Your browser is old and dusty. Try Google Chrome!

Details for slr1533

ORF slr1533
Accession NP_441633.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -251 -237 9.2427 0.0774
NP_441061.1_2 Reverse -232 -246 1.27789 0.192
NP_441061.1_2 Reverse -363 -377 0.786239 0.199
NP_441061.1_2 Forward -389 -375 -0.492064 0.231
NP_441061.1_2 Reverse -223 -237 -0.688726 0.237
NP_441418.1_6 Forward -252 -233 -20.0601 0.103
NP_441418.1_6 Forward -240 -221 -29.7948 0.238
NP_441418.1_6 Forward -276 -257 -29.8932 0.245
NP_441418.1_6 Forward -246 -227 -30.4831 0.28
NP_442291.1_5 Reverse -242 -258 0.648521 0.16
NP_440897.1_6 Reverse -273 -292 -2.16459 0.205
NP_441453.1_1 Reverse -344 -362 4.24662 0.262
NP_441453.1_4 Reverse -222 -230 9.75419 0.0493
NP_441453.1_4 Forward -360 -352 6.80426 0.121
NP_441453.1_4 Reverse -351 -359 6.11594 0.121
NP_441960.1_3 Forward -392 -373 16.7566 0.155
NP_442151.1_6 Reverse -368 -382 9.5377 0.145
NP_442151.1_6 Forward -360 -346 7.9644 0.184
NP_442151.1_6 Forward -384 -370 7.27608 0.205
NP_441818.1_1 Reverse -352 -363 14.8078 0.0426
NP_441818.1_1 Reverse -363 -374 8.71129 0.28
NP_441818.1_9 Forward -300 -281 7.47261 0.116
NP_440226.1_1 Reverse -351 -370 4.22769 0.199
NP_440150.1_2 Reverse -364 -383 6.58682 0.261
NP_442287.1_5 Forward -241 -231 17.8763 0.19
NP_442287.1_5 Forward -301 -291 16.008 0.218
NP_442173.1_1 Reverse -352 -360 12.0158 0.0316
NP_442173.1_1 Forward -359 -351 4.83764 0.241
NP_442752.1_4 Forward -360 -353 13.8055 0.0199
NP_442752.1_4 Reverse -243 -250 10.8555 0.0846
NP_442752.1_4 Forward -240 -233 10.5605 0.1
NP_443027.1_4 Reverse -241 -251 6.46988 0.275
NP_441812.1_3 Forward -361 -347 10.1277 0.228
NP_441812.1_3 Reverse -242 -256 7.07942 0.287
NP_442975.1_10 Reverse -347 -361 2.65393 0.269
NP_440784.1_7 Forward -359 -352 6.23397 0.241
NP_440784.1_7 Reverse -352 -359 6.13563 0.241
NP_440061.1_9 Reverse -220 -234 8.06211 0.183
NP_442062.1_8 Reverse -243 -253 4.99491 0.188
NP_441900.1_2 Reverse -57 -75 -5.88141 0.288
NP_441859.1_3 Reverse -263 -282 1.57197 0.281
NP_440304.1_4 Reverse -379 -389 5.97822 0.185
NP_442268.1_3 Reverse -223 -242 12.6833 0.295
NP_440044.1_8 Reverse -244 -263 5.01433 0.106
NP_441161.1_1 Reverse -275 -294 14.6499 0.225
NP_441935.1_1 Forward -291 -272 10.5209 0.211
NP_441935.1_1 Forward -240 -221 8.25926 0.234
NP_441935.1_1 Reverse -213 -232 5.80098 0.292
NP_441208.1_9 Forward -300 -286 10.0294 0.196
NP_441594.1_6 Forward -227 -208 -0.295539 0.298
NP_441925.1_4 Reverse -284 -303 -14.1609 0.261
NP_441925.1_4 Forward -217 -198 -15.8325 0.274
NP_441083.1_5 Reverse -351 -361 17.7779 0.00336
NP_441083.1_5 Reverse -222 -232 -0.511621 0.269
NP_441083.1_5 Forward -360 -350 -1.00328 0.289
NP_441434.1_6 Reverse -247 -257 14.6313 0.278
NP_441738.1_2 Reverse -353 -360 15.28 0.0102
NP_441558.1_5 Reverse -349 -368 12.9791 0.0633
NP_440209.1_1 Forward -360 -352 8.57422 0.0425
NP_440209.1_1 Reverse -351 -359 5.52596 0.0821
NP_442765.1_2 Reverse -59 -78 10.9142 0.115
NP_441713.1_1 Forward -366 -347 -10.3253 0.197
NP_441713.1_1 Reverse -205 -224 -11.7019 0.234
NP_441770.1_4 Reverse -244 -263 -3.44213 0.204
NP_441770.1_4 Forward -245 -226 -12.4886 0.291
NP_441770.1_4 Reverse -265 -284 -12.7836 0.297
NP_442570.1_3 Forward -62 -43 -8.06369 0.279
NP_439953.1_2 Reverse -206 -224 10.0489 0.266
NP_441716.1_1 Forward -282 -268 6.3911 0.198
NP_441716.1_1 Forward -252 -238 3.8345 0.259
NP_441624.1_7 Reverse -363 -377 8.55439 0.238
NP_441163.1_1 Reverse -83 -100 4.0697 0.294
NP_440906.1_5 Forward -359 -352 6.23397 0.234
NP_440906.1_5 Reverse -352 -359 6.13563 0.241
NP_440747.1_10 Forward -363 -351 -2.61596 0.0556
NP_440747.1_10 Reverse -240 -252 -11.9574 0.178
NP_440747.1_10 Reverse -359 -371 -12.3507 0.27
NP_441130.1_10 Reverse -349 -363 8.45605 0.135
NP_441486.1_1 Forward -255 -241 6.29277 0.0344
NP_440403.1_10 Forward -240 -221 3.24438 0.278
NP_441014.1_10 Forward -20 -1 -0.886293 0.254
NP_441014.1_10 Forward -253 -234 -0.984623 0.257
NP_442848.1_5 Reverse -299 -317 -2.93078 0.289
NP_442848.1_5 Reverse -374 -392 -3.42244 0.291
NP_442848.1_5 Reverse -64 -82 -3.42244 0.291
NP_441012.1_4 Reverse -224 -237 11.229 0.252
NP_441012.1_4 Forward -250 -237 7.59077 0.272
