Your browser is old and dusty. Try Google Chrome!

Details for slr1534

ORF slr1534
Accession NP_441634.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -313 -327 -2.26202 0.287
NP_440795.1_7 Forward -320 -313 14.1988 0.0267
NP_440795.1_7 Forward -124 -117 7.51227 0.24
NP_441418.1_6 Forward -321 -302 -12.0953 0.0601
NP_441418.1_6 Reverse -312 -331 -30.1882 0.262
NP_441418.1_6 Forward -303 -284 -30.2865 0.267
NP_440897.1_6 Forward -321 -302 0.686995 0.179
NP_441453.1_4 Forward -321 -313 6.80426 0.121
NP_441453.1_4 Reverse -312 -320 6.70593 0.121
NP_441453.1_7 Reverse -246 -253 11.9372 0.298
NP_441623.1_1 Reverse -287 -305 5.23069 0.175
NP_441623.1_1 Forward -328 -310 -4.40575 0.274
NP_441623.1_1 Reverse -202 -220 -4.60241 0.274
NP_442151.1_6 Forward -321 -307 5.01447 0.298
NP_442838.1_7 Forward -326 -307 -2.36049 0.185
NP_441818.1_1 Forward -320 -309 14.7094 0.0449
NP_441630.1_3 Forward -311 -292 6.68596 0.126
NP_441630.1_3 Forward -50 -31 3.73603 0.186
NP_440348.1_6 Forward -71 -52 2.75272 0.279
NP_440150.1_6 Forward -324 -305 3.6377 0.245
NP_442173.1_1 Forward -320 -312 5.72262 0.203
NP_442173.1_1 Reverse -313 -321 5.72262 0.203
NP_442173.1_1 Reverse -236 -244 5.42762 0.207
NP_442752.1_4 Reverse -312 -319 13.5105 0.0314
NP_442752.1_4 Forward -321 -314 4.26735 0.293
NP_443027.1_4 Forward -323 -313 12.9597 0.0595
NP_441812.1_1 Forward -297 -283 15.5352 0.201
NP_442975.1_10 Forward -325 -311 3.44058 0.259
NP_440784.1_7 Reverse -313 -320 13.2155 0.0365
NP_440784.1_7 Forward -320 -313 12.1338 0.0604
NP_442909.1_7 Reverse -236 -250 16.6169 0.0821
NP_442062.1_8 Reverse -312 -322 9.7148 0.0559
NP_442062.1_8 Forward -321 -311 7.94484 0.0848
NP_442062.1_8 Forward -273 -263 4.69992 0.201
NP_440761.1_4 Reverse -142 -161 -11.8003 0.202
NP_440304.1_4 Reverse -310 -320 9.12481 0.0626
NP_442242.1_4 Forward -320 -313 12.0355 0.0521
NP_442242.1_4 Reverse -313 -320 11.5438 0.089
NP_440044.1_8 Reverse -313 -332 1.86774 0.161
NP_441035.1_3 Forward -324 -305 0.884433 0.245
NP_441200.1_8 Reverse -131 -150 16.5793 0.217
NP_441935.1_1 Forward -272 -253 6.78429 0.264
NP_441935.1_2 Reverse -141 -160 5.80098 0.12
NP_441208.1_1 Reverse -153 -172 -6.29373 0.287
NP_441208.1_9 Reverse -309 -323 8.06273 0.219
NP_441594.1_6 Forward -330 -311 4.916 0.211
NP_440769.1_8 Reverse -181 -200 8.45592 0.23
NP_441083.1_5 Forward -321 -311 16.7946 0.00546
NP_441083.1_5 Forward -303 -293 4.40493 0.146
NP_441083.1_5 Reverse -312 -322 1.74999 0.198
NP_442827.1_8 Forward -329 -310 5.99684 0.113
NP_441149.1_9 Forward -343 -324 -2.16459 0.291
NP_441434.1_7 Reverse -314 -328 4.81781 0.225
NP_441738.1_4 Forward -331 -312 11.0125 0.149
NP_441558.1_7 Forward -165 -146 11.8975 0.212
NP_440209.1_1 Forward -321 -313 8.37755 0.0576
NP_440209.1_1 Reverse -312 -320 8.27922 0.0687
NP_442889.1_8 Forward -324 -310 7.27547 0.156
NP_441713.1_1 Forward -327 -308 -14.5535 0.259
NP_441770.1_10 Reverse -310 -329 10.7175 0.23
NP_440178.1_7 Reverse -311 -330 -11.9969 0.111
NP_440178.1_7 Reverse -293 -312 -22.715 0.272
NP_441025.1_5 Reverse -7 -21 13.7659 0.294
NP_442445.1_2 Forward -230 -211 11.6025 0.288
NP_441716.1_1 Forward -321 -307 20.0591 0.00829
NP_441598.1_1 Forward -340 -321 6.88262 0.295
NP_442111.1_4 Forward -322 -308 3.8345 0.229
NP_440906.1_5 Reverse -313 -320 13.3138 0.0268
NP_440906.1_5 Forward -320 -313 6.13563 0.241
