Your browser is old and dusty. Try Google Chrome!

Details for slr1544

ORF slr1544
Accession NP_440790.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -84 -70 6.78443 0.114
NP_441418.1_6 Forward -84 -65 -29.5982 0.23
NP_441418.1_6 Reverse -219 -238 -30.2865 0.267
NP_441818.1_9 Reverse -208 -227 -9.73531 0.291
NP_439997.1_6 Forward -128 -109 10.0292 0.212
NP_441812.1_1 Forward -393 -379 16.0269 0.193
NP_442975.1_10 Forward -232 -218 1.67063 0.293
NP_441054.1_2 Reverse -327 -346 11.1109 0.271
NP_441859.1_3 Forward -275 -256 5.11187 0.206
NP_441492.1_5 Forward -311 -292 4.99194 0.237
NP_439923.1_10 Forward -249 -230 16.3224 0.11
NP_441208.1_9 Forward -252 -238 6.09611 0.253
NP_440769.1_8 Reverse -336 -355 7.86593 0.248
NP_441083.1_5 Forward -274 -264 5.38824 0.12
NP_441942.1_6 Reverse -224 -243 14.0859 0.245
NP_442136.1_1 Forward -340 -321 7.07928 0.265
NP_441713.1_1 Reverse -376 -395 -14.2585 0.257
NP_441025.1_6 Reverse -313 -332 1.82439 0.28
NP_441854.1_10 Forward -251 -232 6.78429 0.216
NP_442145.1_4 Forward -330 -311 12.1748 0.125
NP_442145.1_4 Forward -340 -321 11.1244 0.136
NP_442145.1_4 Reverse -290 -309 2.62561 0.299
NP_442634.1_4 Reverse -263 -277 2.06454 0.147
NP_442634.1_4 Forward -86 -72 -4.03198 0.179
NP_441667.1_5 Forward -364 -350 16.8237 0.254
NP_440470.1_5 Reverse -323 -342 14.0846 0.158
NP_440842.1_4 Forward -339 -320 10.197 0.0869
NP_440842.1_4 Forward -329 -310 3.3521 0.207
NP_441014.1_10 Reverse -264 -283 1.17865 0.231
NP_443018.1_3 Forward -210 -203 8.49558 0.141
NP_441797.1_7 Reverse -5 -23 9.85225 0.292
NP_440781.1_1 Forward -133 -119 11.5043 0.289
NP_441029.1_3 Reverse -64 -83 3.24438 0.277
NP_441763.1_10 Reverse -229 -248 8.4551 0.216
NP_442658.1_1 Reverse -68 -78 4.89613 0.292
NP_440141.1_8 Reverse -193 -212 14.9458 0.151
NP_440184.1_1 Forward -348 -329 13.5949 0.0864
NP_441127.1_1 Forward -103 -89 11.111 0.233
NP_442685.1_7 Forward -141 -124 18.7209 0.162
NP_440203.1_5 Reverse -97 -107 11.8776 0.171
NP_442690.1_1 Reverse -323 -342 -2.36049 0.136
NP_442911.1_2 Forward -259 -240 -5.50708 0.16
NP_440993.1_5 Forward -285 -267 18.7012 0.101
NP_441646.1_1 Forward -256 -237 -0.197208 0.259
NP_441646.1_7 Forward -70 -56 12.9793 0.299
NP_442438.1_10 Forward -254 -240 1.57289 0.191
NP_440147.1_4 Forward -31 -18 0.314277 0.257
NP_441916.1_5 Reverse -28 -47 15.3391 0.273
NP_440465.1_3 Forward -120 -101 15.2408 0.299
NP_441041.1_7 Reverse -239 -251 7.90349 0.154
NP_441725.1_5 Forward -210 -200 3.61828 0.115
NP_440983.1_9 Forward -258 -239 1.76941 0.292
NP_442281.1_1 Forward -34 -20 9.53707 0.0685
NP_442281.1_1 Forward -108 -94 5.1122 0.169