NP_443018.1_3 Reverse -352 -359 11.7405 0.0655
NP_443018.1_3 Reverse -244 -251 11.5438 0.0752
NP_443018.1_3 Forward -359 -352 5.44732 0.193
NP_441634.1_8 Forward -242 -228 2.85119 0.16
NP_441634.1_8 Reverse -241 -255 -0.000409212 0.243
NP_441634.1_8 Forward -362 -348 -3.93365 0.295
NP_440376.1_1 Forward -360 -351 5.99792 0.111
NP_440376.1_1 Forward -231 -222 2.65466 0.216
NP_440376.1_1 Reverse -351 -360 -0.196935 0.285
NP_441588.1_4 Reverse -353 -363 8.73149 0.14
NP_442687.1_7 Forward -225 -215 4.3066 0.255
NP_442485.1_3 Reverse -226 -245 1.37609 0.229
NP_442485.1_3 Reverse -184 -203 -3.14714 0.272
NP_442485.1_3 Forward -263 -244 -6.09707 0.299
NP_442958.1_2 Forward -379 -360 15.8307 0.289
NP_442958.1_3 Reverse -201 -220 -2.75381 0.299
NP_441029.1_8 Reverse -291 -310 13.175 0.242
NP_441763.1_5 Reverse -275 -294 -6.68705 0.274
NP_440360.1_10 Reverse -224 -238 3.73617 0.227
NP_442198.1_3 Forward -294 -275 2.45773 0.299
NP_440141.1_4 Forward -249 -230 -11.8986 0.298
NP_442782.1_2 Forward -371 -357 -0.000409212 0.297
NP_440656.1_8 Reverse -184 -203 -8.35868 0.273
NP_441414.1_9 Reverse -351 -370 -3.93378 0.143
NP_441414.1_9 Reverse -381 -400 -7.4737 0.219
NP_441256.1_1 Forward -249 -230 -3.44213 0.233
NP_441958.1_5 Reverse -350 -360 1.55333 0.095
NP_441958.1_5 Forward -361 -351 0.865012 0.12
NP_440651.1_7 Reverse -381 -400 13.0775 0.265
NP_441127.1_1 Reverse -306 -320 10.6193 0.244
NP_441127.1_1 Reverse -213 -227 8.45605 0.295
NP_440203.1_5 Forward -249 -239 17.6791 0.0611
NP_440203.1_5 Forward -387 -377 11.6809 0.182
NP_443001.1_7 Forward -383 -364 1.0811 0.287
NP_440984.1_7 Reverse -217 -231 4.91614 0.281
NP_439990.1_5 Reverse -363 -376 5.62415 0.283
NP_442690.1_1 Forward -118 -99 -16.7168 0.291
NP_442690.1_1 Forward -327 -308 -17.1101 0.297
NP_442911.1_2 Forward -400 -381 -6.09707 0.175
NP_440153.1_8 Reverse -228 -241 -2.144 0.235
NP_441591.1_10 Forward -362 -343 5.50599 0.297
NP_440369.1_5 Forward -378 -359 10.5209 0.27
NP_443055.1_6 Forward -260 -242 0.411736 0.243
NP_442236.1_2 Forward -372 -353 17.5024 0.13
NP_440993.1_3 Forward -195 -176 -0.787962 0.273
NP_440993.1_4 Forward -252 -235 5.05372 0.263
NP_440827.1_3 Forward -383 -364 11.9958 0.262
NP_440138.1_6 Reverse -346 -365 2.26028 0.269
NP_440809.1_9 Reverse -342 -360 -5.88071 0.225
NP_441938.1_1 Reverse -229 -248 1.47442 0.272
NP_441294.1_7 Reverse -218 -232 11.0744 0.157
NP_441294.1_10 Reverse -205 -224 13.1758 0.198
NP_443020.1_4 Reverse -67 -86 17.4032 0.232
NP_441646.1_1 Forward -238 -219 -0.787193 0.272
NP_442431.1_10 Forward -303 -285 5.42735 0.201
NP_441000.1_6 Reverse -350 -364 4.81781 0.0933
NP_441550.1_8 Forward -362 -352 13.8442 0.0207
NP_441550.1_8 Reverse -349 -359 8.43603 0.124
NP_440206.1_4 Reverse -358 -377 6.68515 0.212
NP_441041.1_4 Reverse -369 -388 -1.57384 0.101
NP_441041.1_4 Forward -377 -358 -3.3438 0.121
NP_441041.1_4 Reverse -351 -370 -10.227 0.228
NP_441041.1_7 Forward -363 -351 6.25147 0.216
NP_442396.1_5 Forward -50 -37 6.50913 0.234
NP_440569.1_7 Reverse -288 -307 9.14423 0.286
NP_440703.1_9 Reverse -222 -235 11.4251 0.192
NP_441725.1_5 Forward -359 -349 -0.511621 0.26
NP_441725.1_5 Forward -251 -241 -1.10161 0.288
NP_439966.1_7 Reverse -349 -359 14.5325 0.0203
NP_439966.1_7 Forward -254 -244 7.35439 0.15
NP_439966.1_7 Forward -362 -352 5.58445 0.216
NP_442941.1_3 Reverse -352 -362 9.41981 0.0319
NP_442941.1_3 Forward -359 -349 0.766681 0.171
NP_442941.1_3 Forward -251 -241 0.275027 0.222
NP_440289.1_2 Forward -363 -350 -5.19226 0.3
NP_440983.1_5 Reverse -294 -313 -1.47551 0.228
NP_440983.1_5 Reverse -216 -235 -5.31042 0.266
NP_440983.1_5 Reverse -231 -250 -7.37537 0.288
NP_440983.1_5 Reverse -252 -271 -9.14533 0.3
NP_440260.1_7 Forward -266 -247 -5.40875 0.261
NP_442281.1_1 Reverse -238 -252 8.65209 0.0783
NP_442281.1_1 Forward -376 -362 6.78381 0.115
NP_442281.1_1 Forward -382 -368 2.94893 0.249
NP_440479.1_6 Reverse -280 -294 13.4703 0.282
NP_440437.1_1 Reverse -52 -71 1.76941 0.143
NP_440437.1_1 Reverse -222 -241 -5.21209 0.276
NP_441644.1_6 Reverse -351 -361 14.4342 0.0126
NP_441644.1_6 Reverse -222 -232 6.0761 0.167
NP_441644.1_6 Forward -360 -350 5.68278 0.18