NP_440747.1_10 Forward -324 -312 -11.7607 0.142
NP_440747.1_10 Reverse -309 -321 -11.7607 0.142
NP_441130.1_10 Reverse -310 -324 14.3559 0.0483
NP_441486.1_1 Forward -324 -310 2.2612 0.0868
NP_441486.1_1 Reverse -309 -323 -5.9986 0.272
NP_442760.1_7 Forward -308 -289 24.9755 0.0054
NP_440403.1_10 Reverse -312 -331 2.26107 0.279
NP_441695.1_4 Forward -161 -143 12.4089 0.225
NP_441014.1_5 Reverse -352 -370 9.85225 0.272
NP_441014.1_10 Reverse -311 -330 -1.18128 0.257
NP_442848.1_4 Reverse -228 -242 9.34103 0.282
NP_443018.1_3 Forward -320 -313 5.15232 0.226
NP_443018.1_3 Reverse -313 -320 5.05399 0.238
NP_441634.1_8 Reverse -310 -324 2.65453 0.166
NP_440376.1_1 Reverse -312 -321 9.83282 0.0339
NP_440376.1_1 Forward -321 -312 9.73449 0.0365
NP_442687.1_7 Reverse -311 -321 17.5813 0.0089
NP_442687.1_7 Forward -322 -312 6.07655 0.179
NP_442485.1_3 Reverse -142 -161 -1.7705 0.261
NP_442485.1_3 Forward -332 -313 -3.3438 0.273
NP_441846.1_10 Reverse -359 -378 -23.2067 0.279
NP_440642.1_10 Forward -341 -327 9.83206 0.178
NP_442658.1_1 Forward -323 -313 9.12434 0.167
NP_442658.1_1 Reverse -262 -272 5.78111 0.25
NP_442658.1_1 Reverse -310 -320 4.99446 0.288
NP_440656.1_8 Forward -332 -313 -2.16383 0.184
NP_442544.1_2 Forward -398 -384 -0.885388 0.252
NP_440720.1_6 Reverse -175 -193 16.0471 0.281
NP_440607.1_9 Reverse -283 -302 17.1898 0.243
NP_442937.1_5 Forward -326 -307 11.4058 0.14
NP_442937.1_5 Reverse -204 -223 9.0459 0.204
NP_441958.1_5 Reverse -311 -321 10.6981 0.0112
NP_441958.1_5 Forward -322 -312 2.53664 0.0409
NP_441958.1_5 Forward -274 -264 -1.98659 0.265
NP_440203.1_5 Forward -91 -81 9.12434 0.271
NP_443001.1_5 Forward -98 -79 16.6174 0.152
NP_440153.1_8 Forward -324 -311 -3.71729 0.299
NP_441591.1_10 Forward -323 -304 4.71934 0.297
NP_442064.1_4 Reverse -199 -218 4.62021 0.286
NP_442536.1_9 Reverse -22 -41 17.6007 0.166
NP_443055.1_6 Forward -329 -311 4.54162 0.181
NP_443055.1_6 Reverse -294 -312 -0.964891 0.271
NP_443055.1_6 Reverse -312 -330 -1.16155 0.273
NP_441099.1_5 Forward -331 -312 -7.57203 0.177
NP_441099.1_5 Reverse -302 -321 -12.0953 0.294
NP_442002.1_9 Reverse -84 -91 11.3472 0.185
NP_442002.1_9 Forward -322 -315 10.7572 0.185
NP_440809.1_9 Reverse -303 -321 -7.65067 0.225
NP_441294.1_7 Forward -325 -311 12.5142 0.0944
NP_442438.1_10 Forward -326 -312 10.3243 0.0547
NP_441000.1_6 Reverse -311 -325 4.42448 0.0953
NP_441000.1_6 Forward -322 -308 0.491246 0.192
NP_442771.1_1 Reverse -310 -328 1.29745 0.081
NP_440147.1_4 Reverse -310 -323 2.2809 0.209
NP_440147.1_4 Forward -323 -310 0.60927 0.249
NP_440147.1_4 Reverse -292 -305 0.215946 0.261
NP_441550.1_8 Reverse -310 -320 12.8609 0.0296
NP_441550.1_8 Forward -323 -313 5.38779 0.252
NP_441916.1_7 Reverse -312 -322 8.63316 0.0437
NP_441916.1_7 Forward -321 -311 7.15819 0.0745
NP_440465.1_10 Reverse -309 -328 1.57275 0.275
NP_441041.1_1 Reverse -141 -160 9.53756 0.221
NP_441041.1_7 Forward -324 -312 10.3329 0.1
NP_441041.1_7 Reverse -82 -94 10.0414 0.103
NP_442004.1_6 Forward -321 -307 2.5562 0.263
NP_441725.1_4 Forward -263 -249 4.22722 0.278
NP_441725.1_5 Forward -320 -310 11.2881 0.0247
NP_441725.1_5 Reverse -313 -323 -0.806614 0.271
NP_439966.1_7 Forward -323 -313 7.94438 0.145
NP_439966.1_8 Reverse -291 -310 18.9773 0.0421
NP_439966.1_9 Forward -323 -314 0.983037 0.253