NP_441079.1_7 Reverse -129 -148 -4.91784 0.257
NP_442012.1_2 Reverse -6 -25 10.8159 0.134
NP_440375.1_8 Reverse -203 -222 6.88262 0.166
NP_441644.1_6 Forward -84 -74 3.61784 0.272
NP_442215.1_2 Reverse -92 -108 -1.51476 0.186
NP_441751.2_8 Reverse -266 -280 -6.88358 0.289
NP_441751.2_8 Forward -248 -234 -6.98191 0.294
NP_442554.1_8 Reverse -76 -86 4.60159 0.18
NP_442554.1_8 Forward -83 -73 1.94665 0.288
NP_442142.1_4 Forward -20 -7 3.26365 0.262
NP_440895.1_8 Forward -139 -125 16.0275 0.231
NP_440405.1_6 Reverse -198 -216 2.0841 0.268
NP_440158.1_1 Forward -317 -298 15.517 0.0997
NP_441020.2_6 Reverse -238 -255 6.82368 0.251
NP_441637.1_9 Forward -145 -127 0.21581 0.292
NP_441764.1_1 Reverse -312 -331 18.7807 0.0481
NP_441764.1_4 Reverse -310 -327 17.3345 0.0666
NP_441764.1_4 Reverse -320 -337 13.9923 0.154
NP_441764.1_4 Reverse -300 -317 9.88619 0.273
NP_442868.1_6 Forward -86 -76 0.471689 0.226
NP_441612.1_2 Forward -274 -264 15.1326 0.21
NP_440789.1_1 Forward -329 -310 21.6314 0.0189
NP_440145.1_3 Forward -39 -20 -3.44213 0.198
NP_441114.1_3 Reverse -96 -105 7.37455 0.239
NP_440558.1_2 Forward -395 -376 -2.95047 0.232
NP_440558.1_2 Forward -214 -195 -6.29373 0.273
NP_441048.1_6 Forward -343 -329 15.8633 0.296
NP_442789.1_4 Reverse -263 -282 -4.6221 0.261
NP_440923.1_1 Forward -330 -312 27.7476 0.0000545
NP_441557.1_8 Forward -258 -248 10.9926 0.269
NP_441445.1_1 Reverse -225 -244 -0.590531 0.297
NP_442066.2_9 Reverse -16 -29 6.31247 0.297
NP_441433.1_8 Forward -108 -89 1.47442 0.236
NP_442347.1_2 Forward -206 -197 4.42462 0.284
NP_442317.1_8 Reverse -298 -317 18.3873 0.134
NP_441007.1_10 Reverse -217 -230 0.117615 0.25
NP_440709.1_1 Forward -341 -322 15.7316 0.0302
NP_440709.1_1 Forward -331 -312 14.2566 0.0386
NP_440709.1_1 Forward -321 -302 12.1917 0.0464
NP_440709.1_2 Forward -326 -312 23.5 0.000895
NP_441559.1_8 Forward -212 -198 -6.88358 0.281
NP_442756.1_2 Forward -144 -125 4.32602 0.296
NP_442158.1_4 Reverse -371 -381 12.2714 0.253
NP_441179.1_9 Reverse -119 -129 14.2375 0.246
NP_442069.1_10 Forward -28 -10 17.2271 0.0593
NP_442866.1_1 Forward -132 -113 1.86774 0.158
NP_442866.1_1 Reverse -217 -236 -8.06369 0.275
NP_440702.1_2 Reverse -223 -242 -6.39206 0.257
NP_441199.1_6 Forward -253 -234 0.491109 0.242
NP_441199.1_7 Reverse -309 -328 5.50599 0.231
NP_442386.1_8 Forward -256 -237 13.6675 0.264
NP_441271.1_8 Reverse -10 -20 17.4829 0.198
NP_441132.1_2 Reverse -350 -369 8.55425 0.163
NP_440586.1_1 Reverse -233 -252 -4.03212 0.277
NP_442251.1_6 Reverse -21 -28 6.43063 0.298
NP_440027.1_4 Forward -338 -319 11.4512 0.0706