NP_441644.1_6 Forward -143 -133 4.20782 0.245
NP_441644.1_6 Reverse -375 -385 3.71617 0.267
NP_441644.1_6 Forward -377 -367 3.61784 0.272
NP_441644.1_6 Reverse -243 -253 3.61784 0.272
NP_441644.1_6 Forward -246 -236 3.22451 0.293
NP_443049.1_6 Forward -361 -351 14.4711 0.114
NP_443049.1_6 Reverse -242 -252 14.2759 0.126
NP_442215.1_2 Forward -380 -364 13.4315 0.0232
NP_442215.1_2 Reverse -255 -271 -2.10475 0.192
NP_442215.1_2 Reverse -366 -382 -4.1697 0.228
NP_442215.1_2 Forward -392 -376 -4.46469 0.233
NP_442215.1_2 Reverse -360 -376 -4.75968 0.239
NP_442029.1_1 Forward -242 -223 -18.8801 0.277
NP_442029.1_1 Forward -362 -343 -20.1584 0.297
NP_440929.1_8 Reverse -351 -360 7.07956 0.0713
NP_441751.2_8 Reverse -352 -366 2.85119 0.0759
NP_441751.2_8 Forward -251 -237 -4.13031 0.163
NP_442554.1_8 Reverse -352 -362 6.37155 0.12
NP_442554.1_8 Forward -359 -349 5.09324 0.161
NP_442554.1_8 Forward -251 -241 4.99491 0.163
NP_442554.1_8 Forward -383 -373 3.61828 0.218
NP_442554.1_8 Reverse -301 -311 2.83163 0.253
NP_442554.1_8 Forward -230 -220 2.63497 0.265
NP_442554.1_8 Reverse -376 -386 2.04498 0.285
NP_442554.1_8 Reverse -244 -254 2.04498 0.285
NP_442554.1_8 Reverse -207 -217 1.84832 0.292
NP_442554.1_9 Forward -304 -285 14.1224 0.269
NP_442075.1_10 Forward -360 -341 12.2908 0.282
NP_442142.1_4 Reverse -234 -247 13.6867 0.0348
NP_442142.1_4 Reverse -228 -241 12.605 0.0434
NP_442142.1_4 Reverse -297 -310 9.45847 0.095
NP_442142.1_4 Reverse -64 -77 7.59019 0.135
NP_442142.1_4 Forward -249 -236 3.65697 0.248
NP_442142.1_4 Reverse -276 -289 3.06699 0.268
NP_442292.1_1 Reverse -352 -361 8.65285 0.0335
NP_442292.1_1 Forward -251 -242 5.70292 0.135
NP_442476.1_6 Reverse -352 -366 0.0979218 0.274
NP_442301.1_2 Reverse -221 -240 4.42355 0.279
NP_441715.1_4 Reverse -352 -362 7.55152 0.108
NP_441448.1_1 Reverse -204 -223 18.584 0.113
NP_441448.1_1 Forward -269 -250 7.86593 0.211
NP_441448.1_1 Reverse -289 -308 3.83436 0.287
NP_440158.1_8 Forward -317 -298 12.9791 0.222
NP_440379.1_5 Forward -393 -374 -2.36049 0.198
NP_440379.1_5 Forward -318 -299 -8.16202 0.25
NP_440379.1_5 Reverse -347 -366 -9.34199 0.263
NP_441468.1_1 Forward -359 -352 6.13563 0.209
NP_441468.1_1 Reverse -352 -359 6.0373 0.223
NP_441468.1_1 Reverse -244 -251 4.07068 0.263
NP_441015.1_8 Forward -273 -254 -0.688862 0.296
NP_441015.1_10 Forward -236 -217 5.40766 0.115
NP_441015.1_10 Forward -242 -223 4.42435 0.125
NP_441015.1_10 Forward -278 -259 -2.45882 0.178
NP_441015.1_10 Forward -389 -370 -11.5053 0.298
NP_441673.1_1 Forward -360 -351 1.37636 0.114
NP_441673.1_1 Reverse -351 -360 1.1797 0.163
NP_441016.2_6 Reverse -291 -310 13.9616 0.184
NP_442757.1_7 Forward -286 -267 12.5858 0.221
NP_441826.1_2 Reverse -369 -383 -2.45868 0.271
NP_441826.1_2 Forward -377 -363 -2.95034 0.28
NP_442868.1_6 Forward -362 -352 9.51814 0.0447
NP_442719.1_2 Forward -267 -249 -10.0113 0.268
NP_441056.1_1 Forward -252 -233 -8.65367 0.283
NP_442677.1_3 Forward -182 -163 -4.52377 0.287
NP_442227.1_2 Reverse -227 -246 6.88262 0.198
NP_442227.1_2 Forward -180 -161 3.04771 0.219
NP_442227.1_2 Reverse -224 -243 0.58944 0.252
NP_442227.1_2 Forward -183 -164 -3.73712 0.295
NP_443058.1_7 Forward -253 -234 4.42435 0.258
NP_442361.1_3 Reverse -237 -250 7.49244 0.3
NP_442808.1_1 Reverse -350 -360 9.71433 0.0481
NP_442808.1_1 Reverse -230 -240 5.48612 0.151
NP_442808.1_1 Reverse -221 -231 5.09279 0.173
NP_440145.1_3 Forward -388 -369 -3.93378 0.214
NP_442718.1_2 Forward -240 -221 -3.04881 0.283
NP_442542.1_9 Forward -378 -364 5.99717 0.255
NP_442050.1_5 Reverse -349 -359 14.9258 0.0175
NP_441114.1_3 Reverse -217 -226 15.1427 0.193
NP_441114.1_3 Reverse -370 -379 7.66954 0.231
NP_440558.1_2 Reverse -353 -372 -0.000545616 0.197
NP_440558.1_2 Forward -387 -368 -3.63879 0.237
NP_440558.1_2 Forward -393 -374 -4.6221 0.247
NP_440558.1_2 Forward -261 -242 -4.81876 0.249
NP_440558.1_2 Reverse -234 -253 -5.31042 0.256
NP_440558.1_2 Reverse -365 -384 -7.08038 0.287
NP_442789.1_5 Forward -242 -223 8.84924 0.21
NP_441518.1_3 Reverse -185 -204 -6.29373 0.134
NP_441518.1_3 Forward -262 -243 -9.44032 0.218
NP_442792.1_4 Forward -297 -278 11.8975 0.288