NP_440202.1_8 Forward -338 -319 9.90358 0.297
NP_442941.1_3 Forward -320 -310 8.82982 0.0333
NP_440289.1_2 Forward -324 -311 12.8023 0.0139
NP_440289.1_2 Reverse -309 -322 -3.12731 0.265
NP_440289.1_2 Forward -97 -84 -3.81562 0.271
NP_440983.1_5 Forward -244 -225 -5.80207 0.273
NP_441678.1_9 Reverse -344 -363 -2.95047 0.273
NP_442281.1_1 Forward -326 -312 7.66879 0.0949
NP_441334.1_7 Forward -323 -304 -21.3384 0.296
NP_440437.1_1 Reverse -306 -325 9.3409 0.0514
NP_441457.1_7 Reverse -310 -329 5.60432 0.186
NP_440498.1_3 Forward -167 -148 35.4969 0.00000367
NP_441644.1_6 Forward -321 -311 12.4676 0.0321
NP_441644.1_6 Reverse -264 -274 5.38779 0.194
NP_442215.1_2 Forward -323 -307 -1.02311 0.177
NP_442029.1_1 Reverse -300 -319 -14.3569 0.272
NP_440253.1_2 Reverse -312 -330 10.6389 0.0381
NP_440929.1_8 Forward -321 -312 9.53783 0.0296
NP_440929.1_8 Reverse -312 -321 9.4395 0.0326
NP_440469.1_8 Forward -149 -130 9.53756 0.295
NP_442933.1_10 Reverse -312 -321 13.9627 0.0192
NP_442933.1_10 Forward -321 -312 7.86621 0.103
NP_441751.2_8 Forward -320 -306 -4.22864 0.166
NP_439922.1_6 Reverse -82 -100 15.9488 0.285
NP_442554.1_8 Reverse -313 -323 6.46988 0.117
NP_442554.1_8 Forward -320 -310 5.09324 0.161
NP_441762.1_7 Reverse -311 -323 11.1504 0.0142
NP_441762.1_7 Forward -322 -310 -7.53251 0.293
NP_442142.1_4 Forward -324 -311 3.16532 0.265
NP_442292.1_1 Reverse -313 -322 0.196389 0.234
NP_442292.1_1 Forward -320 -311 -0.196935 0.239
NP_441525.1_1 Reverse -260 -273 13.294 0.244
NP_443009.1_5 Reverse -311 -322 16.971 0.00677
NP_442408.2_1 Forward -321 -302 -6.58872 0.282
NP_441715.1_4 Forward -320 -310 7.25653 0.108
NP_440015.1_9 Forward -321 -303 1.10079 0.242
NP_440379.1_5 Reverse -144 -163 -9.83364 0.267
NP_441468.1_1 Reverse -313 -320 6.3323 0.202
NP_441468.1_1 Forward -320 -313 6.13563 0.209
NP_441020.2_6 Reverse -310 -327 8.39697 0.2
NP_441020.2_6 Forward -305 -288 7.41366 0.232
NP_441673.1_1 Forward -321 -312 11.1111 0.0121
NP_441673.1_1 Reverse -312 -321 11.0128 0.018
NP_441826.1_2 Reverse -306 -320 -0.0987402 0.204
NP_441637.1_9 Forward -354 -336 -1.45582 0.292
NP_442719.1_2 Reverse -10 -28 -10.9946 0.286
NP_442808.1_1 Forward -322 -312 8.92768 0.0481
NP_442542.1_2 Forward -323 -310 11.1307 0.114
NP_442342.1_9 Forward -164 -148 5.17175 0.241
NP_441114.1_3 Forward -92 -83 7.37455 0.239
NP_440558.1_2 Reverse -129 -148 -2.75381 0.229
NP_442789.1_4 Reverse -310 -329 -6.58872 0.286
NP_441518.1_3 Forward -331 -312 10.7175 0.0343
NP_441878.1_6 Reverse -311 -321 10.4031 0.0176
NP_441878.1_6 Forward -322 -312 0.668351 0.139
NP_441036.1_8 Forward -322 -312 8.04317 0.177
NP_441557.1_5 Forward -321 -312 10.2261 0.0144
NP_441557.1_5 Reverse -312 -321 10.1278 0.0188
NP_441445.1_1 Reverse -303 -322 14.3558 0.0505
NP_442066.2_9 Forward -325 -312 6.60746 0.278
NP_440101.1_10 Forward -327 -308 7.66927 0.193
NP_442183.1_1 Reverse -312 -326 7.27608 0.145
NP_440190.1_9 Reverse -6 -20 21.1401 0.0908
NP_442347.1_2 Reverse -313 -322 13.3727 0.056
NP_442965.1_4 Forward -209 -190 12.4875 0.208
NP_440547.1_8 Reverse -294 -313 15.6341 0.195
NP_441037.1_4 Forward -149 -139 8.6821 0.237
NP_441037.1_4 Forward -323 -313 6.83041 0.239
NP_441633.1_3 Forward -323 -310 3.36254 0.0699
NP_441633.1_3 Reverse -310 -323 1.69091 0.109
NP_441633.1_3 Forward -392 -379 -4.79893 0.212
NP_442764.1_8 Reverse -122 -141 14.5524 0.0968