NP_439937.1_8 Forward -242 -223 -5.11376 0.286
NP_439937.1_9 Forward -252 -235 -13.4331 0.286
NP_441167.1_1 Reverse -319 -338 12.2908 0.109
NP_440408.1_7 Forward -84 -65 8.84924 0.267
NP_442239.1_5 Reverse -301 -320 11.3255 0.259
NP_441789.1_7 Forward -216 -197 -2.75457 0.262
NP_441803.1_2 Reverse -235 -254 1.37609 0.232
NP_440267.1_2 Forward -34 -20 4.62054 0.3
NP_441877.1_9 Reverse -330 -347 1.41547 0.297
NP_442572.1_1 Forward -129 -110 9.3409 0.254
NP_442262.1_10 Forward -210 -203 8.59391 0.22
NP_440282.1_10 Reverse -65 -84 -6.09707 0.25
NP_440297.1_9 Forward -83 -73 0.0783647 0.282
NP_440937.1_5 Forward -133 -114 8.55425 0.281
NP_440999.1_2 Reverse -44 -63 10.5209 0.245
NP_440999.1_9 Reverse -261 -275 -3.34366 0.291
NP_442710.1_7 Reverse -315 -334 -1.45616 0.221
NP_442337.1_8 Reverse -270 -289 0.982764 0.241
NP_440148.1_6 Reverse -334 -348 16.157 0.3
NP_441621.1_7 Reverse -238 -252 -4.4253 0.223
NP_441621.1_7 Forward -251 -237 -4.91696 0.248
NP_440519.1_8 Forward -84 -68 5.27008 0.21
NP_440504.1_7 Reverse -196 -215 -4.72043 0.295
NP_442780.1_1 Reverse -314 -333 6.98095 0.291
NP_440454.1_2 Forward -342 -328 10.2293 0.291
NP_442120.1_10 Reverse -82 -101 -13.4719 0.285
NP_440673.1_3 Reverse -96 -103 8.98723 0.203
NP_440673.1_3 Forward -66 -59 6.3323 0.283
NP_440865.1_9 Reverse -234 -253 -1.57384 0.178
NP_441052.1_2 Forward -274 -264 4.10993 0.166
NP_442219.1_8 Reverse -164 -183 7.20077 0.275
NP_441004.1_1 Reverse -234 -253 -17.6018 0.292
NP_441004.1_1 Reverse -225 -244 -17.7985 0.294
NP_440129.1_9 Forward -83 -64 6.39097 0.293
NP_440296.1_6 Reverse -327 -345 9.83765 0.298
NP_442694.1_4 Forward -138 -129 11.9961 0.275
NP_440593.1_3 Reverse -223 -242 -4.42544 0.248
NP_440463.1_8 Forward -253 -234 5.75726 0.277
NP_440338.1_4 Forward -342 -323 11.8967 0.15
NP_442689.1_8 Reverse -327 -344 -6.15601 0.28
NP_441349.1_10 Reverse -170 -189 -8.752 0.278
NP_442843.1_1 Forward -102 -83 0.884433 0.17
NP_441031.1_1 Forward -343 -324 11.161 0.193
NP_441031.1_1 Reverse -317 -336 6.53351 0.267
NP_441570.1_1 Reverse -265 -283 0.609134 0.0379
NP_441570.1_1 Reverse -377 -395 -11.2889 0.191
NP_441078.1_4 Forward -249 -240 -1.18024 0.237
NP_441078.1_4 Reverse -240 -249 -1.96689 0.282
NP_442729.1_5 Reverse -207 -217 7.74818 0.271
NP_441432.1_8 Forward -104 -95 5.50626 0.151
NP_443024.1_2 Forward -210 -197 17.8166 0.156
NP_443024.1_3 Reverse -380 -390 10.5014 0.289
NP_441732.1_2 Forward -278 -262 -8.39793 0.138
NP_440629.1_1 Reverse -313 -331 7.09898 0.152
NP_442157.1_8 Forward -222 -203 12.7816 0.269
NP_440578.1_8 Reverse -222 -241 10.7175 0.284
NP_440578.1_8 Forward -127 -108 9.83255 0.296