NP_441878.1_6 Forward -378 -368 -7.49312 0.231
NP_441878.1_6 Forward -372 -362 -7.49312 0.231
NP_441878.1_6 Forward -232 -222 -7.59145 0.245
NP_441557.1_5 Forward -360 -351 1.08137 0.0794
NP_441557.1_5 Reverse -351 -360 0.589713 0.134
NP_441520.1_8 Forward -240 -221 10.4225 0.238
NP_442356.1_1 Forward -79 -60 8.94757 0.268
NP_441445.1_1 Forward -276 -257 5.50599 0.168
NP_441445.1_1 Forward -291 -272 5.40766 0.171
NP_441445.1_1 Forward -240 -221 4.71934 0.189
NP_441445.1_1 Forward -285 -266 2.55606 0.233
NP_442066.2_4 Forward -178 -159 -8.45701 0.294
NP_441433.1_8 Forward -272 -253 4.22769 0.188
NP_442183.1_1 Forward -360 -346 6.3911 0.176
NP_442183.1_1 Reverse -243 -257 3.73617 0.299
NP_442444.1_6 Forward -300 -282 13.0173 0.262
NP_442347.1_2 Reverse -352 -361 10.3245 0.058
NP_442347.1_2 Reverse -346 -355 4.12963 0.284
NP_442645.1_2 Forward -368 -349 -21.4367 0.29
NP_441633.1_5 Forward -244 -225 18.8728 0.0982
NP_441633.1_7 Forward -100 -81 20.7473 0.0479
NP_441633.1_9 Forward -221 -202 20.9431 0.0798
NP_440136.1_2 Forward -359 -352 6.23397 0.171
NP_440136.1_2 Reverse -352 -359 6.13563 0.193
NP_442590.1_10 Forward -76 -57 5.99764 0.254
NP_442590.1_10 Forward -237 -218 3.14605 0.295
NP_442998.1_5 Forward -262 -252 13.353 0.158
NP_442998.1_5 Forward -261 -251 11.3864 0.187
NP_442998.1_10 Reverse -353 -360 15.5754 0.0102
NP_442998.1_10 Forward -250 -243 6.13563 0.181
NP_440299.1_1 Reverse -218 -231 6.21356 0.149
NP_441799.1_1 Reverse -347 -361 10.2254 0.0778
NP_441007.1_5 Forward -251 -232 11.7992 0.207
NP_441007.1_10 Forward -314 -301 7.6891 0.133
NP_442334.1_10 Forward -231 -212 -16.7168 0.257
NP_440256.1_1 Forward -363 -344 -0.590531 0.095
NP_440256.1_1 Reverse -372 -391 -9.63698 0.284
NP_440256.1_1 Reverse -359 -378 -10.3253 0.299
NP_440087.1_7 Reverse -232 -251 17.994 0.192
NP_440915.1_5 Forward -242 -223 16.078 0.233
NP_440915.1_6 Forward -364 -350 16.0275 0.0183
NP_441179.1_6 Forward -255 -236 15.7324 0.295
NP_441179.1_9 Reverse -298 -308 18.7607 0.131
NP_441179.1_9 Reverse -235 -245 8.92768 0.284
NP_442069.1_6 Reverse -258 -277 12.9791 0.11
NP_442866.1_1 Forward -395 -376 -3.63879 0.221
NP_440748.1_4 Forward -79 -60 12.88 0.292
NP_440748.1_5 Forward -249 -230 3.14605 0.21
NP_441464.1_1 Reverse -324 -343 7.27595 0.262
NP_441464.1_10 Forward -271 -257 9.83269 0.262
NP_440702.1_2 Forward -242 -223 1.57275 0.257
NP_441199.1_3 Forward -175 -157 2.37909 0.231
NP_441494.1_6 Reverse -210 -223 7.19745 0.267
NP_442993.1_1 Forward -360 -344 -11.5445 0.251
NP_442386.1_9 Reverse -374 -383 8.2591 0.205
NP_442386.1_9 Reverse -350 -359 4.52254 0.297
NP_442386.1_9 Reverse -299 -308 4.52254 0.297
NP_440570.1_5 Forward -250 -231 -2.85214 0.282
NP_440570.1_5 Reverse -233 -252 -3.14714 0.288
NP_440570.1_5 Reverse -188 -207 -3.3438 0.289
NP_441750.1_1 Forward -246 -227 -12.3902 0.3
NP_441340.1_5 Forward -359 -352 13.5105 0.0314
NP_441340.1_5 Reverse -352 -359 5.84064 0.208
NP_442186.1_9 Reverse -213 -232 13.2741 0.193
NP_442484.1_2 Reverse -364 -383 0.687771 0.244
NP_440586.1_8 Reverse -244 -251 10.9535 0.119
NP_440586.1_8 Reverse -352 -359 9.47853 0.146
NP_440586.1_8 Forward -308 -301 5.8403 0.283
NP_440586.1_8 Forward -245 -238 5.8403 0.283
NP_440586.1_8 Forward -359 -352 5.74197 0.283
NP_440192.1_5 Reverse -194 -213 13.4708 0.116
NP_440684.1_9 Forward -282 -268 7.17775 0.275
NP_441262.1_3 Forward -360 -353 14.7888 0.0223
NP_441262.1_3 Reverse -243 -250 5.25066 0.215
NP_440027.1_3 Reverse -341 -359 10.8348 0.164
NP_443051.1_1 Forward -361 -352 7.47288 0.0571
NP_443051.1_1 Reverse -350 -359 0.29472 0.195
NP_439996.1_6 Forward -247 -228 20.7407 0.0418
NP_439996.1_6 Forward -310 -291 11.8976 0.181
NP_442294.1_3 Reverse -247 -261 12.782 0.274
NP_441595.1_2 Forward -265 -252 8.46506 0.29
NP_440408.1_3 Forward -285 -266 1.86774 0.204
NP_440439.1_1 Reverse -348 -361 -0.767364 0.236
NP_439943.1_1 Reverse -369 -388 -11.0136 0.29
NP_440372.1_2 Forward -359 -352 13.8055 0.0214
NP_440372.1_2 Reverse -352 -359 6.52896 0.188
NP_439977.1_5 Forward -396 -377 1.0811 0.196
NP_441572.1_7 Forward -377 -358 -4.72043 0.243
NP_440267.1_2 Reverse -357 -371 12.5853 0.125
NP_440267.1_2 Forward -257 -243 5.01387 0.285