NP_440136.1_2 Reverse -313 -320 6.43063 0.154
NP_440136.1_2 Forward -320 -313 6.23397 0.171
NP_442998.1_10 Forward -216 -209 7.21728 0.144
NP_442998.1_10 Reverse -314 -321 5.93897 0.206
NP_442998.1_10 Forward -319 -312 5.84064 0.235
NP_440299.1_1 Reverse -205 -218 3.46031 0.243
NP_440299.1_1 Reverse -308 -321 3.16532 0.256
NP_441799.1_1 Reverse -308 -322 9.04542 0.1
NP_440256.1_1 Forward -276 -257 0.0977854 0.087
NP_441512.1_4 Reverse -308 -327 9.83255 0.237
NP_441559.1_8 Reverse -307 -321 -1.27871 0.182
NP_440915.1_6 Forward -325 -311 4.62115 0.0953
NP_440915.1_6 Reverse -260 -274 0.0979218 0.176
NP_440915.1_6 Reverse -149 -163 -0.983719 0.217
NP_440717.1_3 Reverse -297 -311 7.07881 0.285
NP_442785.1_7 Forward -159 -145 10.1277 0.231
NP_440243.1_1 Forward -74 -55 13.3207 0.246
NP_441464.1_8 Forward -321 -307 7.37441 0.21
NP_441199.1_6 Reverse -109 -128 -0.000545616 0.255
NP_442993.1_1 Reverse -312 -328 -9.77456 0.194
NP_442386.1_9 Reverse -263 -272 7.07914 0.219
NP_442386.1_9 Forward -322 -313 6.19416 0.23
NP_441340.1_5 Forward -320 -313 5.93897 0.198
NP_441340.1_5 Reverse -313 -320 5.84064 0.208
NP_442791.1_5 Reverse -304 -323 -6.98204 0.279
NP_442326.1_7 Reverse -218 -237 19.7631 0.264
NP_439976.1_2 Forward -173 -154 7.66846 0.272
NP_440586.1_8 Forward -320 -313 11.1501 0.0845
NP_442251.1_6 Forward -320 -313 13.7071 0.0268
NP_443051.1_1 Reverse -311 -320 8.25953 0.0414
NP_443051.1_1 Forward -322 -313 0.688044 0.134
NP_439996.1_1 Forward -237 -218 10.3242 0.234
NP_441232.1_10 Reverse -301 -320 11.3075 0.0997
NP_439984.1_1 Forward -76 -57 10.2943 0.292
NP_439937.1_9 Forward -322 -305 -6.64833 0.157
NP_439937.1_9 Reverse -293 -310 -15.4981 0.287
NP_442374.1_3 Forward -110 -93 17.5418 0.185
NP_440439.1_1 Forward -324 -311 1.88757 0.139
NP_440439.1_1 Reverse -309 -322 1.39592 0.156
NP_440372.1_2 Forward -320 -313 6.62729 0.151
NP_440372.1_2 Reverse -313 -320 6.52896 0.188
NP_441181.1_6 Reverse -313 -331 3.06741 0.283
NP_440991.1_3 Forward -89 -70 13.7658 0.234
NP_440316.1_10 Reverse -152 -162 6.66654 0.256
NP_439977.1_5 Forward -327 -308 -1.7705 0.26
NP_440139.1_1 Forward -327 -308 0.490334 0.291
NP_442384.1_10 Forward -321 -308 15.3589 0.0103
NP_440699.1_3 Forward -239 -222 17.2468 0.116
NP_442790.1_4 Reverse -107 -126 -6.68705 0.144
NP_441689.1_5 Reverse -106 -116 7.64939 0.197
NP_442244.1_6 Forward -324 -305 2.26107 0.291
NP_440344.1_10 Forward -328 -311 -1.82945 0.0577
NP_440344.1_10 Reverse -305 -322 -4.87771 0.102
NP_440531.1_6 Reverse -304 -323 -0.197208 0.205
NP_440487.1_1 Forward -324 -305 -2.55715 0.214
NP_441335.1_1 Reverse -166 -185 14.1591 0.146
NP_442065.1_7 Forward -253 -235 1.39578 0.243
NP_440297.1_9 Forward -320 -310 9.32148 0.0917
NP_441896.1_3 Forward -330 -311 7.86593 0.0928
NP_440894.1_2 Reverse -218 -237 -3.04881 0.296
NP_440894.1_10 Forward -36 -17 4.32602 0.254
NP_440894.1_10 Reverse -307 -326 2.3594 0.29
NP_440999.1_9 Forward -325 -311 2.35953 0.151
NP_440888.1_2 Reverse -312 -326 14.1586 0.02
NP_440888.1_2 Reverse -194 -208 8.75042 0.149
NP_440888.1_2 Forward -162 -148 7.27547 0.202
NP_441771.1_4 Reverse -376 -395 1.17943 0.231
NP_440491.1_1 Reverse -309 -328 7.79413 0.258
NP_440052.1_5 Reverse -224 -243 1.37609 0.165
NP_442277.1_4 Forward -330 -311 3.04693 0.231
NP_442033.1_10 Forward -323 -304 -12.9802 0.279
