward -25 -13 4.8572 0.239
NP_441951.1_4 Forward -139 -120 0.294447 0.297
NP_440156.1_4 Forward -208 -198 8.63269 0.281
NP_441727.1_8 Forward -173 -154 8.45592 0.189
NP_442044.1_1 Reverse -14 -33 -5.60541 0.188
NP_442044.1_1 Forward -364 -345 -8.35868 0.251
NP_442643.1_7 Forward -62 -43 2.45773 0.288
NP_441017.1_6 Reverse -4 -18 11.897 0.24
NP_441874.1_1 Forward -360 -346 13.4709 0.213
NP_440900.1_1 Forward -367 -348 7.96426 0.292
NP_440500.1_4 Reverse -377 -396 15.4374 0.202
NP_440055.1_10 Forward -291 -273 19.4671 0.129
NP_440868.1_8 Reverse -50 -69 -4.91709 0.272
NP_442499.1_3 Forward -32 -14 5.32902 0.282
NP_442479.1_9 Forward -194 -175 -13.9635 0.294
NP_442402.1_5 Reverse -165 -184 18.289 0.132
NP_441848.1_4 Reverse -101 -117 7.74165 0.288
NP_442409.1_5 Forward -142 -123 14.7491 0.238
NP_442409.1_5 Reverse -125 -144 13.7658 0.238
NP_440825.1_7 Reverse -263 -273 11.7385 0.214
NP_442053.1_1 Reverse -365 -374 4.12963 0.267
NP_440505.1_3 Reverse -363 -373 4.40493 0.292
NP_441701.1_3 Reverse -362 -379 11.0519 0.213
NP_441252.1_6 Reverse -180 -187 11.6422 0.288
NP_442532.1_7 Reverse -174 -188 1.67122 0.274
NP_440914.1_1 Reverse -262 -272 10.2742 0.147
NP_442533.1_6 Forward -140 -131 7.57121 0.0898
NP_442533.1_6 Reverse -127 -136 7.57121 0.0898
NP_442533.1_6 Forward -23 -14 2.16301 0.27
NP_442541.1_10 Forward -141 -127 2.5556 0.255
NP_442269.1_10 Reverse -348 -367 2.26107 0.28
NP_441527.1_4 Reverse -26 -45 -6.7326 0.224
NP_440007.1_9 Reverse -10 -24 11.5043 0.163
NP_440007.1_9 Reverse -224 -238 3.44117 0.269
NP_440007.1_9 Reverse -374 -388 2.94952 0.277
NP_440007.1_9 Reverse -134 -148 1.96621 0.281
NP_443045.1_2 Forward -133 -114 17.3057 0.181
NP_441602.1_3 Reverse -229 -248 -3.73712 0.252
NP_441602.1_3 Forward -178 -159 -5.9004 0.3
NP_441286.1_1 Forward -272 -260 -4.77924 0.175
NP_442674.1_2 Forward -187 -168 10.9142 0.208
NP_440670.1_8 Forward -271 -262 5.3096 0.167
NP_440670.1_8 Reverse -262 -271 4.32629 0.199
NP_441479.1_9 Reverse -371 -389 13.2938 0.281
NP_441930.1_2 Reverse -137 -147 14.3364 0.226
NP_441930.1_2 Reverse -377 -387 12.8614 0.248
NP_440886.1_7 Forward -58 -48 6.27276 0.134
NP_440886.1_7 Forward -184 -174 4.89613 0.213
NP_442614.1_2 Reverse -54 -68 5.80112 0.297
NP_441021.1_1 Forward -146 -127 -6.68705 0.18
NP_442211.1_9 Forward -185 -166 6.68596 0.185
NP_441431.1_2 Reverse -259 -273 5.50552 0.298
NP_441431.1_3 Reverse -222 -241 3.6377 0.263
NP_441836.1_2 Reverse -48 -67 -6.58872 0.3
NP_441174.1_2 Forward -195 -181 13.5693 0.196
NP_440358.1_8 Forward -292 -273 -0.688862 0.272
NP_440287.1_5 Forward -243 -224 6.78348 0.29
NP_440422.1_10 Reverse -173 -192 4.40189 0.289
NP_440457.1_1 Reverse -10 -22 6.92215 0.108
NP_440213.1_5 Forward -21 -2 7.47261 0.289
NP_440801.1_10 Forward -367 -348 5.50599 0.289
NP_440942.1_7 Forward -256 -237 16.2241 0.252
NP_441332.1_6 Forward -24 -14 10.7754 0.287
NP_442509.1_9 Reverse -164 -174 10.501 0.173
NP_442514.1_5 Forward -143 -124 -0.787962 0.189
NP_442514.1_5 Reverse -124 -143 -1.37794 0.199
NP_440478.1_10 Forward -62 -48 8.65272 0.257
NP_442341.1_7 Forward -24 -10 3.53951 0.22
NP_442341.1_9 Reverse -363 -377 7.66879 0.192
NP_441756.1_5 Forward -138 -119 -3.83545 0.29
NP_442534.1_7 Reverse -347 -366 17.994 0.163
NP_440679.1_10 Forward -366 -347 -21.83 0.3
NP_442638.1_3 Reverse -266 -285 11.0289 0.298
NP_442638.1_3 Forward -197 -178 10.7424 0.298
NP_442495.1_4 Forward -143 -133 12.4681 0.226
NP_442495.1_4 Reverse -358 -368 12.0747 0.25
NP_442591.1_7 Reverse -169 -188 7.66927 0.248
NP_441105.1_3 Forward -146 -127 9.83255 0.0449
NP_441105.1_3 Reverse -121 -140 0.982764 0.118
NP_440172.1_1 Reverse -183 -193 11.6814 0.0359
NP_442015.1_10 Reverse -361 -374 7.49244 0.0855
NP_441226.1_7 Reverse -263 -270 8.59356 0.197
NP_441111.1_7 Forward -270 -262 -0.570565 0.233
NP_442252.1_3 Forward -154 -136 9.0656 0.244
NP_440416.1_9 Forward -381 -362 -1.47551 0.0652
NP_440416.1_9 Forward -148 -129 -19.7651 0.278
NP_443052.1_9 Forward -67 -48 0.294447 0.2
NP_443052.1_9 Reverse -43 -62 -4.03212 0.254
NP_440820.2_8 Reverse -347 -366 13.8641 0.249
NP_441940.1_4 Reverse -130 -149 7.07928 0.286
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACGGGTTAGTCATCCCATTTCCCTTGACGCTCCCCGGCGCATGGATGACGGCGAAATTGACTGGGACATTGAATCTGATTACCCCAGTCCCGATGAAACTTTATCCACTGCTGAATTTTATGAATGTTTGCGTTCGGCCATTAAGGACCTACCTGAAGCTTTCCGCACCACCATTATCCTGCGGGAAATTGACGGTTTAGCCTACGAAGAAATTGCCGAAATCACCGGGGTTTCCCTCGGGACGGTTAAATCTCGCATTGCCCGGGCCCGGGCGAAGTTGCAAACTTTTTTACAGCCCTATTTGGCTTCCTAAGCCCACCCTAAACATTGAATCCTAGCTTCCGCCACCAGCAATGGTTTTTATTATTGGTGTTAGTCCCATCACCCTTGGTCTAGGGA