NP_442384.1_10 Reverse -273 -286 3.26421 0.197
NP_442384.1_10 Reverse -216 -229 1.78924 0.247
NP_442384.1_10 Reverse -351 -364 0.412608 0.291
NP_441018.1_7 Forward -235 -216 6.68596 0.283
NP_442262.1_10 Reverse -352 -359 13.2155 0.0213
NP_442262.1_10 Reverse -244 -251 11.7405 0.0841
NP_441689.1_5 Reverse -349 -359 8.53436 0.132
NP_440163.1_10 Reverse -240 -250 14.4347 0.102
NP_440163.1_10 Reverse -261 -271 10.7964 0.193
NP_440344.1_10 Reverse -260 -277 -12.5475 0.257
NP_440344.1_10 Reverse -224 -241 -12.9408 0.269
NP_440282.1_3 Reverse -370 -389 -2.75381 0.298
NP_440531.1_6 Reverse -343 -362 6.4893 0.106
NP_441965.1_3 Forward -370 -351 8.16093 0.127
NP_441640.1_8 Reverse -363 -382 5.40766 0.111
NP_441640.1_8 Forward -251 -232 -3.63879 0.259
NP_440297.1_9 Reverse -376 -386 6.37155 0.193
NP_440297.1_9 Forward -214 -204 0.373358 0.282
NP_440297.1_9 Forward -251 -241 -0.216628 0.282
NP_440297.1_9 Reverse -244 -254 -0.41329 0.283
NP_442187.1_3 Forward -361 -351 15.6147 0.105
NP_442067.1_4 Reverse -204 -223 2.94938 0.289
NP_440999.1_9 Reverse -227 -241 -0.885388 0.22
NP_440888.1_2 Reverse -351 -365 13.5686 0.027
NP_440888.1_2 Reverse -362 -376 8.45543 0.16
NP_440600.1_4 Reverse -343 -361 -2.93078 0.213
NP_440052.1_8 Forward -308 -289 24.4839 0.00734
NP_440052.1_8 Forward -245 -226 17.699 0.0498
NP_442033.1_10 Reverse -339 -358 -8.35868 0.196
NP_442033.1_10 Forward -223 -204 -10.227 0.23
NP_441123.1_4 Reverse -351 -365 17.0102 0.23
NP_440575.1_4 Forward -240 -221 15.8366 0.155
NP_441917.1_2 Forward -374 -356 6.41066 0.288
NP_441543.1_2 Reverse -352 -361 7.07956 0.131
NP_441543.1_2 Forward -251 -242 4.81794 0.219
NP_442845.1_2 Forward -366 -352 7.9644 0.195
NP_442845.1_2 Forward -231 -217 7.9644 0.195
NP_442845.1_2 Forward -237 -223 6.58777 0.207
NP_442845.1_2 Reverse -369 -383 3.63784 0.282
NP_442315.1_5 Reverse -167 -177 18.0729 0.195
NP_442337.1_6 Forward -247 -228 15.9847 0.184
NP_442578.1_7 Forward -359 -352 6.0373 0.18
NP_442578.1_7 Reverse -244 -251 5.15232 0.291
NP_441462.1_2 Forward -360 -350 16.2046 0.00406
NP_443062.1_1 Reverse -351 -369 11.9587 0.0887
NP_443062.1_1 Forward -252 -234 11.2761 0.102
NP_442204.1_1 Reverse -239 -250 10.6784 0.0697
NP_442204.1_1 Forward -244 -233 8.81013 0.0852
NP_442204.1_5 Forward -234 -215 -0.0988766 0.278
NP_440516.1_8 Forward -360 -351 18.9776 0.00442
NP_440516.1_8 Reverse -351 -360 5.01461 0.118
NP_442080.1_7 Forward -382 -363 -0.983855 0.287
NP_442428.1_5 Forward -359 -352 6.13563 0.209
NP_442428.1_5 Reverse -352 -359 6.0373 0.212
NP_442428.1_5 Reverse -244 -251 4.46401 0.267
NP_441443.1_7 Forward -249 -230 11.6025 0.0937
NP_441443.1_7 Forward -312 -293 0.786102 0.242
NP_442823.1_8 Forward -389 -370 9.83255 0.299
NP_440673.1_2 Forward -319 -300 18.4864 0.0429
NP_440673.1_2 Forward -225 -206 8.1459 0.28
NP_440673.1_2 Forward -394 -375 7.95079 0.286
NP_440673.1_3 Reverse -353 -360 12.4288 0.0426
NP_440673.1_3 Forward -250 -243 11.6422 0.0724
NP_440673.1_3 Reverse -364 -371 8.98723 0.203
NP_440673.1_3 Reverse -217 -224 6.23397 0.283
NP_441052.1_2 Reverse -351 -361 10.6981 0.0285
NP_441052.1_2 Reverse -231 -241 4.69992 0.149
NP_441052.1_2 Forward -231 -221 4.0116 0.168
NP_441052.1_2 Reverse -243 -253 3.71661 0.175
NP_441052.1_2 Reverse -291 -301 2.43831 0.204
NP_441052.1_2 Reverse -267 -277 2.33998 0.209
NP_441052.1_2 Forward -282 -272 1.84832 0.225
NP_441052.1_2 Reverse -273 -283 0.963343 0.255
NP_442219.1_8 Forward -262 -243 14.4483 0.136
NP_442219.1_8 Forward -235 -216 12.8055 0.153
NP_442219.1_8 Reverse -227 -246 8.94017 0.238
NP_442219.1_9 Reverse -352 -361 7.96454 0.0696
NP_440436.1_4 Reverse -352 -361 7.57079 0.124
NP_440436.1_4 Forward -251 -242 4.62087 0.248
NP_442414.1_4 Reverse -289 -308 21.9273 0.00917
NP_441719.1_4 Forward -359 -352 6.82395 0.0855
NP_441719.1_4 Reverse -352 -359 6.52896 0.188
NP_441719.1_4 Reverse -244 -251 3.77569 0.285
NP_441004.1_1 Forward -383 -364 0.982764 0.111
NP_441004.1_1 Forward -377 -358 -11.8986 0.243
NP_441004.1_2 Forward -388 -369 0.491109 0.234
NP_441004.1_4 Forward -380 -370 14.533 0.175
NP_442813.1_5 Forward -58 -39 1.37609 0.295
NP_442366.1_3 Reverse -361 -379 6.31233 0.0809