NP_441543.1_2 Reverse -313 -322 8.65285 0.0968
NP_441543.1_2 Forward -320 -311 6.29291 0.153
NP_441543.1_3 Forward -379 -365 6.39049 0.286
NP_442845.1_2 Reverse -235 -249 5.1128 0.243
NP_442845.1_2 Reverse -147 -161 3.24451 0.298
NP_441469.1_8 Forward -322 -313 12.8811 0.0929
NP_441469.1_8 Reverse -115 -124 5.21127 0.283
NP_443064.1_6 Forward -321 -311 17.7057 0.065
NP_442578.1_7 Forward -320 -313 12.5271 0.0544
NP_441462.1_2 Forward -321 -311 10.4031 0.011
NP_441462.1_2 Reverse -312 -322 1.74999 0.0811
NP_441621.1_7 Forward -332 -318 -5.31028 0.25
NP_441621.1_7 Reverse -310 -324 -5.31028 0.25
NP_443062.1_6 Reverse -304 -323 12.0942 0.0996
NP_441560.1_10 Reverse -304 -323 7.57094 0.277
NP_442487.1_9 Reverse -309 -328 17.3057 0.112
NP_440516.1_8 Forward -321 -312 7.17789 0.0754
NP_440516.1_8 Reverse -312 -321 7.07956 0.0867
NP_442428.1_5 Reverse -313 -320 13.1171 0.038
NP_442428.1_5 Forward -320 -313 6.23397 0.201
NP_442859.1_2 Reverse -86 -105 2.0644 0.28
NP_441867.1_2 Reverse -366 -385 -14.8485 0.289
NP_440673.1_2 Forward -331 -312 15.0721 0.0952
NP_440673.1_3 Reverse -314 -321 10.1672 0.149
NP_441052.1_2 Reverse -312 -322 8.23984 0.0482
NP_441052.1_2 Forward -321 -311 7.35486 0.0742
NP_442219.1_9 Reverse -313 -322 5.11294 0.186
NP_440436.1_4 Reverse -313 -322 8.35743 0.109
NP_440436.1_4 Forward -320 -311 6.39082 0.162
NP_441884.1_9 Forward -324 -305 -10.7186 0.0848
NP_441719.1_4 Forward -320 -313 6.62729 0.151
NP_441719.1_4 Reverse -313 -320 6.52896 0.188
NP_441733.1_10 Forward -324 -311 9.36073 0.119
NP_441004.1_1 Reverse -155 -174 -15.9302 0.279
NP_442813.1_5 Reverse -80 -99 6.58763 0.213
NP_443029.1_9 Reverse -282 -301 16.0274 0.203
NP_442206.1_8 Forward -51 -35 16.3369 0.278
NP_443054.1_2 Reverse -310 -324 14.0609 0.0722
NP_441851.1_10 Reverse -311 -321 8.1415 0.122
NP_441851.1_10 Forward -322 -312 6.66654 0.159
NP_442814.1_10 Reverse -321 -340 10.8159 0.137
NP_442622.1_8 Forward -321 -303 -18.4671 0.222
NP_441542.1_4 Reverse -205 -219 3.04785 0.292
NP_441668.1_4 Forward -258 -239 -0.197208 0.249
NP_442515.1_1 Forward -322 -308 2.16287 0.141
NP_442515.1_1 Reverse -311 -325 -4.62196 0.298
NP_442709.1_4 Reverse -65 -84 3.83414 0.289
NP_440940.1_7 Reverse -302 -320 3.65664 0.274
NP_441349.1_10 Forward -258 -239 -7.27704 0.247
NP_441409.1_6 Reverse -306 -325 -9.047 0.178
NP_440432.1_9 Reverse -313 -328 0.373221 0.159
NP_440474.1_8 Reverse -313 -327 9.34041 0.162
NP_440474.1_8 Forward -389 -375 9.14375 0.167
NP_442450.1_5 Reverse -310 -320 17.0896 0.0321
NP_440588.1_2 Reverse -303 -322 -3.63879 0.191
NP_440195.1_5 Forward -327 -308 10.0292 0.161
NP_440943.1_6 Reverse -158 -177 15.4374 0.224
NP_442006.1_2 Forward -312 -295 -9.59759 0.197
NP_442006.1_2 Reverse -147 -164 -17.1691 0.27
NP_443047.1_7 Reverse -86 -105 17.404 0.0485
NP_440483.1_1 Reverse -148 -167 11.7008 0.154
NP_441570.1_1 Forward -321 -303 3.85406 0.0211
NP_441570.1_1 Reverse -116 -134 -10.7973 0.18
NP_441570.1_1 Reverse -312 -330 -11.6822 0.201
NP_440078.1_1 Forward -77 -58 20.649 0.0946
NP_441078.1_4 Forward -321 -312 10.1278 0.016
NP_441078.1_4 Reverse -312 -321 9.83282 0.0226
NP_441094.1_7 Reverse -301 -320 15.7062 0.278
NP_440526.1_3 Reverse -313 -324 1.92649 0.267
NP_441432.1_8 Forward -322 -313 5.21127 0.185
NP_442320.1_8 Forward -327 -313 6.6861 0.0257
NP_441732.1_2 Reverse -308 -324 -16.2644 0.165