NP_442298.1_4 Reverse -332 -346 18.728 0.271
NP_440913.1_1 Forward -86 -68 6.60732 0.224
NP_442400.1_10 Forward -353 -340 14.672 0.173
NP_441659.2_8 Forward -84 -74 2.83163 0.187
NP_441022.1_1 Forward -345 -336 12.6973 0.232
NP_440363.1_9 Reverse -220 -238 12.1139 0.291
NP_442776.1_1 Forward -40 -21 5.211 0.256
NP_442346.1_5 Forward -85 -75 9.61647 0.118
NP_440352.1_5 Reverse -96 -115 11.001 0.267
NP_440545.1_3 Reverse -236 -253 -3.40274 0.203
NP_440250.1_4 Reverse -324 -343 5.89851 0.253
NP_440010.1_4 Forward -232 -213 4.03023 0.22
NP_442828.1_5 Forward -309 -290 10.815 0.289
NP_441593.1_2 Reverse -347 -366 10.8159 0.183
NP_441329.1_1 Reverse -298 -317 12.7478 0.175
NP_441329.1_3 Forward -350 -340 14.8103 0.25
NP_441895.1_10 Reverse -195 -214 -27.5332 0.282
NP_442055.1_10 Forward -78 -59 16.1257 0.218
NP_440671.1_1 Reverse -320 -339 9.76781 0.191
NP_440671.1_4 Forward -177 -163 6.09611 0.261
NP_442821.1_3 Forward -155 -136 12.0942 0.124
NP_442045.1_5 Forward -214 -195 1.86774 0.261
NP_440594.1_6 Forward -249 -230 5.80018 0.279
NP_439901.1_1 Reverse -167 -186 1.96607 0.289
NP_441239.1_9 Reverse -73 -85 3.2839 0.289
NP_442897.1_3 Reverse -264 -283 22.9106 0.0129
NP_440604.1_6 Forward -249 -230 -5.31042 0.271
NP_441508.1_1 Reverse -313 -332 19.3036 0.0922
NP_441508.1_1 Reverse -323 -342 16.5164 0.101
NP_441508.1_1 Forward -337 -318 12.3837 0.23
NP_442629.1_5 Reverse -372 -386 15.1426 0.279
NP_441541.1_7 Forward -349 -331 12.7678 0.218
NP_440833.1_6 Forward -220 -206 7.66879 0.278
NP_442138.1_10 Forward -76 -57 -7.17871 0.286
NP_442052.1_8 Forward -19 -9 12.2714 0.282
NP_440546.1_6 Forward -259 -240 8.35759 0.259
NP_442499.1_3 Forward -250 -232 3.65739 0.289
NP_442812.1_10 Forward -222 -203 16.1257 0.135
NP_441474.1_1 Forward -381 -362 -2.75457 0.285
NP_441848.1_7 Forward -221 -202 -0.591301 0.244
NP_442039.1_7 Forward -190 -180 6.8632 0.292
NP_440160.1_1 Reverse -308 -327 11.969 0.205
NP_440548.1_3 Reverse -377 -396 18.1907 0.133
NP_440914.1_1 Reverse -70 -80 7.24882 0.242
NP_442533.1_6 Reverse -75 -84 4.0313 0.194
NP_440263.1_3 Forward -83 -64 9.63589 0.22
NP_442232.1_3 Reverse -232 -251 -15.8318 0.296
NP_443016.1_1 Reverse -2 -21 -6.98204 0.265
NP_441697.1_5 Forward -334 -315 -6.54162 0.232
NP_441697.1_5 Forward -344 -325 -7.01908 0.239
NP_440816.1_2 Forward -349 -330 6.82221 0.27
NP_442202.1_4 Forward -254 -240 13.611 0.252
NP_441527.1_4 Forward -312 -293 -9.2154 0.255
NP_441972.1_5 Forward -89 -70 -7.08038 0.241
NP_441106.1_3 Forward -331 -312 19.174 0.0559
NP_441106.1_3 Reverse -329 -348 16.7157 0.103
NP_441106.1_3 Forward -341 -322 11.6025 0.217