NP_442366.1_3 Forward -391 -373 2.18243 0.134
NP_442366.1_3 Forward -253 -235 -2.53746 0.229
NP_440129.1_9 Forward -142 -123 8.06259 0.247
NP_440129.1_10 Reverse -236 -250 7.27608 0.177
NP_441115.1_4 Forward -385 -367 8.47483 0.247
NP_441115.1_4 Reverse -361 -379 8.27817 0.254
NP_442206.1_1 Reverse -222 -241 -11.3086 0.219
NP_442206.1_1 Reverse -228 -247 -12.6852 0.235
NP_442430.1_2 Forward -277 -258 2.16274 0.268
NP_441851.1_10 Reverse -242 -252 10.2065 0.0998
NP_441542.1_4 Forward -264 -250 4.03116 0.264
NP_441668.1_4 Forward -387 -368 10.8159 0.105
NP_442515.1_1 Reverse -305 -319 1.67122 0.152
NP_442515.1_1 Reverse -221 -235 0.196253 0.2
NP_441396.1_5 Forward -75 -66 8.35786 0.224
NP_441683.1_2 Forward -222 -203 16.3215 0.173
NP_441683.1_5 Forward -394 -375 10.6192 0.201
NP_440593.1_3 Reverse -364 -383 19.0757 0.0616
NP_440165.1_3 Reverse -380 -394 18.8785 0.162
NP_441046.1_2 Forward -81 -62 1.67108 0.256
NP_442689.1_8 Forward -323 -306 -2.71443 0.235
NP_441349.1_10 Forward -370 -351 -8.94866 0.28
NP_441409.1_6 Reverse -345 -364 2.3594 0.0584
NP_441409.1_6 Reverse -237 -256 -11.8986 0.224
NP_439960.1_10 Forward -247 -229 -2.63579 0.257
NP_441477.1_10 Forward -378 -360 0.0191479 0.286
NP_442006.1_2 Forward -246 -229 -15.3991 0.224
NP_442006.1_2 Reverse -163 -180 -17.4641 0.276
NP_442243.1_1 Forward -384 -366 -1.84987 0.281
NP_441570.1_1 Forward -360 -342 -3.52077 0.0715
NP_441570.1_1 Reverse -243 -261 -12.9605 0.22
NP_441078.1_4 Forward -231 -222 6.09625 0.0863
NP_441078.1_4 Forward -360 -351 0.196389 0.205
NP_441078.1_4 Reverse -351 -360 -0.000272808 0.205
NP_441078.1_4 Forward -371 -362 -1.57357 0.266
NP_441078.1_4 Reverse -243 -252 -2.06522 0.295
NP_441078.1_4 Reverse -222 -231 -2.06522 0.295
NP_442729.1_5 Forward -247 -237 16.6963 0.174
NP_442729.1_5 Forward -310 -300 16.4013 0.176
NP_442729.1_5 Forward -241 -231 8.1415 0.248
NP_442388.1_4 Reverse -296 -315 11.405 0.231
NP_441091.1_5 Reverse -263 -282 6.29264 0.22
NP_441091.1_5 Reverse -341 -360 3.83436 0.285
NP_440526.1_3 Reverse -301 -312 5.85971 0.229
NP_440526.1_3 Reverse -352 -363 0.64819 0.273
NP_441432.1_8 Forward -361 -352 14.0611 0.0258
NP_441432.1_8 Forward -232 -223 10.0295 0.0681
NP_441432.1_8 Forward -372 -363 5.50626 0.151
NP_441432.1_8 Reverse -380 -389 5.40793 0.158
NP_441432.1_8 Reverse -242 -251 4.52295 0.206
NP_442320.1_8 Forward -366 -352 -2.75368 0.0966
NP_441732.1_2 Reverse -218 -234 1.5335 0.0368
NP_440199.1_10 Forward -374 -364 7.25653 0.231
NP_440199.1_10 Forward -363 -353 7.25653 0.231
NP_441057.1_4 Reverse -206 -224 -2.0458 0.272
NP_441057.1_4 Forward -241 -223 -3.02911 0.278
NP_443011.1_4 Forward -247 -228 7.57094 0.266
NP_441072.1_2 Forward -371 -352 10.9142 0.189
NP_441072.1_2 Reverse -205 -224 7.17762 0.259
NP_440713.1_4 Reverse -206 -225 3.53937 0.242
NP_442489.1_7 Reverse -362 -371 4.91628 0.0892
NP_442489.1_7 Forward -360 -351 0.688044 0.152
NP_442489.1_7 Reverse -351 -360 0.688044 0.152
NP_442489.1_7 Forward -371 -362 -1.57357 0.213
NP_442489.1_7 Reverse -243 -252 -1.57357 0.213
NP_442489.1_7 Forward -231 -222 -1.6719 0.235
NP_440941.1_4 Forward -289 -275 20.4524 0.27
NP_440559.1_1 Reverse -352 -361 7.76787 0.0918
NP_441659.2_8 Reverse -351 -361 5.48657 0.106
NP_441659.2_8 Reverse -222 -232 3.22496 0.169
NP_441659.2_8 Forward -360 -350 1.84832 0.224
NP_441659.2_8 Reverse -258 -268 0.275027 0.27
NP_442913.1_10 Reverse -213 -232 -1.18052 0.167
NP_441040.1_5 Forward -382 -363 2.55606 0.28
NP_439956.1_7 Forward -395 -376 3.24438 0.257
NP_441800.1_7 Reverse -223 -241 -0.177514 0.222
NP_440335.1_9 Reverse -305 -323 10.4422 0.28
NP_442346.1_2 Reverse -330 -349 5.211 0.281
NP_442346.1_5 Forward -283 -273 8.92815 0.121
NP_442346.1_5 Forward -225 -215 8.73149 0.128
NP_442346.1_5 Reverse -242 -252 5.48657 0.243
NP_442346.1_5 Reverse -227 -237 4.79825 0.272
NP_440352.1_5 Forward -271 -252 18.7879 0.0454
NP_440545.1_3 Reverse -218 -235 -0.551145 0.155
NP_440545.1_3 Forward -219 -202 -4.58271 0.229
NP_441923.1_6 Forward -308 -294 16.8142 0.143
NP_440459.1_2 Reverse -360 -377 13.0185 0.131
NP_440459.1_2 Forward -380 -363 10.8552 0.189
NP_440459.1_2 Reverse -366 -383 10.2653 0.204