NP_441732.1_2 Forward -309 -293 -16.4611 0.167
NP_440497.1_6 Forward -278 -259 -4.91709 0.264
NP_441131.1_6 Forward -104 -86 3.3624 0.267
NP_442751.1_2 Reverse -105 -124 4.42355 0.261
NP_440713.1_4 Reverse -302 -321 9.83255 0.136
NP_442489.1_7 Forward -321 -312 10.4228 0.0151
NP_442489.1_7 Reverse -312 -321 10.3245 0.0193
NP_440941.1_1 Reverse -366 -376 14.9263 0.295
NP_440559.1_1 Forward -320 -311 7.57121 0.106
NP_441659.2_8 Forward -321 -311 9.61647 0.0284
NP_441659.2_8 Reverse -312 -322 2.14332 0.211
NP_442749.1_5 Reverse -367 -384 9.7662 0.198
NP_440779.1_5 Reverse -312 -329 -14.5141 0.246
NP_442346.1_5 Reverse -311 -321 13.5497 0.0226
NP_442346.1_5 Forward -322 -312 5.68323 0.234
NP_442346.1_10 Forward -323 -304 -2.75381 0.294
NP_440352.1_5 Reverse -150 -169 10.125 0.278
NP_440545.1_3 Forward -325 -308 -4.18939 0.22
NP_440025.1_3 Reverse -81 -95 9.44903 0.296
NP_440831.1_3 Forward -312 -293 6.48422 0.273
NP_440486.1_6 Reverse -238 -257 7.07928 0.278
NP_442603.1_7 Forward -321 -307 8.94708 0.161
NP_441585.1_5 Reverse -254 -273 -1.37794 0.298
NP_441948.1_4 Reverse -305 -323 19.587 0.0121
NP_441833.1_4 Reverse -313 -320 6.3323 0.134
NP_441833.1_4 Forward -320 -313 6.23397 0.163
NP_442162.1_9 Forward -320 -313 6.52896 0.178
NP_442162.1_9 Reverse -313 -320 6.43063 0.208
NP_440671.1_4 Forward -254 -240 6.48943 0.245
NP_441973.1_1 Forward -342 -327 -7.98491 0.293
NP_441915.1_6 Reverse -237 -256 18.0395 0.259
NP_442140.1_3 Reverse -313 -323 7.64985 0.133
NP_440875.1_9 Reverse -314 -324 13.5309 0.0677
NP_441813.1_5 Reverse -310 -320 6.27322 0.0971
NP_441813.1_5 Forward -323 -313 0.275027 0.206
NP_442254.1_1 Forward -371 -352 -5.31042 0.282
NP_440590.1_4 Reverse -313 -326 2.57589 0.0845
NP_440567.1_1 Reverse -313 -327 2.06454 0.184
NP_440567.1_1 Forward -320 -306 -0.0987402 0.264
NP_440567.1_4 Forward -159 -140 -0.0988766 0.281
NP_442497.1_10 Forward -320 -311 10.1278 0.0166
NP_442497.1_10 Reverse -313 -322 0.589713 0.153
NP_440821.1_4 Reverse -310 -320 10.2065 0.0163
NP_440821.1_4 Forward -323 -313 9.02648 0.0364
NP_440227.1_2 Forward -62 -46 9.89163 0.29
NP_440927.1_4 Forward -299 -280 12.7825 0.247
NP_441239.1_9 Reverse -262 -274 10.8554 0.0714
NP_441239.1_9 Forward -323 -311 9.87208 0.0941
NP_441239.1_9 Reverse -310 -322 4.66053 0.248
NP_440400.1_1 Forward -103 -84 -0.0996487 0.281
NP_441892.1_1 Reverse -303 -320 0.530496 0.167
NP_441892.1_1 Forward -312 -295 -3.10775 0.233
NP_440665.1_1 Forward -318 -299 -4.42544 0.186
NP_441698.1_3 Forward -378 -364 19.2718 0.232
NP_442772.1_6 Reverse -274 -293 16.7536 0.196
NP_440876.1_5 Forward -216 -197 10.7175 0.244
NP_442809.1_6 Forward -250 -231 1.17943 0.276
NP_440546.1_4 Reverse -153 -163 7.71902 0.224
NP_440462.1_6 Forward -323 -313 8.23984 0.0687
NP_440705.1_4 Reverse -144 -163 6.78429 0.296
NP_440868.1_4 Forward -325 -313 0.0389777 0.234
NP_440868.1_4 Reverse -308 -320 -0.74767 0.282
NP_442499.1_1 Forward -23 -4 2.55606 0.289
NP_441084.1_6 Forward -275 -261 9.24716 0.29
NP_441843.2_9 Reverse -314 -332 12.0482 0.205
NP_441811.1_8 Reverse -306 -320 14.7492 0.162
NP_441180.1_2 Forward -299 -280 10.3897 0.287
NP_441053.1_3 Forward -317 -298 1.96607 0.244
NP_442837.1_3 Reverse -313 -320 13.5105 0.0268
NP_442837.1_3 Forward -320 -313 6.13563 0.25
NP_440160.1_2 Reverse -84 -103 -6.88371 0.283
NP_442053.1_1 Forward -321 -312 8.75118 0.0728