NP_439903.1_6 Reverse -219 -238 2.35861 0.227
NP_439903.1_6 Reverse -262 -281 -1.27961 0.295
NP_441186.1_4 Forward -349 -339 15.3192 0.238
NP_442614.1_2 Forward -171 -157 7.37441 0.275
NP_439899.1_1 Reverse -309 -327 9.73552 0.165
NP_439899.1_1 Reverse -299 -317 4.28466 0.268
NP_442022.1_4 Reverse -222 -241 6.58763 0.27
NP_441463.1_2 Reverse -327 -345 8.05944 0.14
NP_442615.1_1 Reverse -231 -249 -5.38906 0.212
NP_440358.1_8 Reverse -375 -394 5.40766 0.189
NP_440935.1_3 Reverse -279 -298 16.7157 0.167
NP_441510.2_7 Reverse -121 -135 13.9619 0.28
NP_441237.1_9 Forward -210 -200 11.5831 0.17
NP_442942.1_5 Reverse -202 -221 9.83255 0.238
NP_441981.1_3 Reverse -238 -252 15.8666 0.268
NP_440054.1_4 Forward -291 -272 11.1109 0.22
NP_441489.1_3 Forward -350 -336 8.89237 0.232
NP_442582.1_3 Forward -342 -328 14.7174 0.21
NP_441275.1_1 Forward -330 -312 10.7372 0.0571
NP_442341.1_9 Forward -87 -73 4.8172 0.291
NP_440552.1_8 Forward -317 -300 14.9489 0.141
NP_440552.1_8 Forward -327 -310 9.79232 0.287
NP_442513.1_5 Reverse -208 -227 7.07848 0.282
NP_441397.1_3 Reverse -305 -324 12.1917 0.293
NP_441122.1_1 Forward -134 -119 9.22301 0.28
NP_441207.1_7 Forward -345 -331 7.90002 0.293
NP_440175.1_7 Reverse -218 -236 11.2174 0.235
NP_442495.1_5 Forward -248 -229 5.89931 0.291
NP_440216.1_9 Forward -102 -93 7.96454 0.286
NP_440216.1_9 Reverse -123 -132 7.27622 0.286
NP_440216.1_9 Forward -399 -390 5.70292 0.29
NP_440216.1_9 Reverse -96 -105 5.50626 0.292
NP_441485.1_8 Forward -141 -122 17.6007 0.137
NP_441757.1_3 Forward -85 -66 9.53756 0.0935
NP_440416.1_9 Forward -212 -193 -19.9617 0.281
NP_442154.1_1 Forward -70 -52 -18.3687 0.281
NP_442154.1_1 Reverse -208 -226 -18.9587 0.288
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCTAGGCAAGCAATTCGTCCACCAACAAAAAGCTCTTTTGGTCAACAGACTTGACAAAAATCTTAACAATACGTTACATTTATTTACATAAGGTTACAAAATAAAAACCTCAAATACCCAATCAAGGAGATCAACACTATGACTAGCCGCGGATTTCGCCTCGACCAAGACAACCGTCTCAACAACTTCGCCATTGAACCCCCTGTGTACGTTGACAGCAGTGTTCAAGCCGGTTGGACTGAATACGCCGAAAAAATGAATGGTCGTTTTGCCATGATTGGCTTTGTTTCTCTCTTGGCAATGGAAGTAATTACTGGCCACGGCATTGTGGGTTGGTTGCTCTCTCTCTAATTGGCTGGGTGCATAACCAAGCAATCTACTGAACCAGGGCCTAGCTCC

CDS

ATGAACTACCAAAGGACTGCCCTTGGCACCGTGAAAATCGAACAAATAAGAGGTAAAACTATGAACGCCGACACTGATATTTATCAAAACAAAGATCTATTTGCCCCCGTTGTCTTCCGCAAAGACTTCAACCAATTTGCCCCCATCAACGGGAACCAAGCCTGGTCTTTATTTTTCACCGCCGGGCAAGAAGATAAGCAACTGGGCAACAGCCCTGAATTCGGTCGCTTTTTCACCAATACTCTCTTCGCCATTGGGGCTGCCACTTTCATCTGGGGTTACTTCTTCAGCCGTTGGGCTGACTTTCTCTAA

Protein

MNYQRTALGTVKIEQIRGKTMNADTDIYQNKDLFAPVVFRKDFNQFAPINGNQAWSLFFTAGQEDKQLGNSPEFGRFFTNTLFAIGAATFIWGYFFSRWADFL