NP_440010.1_4 Reverse -227 -246 6.58682 0.199
NP_440010.1_4 Forward -247 -228 1.96529 0.227
NP_440010.1_4 Forward -283 -264 1.27698 0.24
NP_440010.1_4 Reverse -284 -303 -3.54122 0.299
NP_442603.1_7 Forward -360 -346 10.2254 0.132
NP_443022.1_3 Forward -175 -156 16.8141 0.126
NP_441050.1_5 Forward -228 -210 4.73903 0.194
NP_440449.1_4 Forward -330 -311 17.0107 0.192
NP_440170.1_6 Reverse -357 -376 16.8141 0.125
NP_441833.1_4 Reverse -352 -359 6.52896 0.0924
NP_441833.1_4 Forward -359 -352 6.23397 0.163
NP_441895.1_2 Forward -143 -124 -26.7466 0.247
NP_441895.1_10 Forward -83 -64 -27.7299 0.29
NP_442060.1_9 Forward -248 -229 9.93088 0.165
NP_442060.1_10 Forward -316 -297 13.2741 0.244
NP_442699.1_8 Forward -269 -250 -2.36049 0.217
NP_442162.1_9 Forward -359 -352 12.9205 0.0282
NP_442162.1_9 Reverse -352 -359 12.9205 0.0282
NP_440671.1_4 Reverse -362 -376 8.16106 0.202
NP_440671.1_4 Reverse -237 -251 7.86607 0.207
NP_440671.1_4 Forward -366 -352 5.70279 0.275
NP_440204.1_1 Forward -329 -310 15.6341 0.118
NP_440830.1_3 Reverse -97 -116 14.1583 0.284
NP_442199.1_5 Forward -392 -373 -6.88371 0.283
NP_442140.1_3 Reverse -352 -362 8.23984 0.122
NP_442140.1_3 Forward -239 -229 6.96153 0.156
NP_442140.1_3 Reverse -223 -233 4.10993 0.261
NP_442140.1_3 Forward -308 -298 3.81494 0.278
NP_441671.1_10 Forward -395 -376 6.98095 0.205
NP_440875.1_9 Forward -369 -359 8.27469 0.233
NP_440875.1_9 Reverse -353 -363 7.69067 0.255
NP_441813.1_5 Reverse -349 -359 12.7631 0.0192
NP_441813.1_5 Forward -362 -352 8.4365 0.0432
NP_441813.1_7 Reverse -61 -75 8.65209 0.278
NP_440590.1_4 Reverse -352 -365 1.59258 0.118
NP_440590.1_4 Forward -230 -217 -0.472371 0.189
NP_440567.1_1 Reverse -352 -366 2.65453 0.167
NP_442497.1_10 Reverse -352 -361 0.589713 0.153
NP_442497.1_10 Forward -359 -350 -1.18024 0.256
NP_440821.1_4 Forward -362 -352 -0.314959 0.251
NP_441239.1_9 Reverse -349 -361 10.5604 0.076
NP_441239.1_9 Forward -386 -374 3.18557 0.292
NP_441239.1_9 Forward -379 -367 2.98891 0.3
NP_441892.1_1 Reverse -342 -359 -2.12444 0.218
NP_440665.1_1 Reverse -231 -250 1.17943 0.177
NP_440665.1_1 Forward -252 -233 -6.68705 0.209
NP_442193.1_1 Forward -315 -297 13.1955 0.221
NP_442193.1_8 Reverse -348 -367 11.2084 0.269
NP_442270.1_9 Forward -382 -363 0.0977854 0.142
NP_440949.1_7 Reverse -235 -254 13.9616 0.199
NP_440354.1_5 Reverse -219 -238 5.40766 0.196
NP_442052.1_8 Forward -226 -216 11.8781 0.297
NP_440546.1_4 Forward -360 -350 15.6695 0.0459
NP_440546.1_4 Forward -231 -221 7.23423 0.252
NP_440441.1_7 Forward -374 -355 7.96426 0.251
NP_440462.1_6 Reverse -349 -359 12.9597 0.0319
NP_442611.1_3 Forward -376 -358 12.8022 0.263
NP_440868.1_4 Reverse -347 -359 9.67541 0.0441
NP_440868.1_4 Forward -364 -352 5.54551 0.0954
NP_442499.1_4 Forward -380 -366 12.0943 0.226
NP_441474.1_1 Reverse -281 -300 -0.0996487 0.255
NP_441672.1_10 Forward -229 -210 19.174 0.122
NP_442402.1_10 Reverse -61 -71 11.1893 0.269
NP_442402.1_10 Forward -218 -208 10.206 0.299
NP_440653.1_10 Reverse -369 -388 7.66927 0.201
NP_440653.1_10 Forward -383 -364 6.58763 0.203
NP_442039.1_4 Forward -359 -352 11.6422 0.0747
NP_442837.1_3 Forward -359 -352 6.0373 0.25
NP_442837.1_3 Reverse -352 -359 6.0373 0.25
NP_442053.1_1 Reverse -351 -360 14.4544 0.0114
NP_442053.1_1 Forward -360 -351 7.86621 0.0863
NP_440505.1_3 Forward -362 -352 16.7946 0.00614
NP_442360.1_5 Forward -230 -220 12.9597 0.298
NP_442456.1_5 Reverse -29 -47 13.5888 0.233
NP_440914.1_1 Reverse -351 -361 13.1043 0.0386
NP_440914.1_1 Forward -360 -350 10.8597 0.118
NP_440914.1_1 Forward -377 -367 10.2742 0.147
NP_440914.1_4 Forward -223 -207 10.2842 0.274
NP_442470.1_3 Reverse -224 -243 16.4199 0.12
NP_441011.1_8 Forward -359 -350 11.5045 0.0778
NP_442533.1_6 Reverse -222 -231 5.40793 0.14
NP_442533.1_6 Reverse -351 -360 4.42462 0.179
NP_442533.1_6 Reverse -273 -282 4.42462 0.179
NP_442533.1_6 Forward -19 -10 1.37636 0.3
NP_441219.1_8 Reverse -236 -255 20.6481 0.0569
NP_441482.1_7 Reverse -237 -251 -11.3085 0.254
NP_441482.1_7 Reverse -375 -389 -11.4068 0.262
NP_439944.1_9 Reverse -244 -254 4.99491 0.284
NP_441697.1_5 Forward -119 -100 -9.02441 0.268
NP_440115.1_6 Forward -363 -353 6.8632 0.167