NP_442053.1_1 Reverse -312 -321 8.65285 0.0741
NP_440505.1_3 Forward -323 -313 4.50326 0.284
NP_441536.1_10 Reverse -351 -370 10.9142 0.265
NP_442532.1_7 Reverse -312 -326 4.62115 0.171
NP_441299.1_4 Forward -251 -233 13.4905 0.232
NP_440914.1_1 Reverse -264 -274 9.98138 0.164
NP_440914.1_1 Forward -321 -311 6.66328 0.269
NP_441011.1_8 Reverse -313 -322 14.1594 0.0269
NP_442533.1_1 Reverse -309 -328 -16.1268 0.263
NP_442533.1_1 Reverse -357 -376 -17.1101 0.281
NP_442533.1_6 Forward -321 -312 14.651 0.01
NP_442533.1_6 Reverse -312 -321 7.37455 0.0898
NP_442533.1_6 Forward -162 -153 1.37636 0.3
NP_442232.1_3 Reverse -304 -323 -15.6352 0.295
NP_441482.1_7 Forward -250 -236 -10.9151 0.222
NP_441482.1_7 Forward -254 -240 -11.3085 0.254
NP_439944.1_9 Forward -320 -310 7.74818 0.131
NP_442202.1_4 Forward -323 -309 17.7801 0.104
NP_442664.1_10 Forward -93 -74 8.35759 0.263
NP_440116.1_7 Reverse -24 -38 20.0591 0.158
NP_441527.1_4 Reverse -330 -349 -9.88384 0.262
NP_440115.1_6 Forward -306 -296 5.68323 0.227
NP_440007.1_9 Reverse -149 -163 0.88457 0.29
NP_440903.1_2 Reverse -355 -365 16.2046 0.275
NP_441106.1_1 Forward -322 -313 8.45619 0.0548
NP_440429.1_2 Reverse -224 -243 7.66927 0.28
NP_442306.1_10 Reverse -307 -326 -1.37718 0.0484
NP_441286.1_1 Forward -322 -310 4.66053 0.031
NP_441286.1_1 Reverse -311 -323 -4.48425 0.161
NP_440670.1_8 Forward -321 -312 8.84951 0.0606
NP_440670.1_8 Reverse -312 -321 8.55452 0.066
NP_440670.1_8 Forward -244 -235 3.93297 0.212
NP_441886.1_2 Reverse -348 -367 7.17762 0.251
NP_441930.1_2 Forward -94 -84 12.0747 0.266
NP_441930.1_8 Reverse -144 -163 17.2074 0.19
NP_440886.1_7 Forward -322 -312 17.1874 0.00477
NP_440886.1_7 Reverse -115 -125 3.71617 0.267
NP_440828.1_4 Forward -386 -367 -7.3761 0.285
NP_442614.1_2 Forward -321 -307 11.996 0.172
NP_442072.1_9 Reverse -311 -329 -21.712 0.212
NP_442401.1_2 Forward -174 -155 11.5033 0.163
NP_440907.2_8 Reverse -313 -323 7.84605 0.117
NP_442264.1_5 Forward -142 -128 17.4042 0.222
NP_441021.1_8 Reverse -307 -325 4.9357 0.215
NP_441463.1_3 Reverse -302 -321 -3.63879 0.181
NP_442061.1_8 Reverse -142 -156 13.8643 0.272
NP_441626.1_2 Forward -320 -313 6.0373 0.212
NP_441626.1_2 Reverse -313 -320 5.93897 0.231
NP_442238.1_1 Forward -105 -86 4.03102 0.215
NP_441401.1_5 Forward -90 -71 12.1748 0.297
NP_442615.1_1 Forward -330 -312 -5.58572 0.217
NP_442615.1_1 Forward -151 -133 -6.66736 0.256
NP_441962.1_5 Reverse -297 -316 10.2259 0.19
NP_442020.1_1 Forward -25 -6 -0.689632 0.278
NP_440634.1_10 Reverse -248 -267 5.80018 0.269
NP_440114.1_10 Reverse -264 -278 9.83269 0.16
NP_440114.1_10 Reverse -312 -326 7.57108 0.231
NP_440114.1_10 Reverse -286 -300 5.99778 0.289
NP_442323.1_7 Forward -100 -81 4.52188 0.216
NP_442324.1_7 Forward -306 -287 5.85867 0.268
NP_441510.2_2 Forward -325 -306 5.70185 0.26
NP_441510.2_2 Reverse -134 -153 3.9319 0.272
NP_441510.2_9 Forward -320 -301 9.43923 0.165
NP_440287.1_6 Forward -275 -256 1.67108 0.266
NP_440766.1_5 Reverse -158 -170 8.80169 0.277
NP_439988.1_3 Reverse -316 -330 4.12949 0.295
NP_440457.1_1 Reverse -308 -320 11.642 0.092
NP_440457.1_1 Forward -248 -236 4.16888 0.171
NP_441984.1_3 Forward -283 -265 7.88563 0.239
NP_441889.1_4 Reverse -303 -322 6.29264 0.158
NP_442509.1_9 Reverse -312 -322 16.1058 0.00871
NP_442509.1_9 Forward -321 -311 8.3377 0.192