CDS

GTGTCCAACTTTGTGAGGAGTGAATCGGCCAGAGTTAATAACAAACAGCTAATTCACTATTACTTGTCGGTGGAGATTCCCCCGAAGAGGTTTACTATGAATTCAAAATTTGACTTTGATTGTCCACGGCAGCCTTGGGATGGAGCTGAACCTGGAAATGAGGATTTATTGTTTGATGAAAAATTTGAGCTGTTGAGTGCTTACATTGACGGGGAGGTTACCCCCCAAGAGAAGAAACAGGTACAAGGCTGGATTGATAGCGACCCAGAGTTTAAGCAGACCTATCTGGGGTTGATTCGTTTGCAAAACGCTTTGCCCCAAGTGCCAGTGCCGCCGGCTATTGACGCCGATGTGTTGGCCCAGAGGGTATTTGCCAAACTAGAGCAGGAAAATCGTTGGCGTGGTATTTGGTTCTGGGGTAGTGTGACTGCCGCCGCTGTGGTGGTGGCCGCCTACTCTAGTATTCTGGGTAAACCCTTGGTTCCTTCTCTGAATCAGGCTAATTTGGACCCGGCGATCGTAGCCATGGATGAAGATCCTTTGATGGTTGCCATCCACGAGCCGATGTTTGAAGTGTTAACCAAAGTGGACCCTGGCCATGGGCCCGAAAATGAGGGAGCGGAACAAGGGCTGCATTAA

Protein

MSNFVRSESARVNNKQLIHYYLSVEIPPKRFTMNSKFDFDCPRQPWDGAEPGNEDLLFDEKFELLSAYIDGEVTPQEKKQVQGWIDSDPEFKQTYLGLIRLQNALPQVPVPPAIDADVLAQRVFAKLEQENRWRGIWFWGSVTAAAVVVAAYSSILGKPLVPSLNQANLDPAIVAMDEDPLMVAIHEPMFEVLTKVDPGHGPENEGAEQGLH