NP_440554.1_4 Reverse -313 -323 4.3066 0.195
NP_441885.1_5 Forward -321 -311 1.94665 0.0935
NP_441885.1_5 Reverse -312 -322 1.65166 0.106
NP_442341.1_7 Forward -322 -308 5.80112 0.145
NP_442341.1_9 Reverse -233 -247 7.96378 0.182
NP_441173.1_9 Forward -166 -158 12.0154 0.214
NP_441173.1_9 Reverse -60 -68 10.9338 0.242
NP_443000.1_7 Reverse -310 -320 5.97822 0.125
NP_442513.1_5 Forward -329 -310 10.52 0.266
NP_441842.1_10 Forward -310 -296 8.94771 0.203
NP_440275.1_3 Forward -323 -313 8.23984 0.0602
NP_440275.1_3 Forward -124 -114 3.32329 0.231
NP_440091.1_1 Forward -325 -313 17.1486 0.0153
NP_443010.1_10 Forward -324 -307 16.1063 0.0512
NP_442451.1_2 Forward -329 -310 -8.85033 0.254
NP_442495.1_4 Reverse -152 -162 16.598 0.0771
NP_440149.1_8 Reverse -312 -331 1.57275 0.122
NP_440149.1_8 Forward -279 -260 -6.58872 0.255
NP_440216.1_1 Forward -321 -307 -1.77037 0.0383
NP_440216.1_1 Reverse -312 -326 -3.54032 0.0833
NP_440216.1_9 Forward -32 -23 5.3096 0.298
NP_440172.1_1 Forward -321 -311 13.4514 0.021
NP_440172.1_1 Reverse -85 -95 1.74999 0.299
NP_442015.1_10 Reverse -308 -321 7.88576 0.0755
NP_441226.1_5 Reverse -234 -251 10.7569 0.213
NP_441226.1_7 Reverse -236 -243 7.1186 0.218
NP_441111.1_7 Forward -320 -312 8.96754 0.0463
NP_441111.1_7 Reverse -313 -321 8.86921 0.0589
NP_441766.1_2 Forward -321 -312 7.86621 0.0703
NP_441766.1_2 Reverse -312 -321 7.66954 0.0723
NP_440416.1_9 Reverse -228 -247 -14.8485 0.18
NP_440416.1_9 Reverse -301 -320 -18.5851 0.26
NP_440416.1_9 Forward -328 -309 -21.0434 0.29
NP_443052.1_8 Forward -331 -312 8.94757 0.023
NP_440261.1_5 Forward -320 -307 -4.60227 0.158
NP_440261.1_5 Forward -247 -234 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCCCATTTTTGTAATGACAGCTCCCCTAACCCTCAACTTACTCCAAGGTTCTGTTCGTTTTCCCTTTAGTGCCGAAGCGGCGATCACCCTCCAGGGGGAGATCAACCAATTGGTCAATCAATTAAAGGCCATTGGTGCTCAGGTTAACCAGGGAGGCCGACCGGAGAAGCAACAGAATTTGGAATATTGCCACAGTGGAGAAGTCTTTTTAGAAGTATTTTGCAACCCAAATATTTACCCCAGCCCCTTTGCGGCTAAGGTATTGCTCACACTACGGGATGACCGGATTCGTTTGACCACGGAAGCGGAATTGCCCAGACTCATTGAAGATTTGGCTGAATATCTAGCCCAGCATGGTTAGATCCAGCCCTGGTAAACCTTGTAAACAGTGCCCAACCA

CDS

ATGTCTTCCCTGCCCAAAAATTTTCTTCAACCTCTCCCTCTCCAACCAGGCGATCGCCTCACTGTGGTGTCCCCCAGCGGTAGTCTGCGGGAATTGGCGGACTTGCAAAAAGGGGTGGATATTTGGCGATCGTGGGGCTACGAGGTAATTTTCAGCCAAGGTTACCACAATCGCTTCGGCTACCTAGCGGGAACAGATCAACAACGTAGGCAAGATTTACTCCACGCTTGGTTAGACCCCCAGTGTAAAGGAATTTTATGTAGTCGGGGGGGCTACGGCTCCGCCCGGTTGCTGGAAGATTGGCAATGGCCGGCAATTAGCCAACCAAAATGGGTGTTGGGTTTTTCCGATGTCACAGGGATTTTATGGAGTTTGCTCAAATCAGGTATTATCAGCCTCCACGGCCCTGTGTTGACTACCCTCAGCGATGAGCCGGATTGGGCCCTGGAACGGTTGCGTGGGCATCTTCAGGGTCTTCCCCTTGCACCATTGACCGGGAACAGTTGGCAGAAAGGAATGGCCCGAGGGCGTTTAGTGGCAGGTAATTTAACCGTTGCTACCCATTTTTTAGGAACAGAATGGCAACCAGATTTTGAAAACGTAATTTTGGCGATCGAAGATGTGACCGAATCCCCCTATCGCATTGACCGCATGGTGACCCAATGGCGAGCCTCCGGCAATTTATCCCAGGTAGCTGGCATTGCCCTGGGGCGGTTCAGTGAATGTGAAGCTCCCGCCGGATTCCCCAGTTGGACAGTGGAAGAAGTCCTTGGCGATCGCCTGGGGGATTTGGGCATACCAGTGGTGGCGGATTTACCGTTTGGTCATGGCGGCGTCAATGCCATTTTGCCCGTGGGTAGCAAAGCGGAATTGGATGGGGACGCTGGCACCCTCAGCTTTTTGTAA

Protein

MSSLPKNFLQPLPLQPGDRLTVVSPSGSLRELADLQKGVDIWRSWGYEVIFSQGYHNRFGYLAGTDQQRRQDLLHAWLDPQCKGILCSRGGYGSARLLEDWQWPAISQPKWVLGFSDVTGILWSLLKSGIISLHGPVLTTLSDEPDWALERLRGHLQGLPLAPLTGNSWQKGMARGRLVAGNLTVATHFLGTEWQPDFENVILAIEDVTESPYRIDRMVTQWRASGNLSQVAGIALGRFSECEAPAGFPSWTVEEVLGDRLGDLGIPVVADLPFGHGGVNAILPVGSKAELDGDAGTLSFL