NP_440007.1_9 Forward -364 -350 11.5043 0.163
NP_440007.1_9 Reverse -239 -253 11.111 0.163
NP_441602.1_3 Forward -236 -217 -2.75381 0.238
NP_441972.1_5 Reverse -370 -389 -7.37537 0.248
NP_439903.1_6 Reverse -359 -378 0.490334 0.261
NP_442588.1_8 Forward -90 -71 5.01433 0.289
NP_442306.1_10 Reverse -346 -365 -20.65 0.219
NP_441286.1_1 Forward -361 -349 3.97222 0.0397
NP_441286.1_1 Forward -253 -241 0.432302 0.113
NP_441286.1_1 Reverse -242 -254 -6.94252 0.288
NP_442674.1_3 Reverse -235 -254 12.29 0.174
NP_440670.1_8 Forward -360 -351 8.75118 0.0606
NP_440670.1_8 Reverse -351 -360 6.19458 0.124
NP_440886.1_7 Reverse -230 -240 7.64939 0.0865
NP_440886.1_7 Reverse -350 -360 6.76441 0.114
NP_441001.1_10 Forward -283 -264 12.6841 0.249
NP_441001.1_10 Forward -241 -222 6.29264 0.249
NP_441001.1_10 Forward -247 -228 5.01433 0.292
NP_442614.1_2 Forward -360 -346 9.34103 0.242
NP_439995.1_7 Reverse -347 -361 19.0751 0.174
NP_442401.1_2 Forward -225 -206 7.57013 0.259
NP_441808.1_2 Forward -145 -126 8.75091 0.235
NP_441808.1_8 Forward -82 -63 9.43923 0.259
NP_441808.1_8 Reverse -210 -229 8.84924 0.259
NP_442264.1_2 Forward -256 -239 12.8219 0.161
NP_442264.1_2 Forward -241 -224 11.1502 0.185
NP_442264.1_2 Forward -319 -302 9.38028 0.196
NP_441021.1_1 Reverse -352 -371 -6.58872 0.18
NP_441021.1_1 Reverse -363 -382 -9.24366 0.212
NP_441463.1_3 Forward -262 -243 -2.65548 0.158
NP_441463.1_3 Reverse -281 -300 -3.73712 0.184
NP_441463.1_3 Forward -400 -381 -9.93197 0.287
NP_441463.1_3 Reverse -233 -252 -10.1286 0.289
NP_441463.1_6 Forward -254 -240 6.41593 0.273
NP_441463.1_6 Forward -248 -234 5.73949 0.287
NP_441626.1_2 Forward -359 -352 12.2322 0.0511
NP_441626.1_2 Reverse -352 -359 5.93897 0.231
NP_442365.1_7 Reverse -218 -237 5.89931 0.124
NP_442365.1_7 Reverse -347 -366 1.86774 0.168
NP_442209.1_10 Forward -213 -194 16.0265 0.294
NP_442794.1_1 Reverse -233 -245 7.51213 0.137
NP_442794.1_1 Reverse -239 -251 7.4138 0.138
NP_442794.1_1 Forward -244 -232 5.05386 0.236
NP_442794.1_1 Forward -381 -369 2.59558 0.287
NP_441962.1_4 Forward -245 -226 -8.35868 0.199
NP_441962.1_4 Reverse -301 -320 -10.817 0.232
NP_441962.1_9 Reverse -261 -280 5.89931 0.258
NP_441488.1_8 Forward -365 -351 6.78381 0.295
NP_441836.1_2 Forward -243 -224 1.57275 0.191
NP_441836.1_2 Forward -288 -269 -4.03212 0.251
NP_440634.1_10 Reverse -267 -286 12.585 0.164
NP_440634.1_10 Reverse -285 -304 10.6184 0.221
NP_440634.1_10 Reverse -282 -301 6.88182 0.261
NP_441993.1_1 Forward -377 -358 1.94669 0.267
NP_440467.1_3 Forward -251 -232 13.5024 0.19
NP_440114.1_10 Forward -360 -346 12.4876 0.0814
NP_440114.1_10 Reverse -351 -365 6.3911 0.273
NP_442698.1_10 Reverse -37 -56 6.29264 0.233
NP_442323.1_7 Forward -377 -358 6.09517 0.201
NP_440766.1_5 Forward -264 -252 7.75128 0.288
NP_441237.1_9 Reverse -369 -379 11.2881 0.189
NP_442743.1_5 Forward -389 -370 5.40766 0.202
NP_440457.1_1 Reverse -202 -214 14.002 0.0753
NP_440457.1_1 Forward -364 -352 11.1504 0.092
NP_440457.1_1 Reverse -239 -251 5.44718 0.141
NP_440213.1_5 Forward -389 -370 14.1591 0.186
NP_441436.1_6 Forward -276 -257 22.3206 0.0446
NP_441436.1_6 Forward -240 -221 8.16093 0.26
NP_442514.1_5 Forward -181 -162 -3.44288 0.228
NP_442514.1_5 Forward -385 -366 -5.1145 0.254
NP_440554.1_4 Reverse -352 -362 5.97822 0.128
NP_442737.1_5 Forward -247 -228 13.7516 0.211
NP_442737.1_5 Forward -280 -261 11.8124 0.284
NP_441885.1_5 Forward -231 -221 7.64985 0.0466
NP_441885.1_5 Reverse -351 -361 1.25834 0.11
NP_441885.1_5 Forward -360 -350 -0.0199663 0.186
NP_441885.1_5 Forward -267 -257 -1.78992 0.284
NP_442341.1_6 Reverse -283 -302 19.3698 0.161
NP_442341.1_7 Reverse -221 -235 12.1926 0.0467
NP_442341.1_7 Forward -253 -239 7.66941 0.0994
NP_442341.1_7 Forward -232 -218 2.06454 0.271
NP_442341.1_7 Reverse -361 -375 1.27789 0.295
NP_442341.1_9 Forward -362 -348 7.47213 0.198
NP_441173.1_9 Reverse -254 -262 12.1137 0.21
NP_443000.1_7 Forward -362 -352 10.2065 0.0355
NP_440507.2_3 Forward -261 -242 11.0117 0.197
NP_443059.1_10 Reverse -229 -248 1.6703 0.239
NP_441842.1_10 Reverse -236 -250 7.07942 0.267
NP_440275.1_3 Forward -362 -352 12.5664 0.0316
NP_440091.1_1 Forward -364 -352 1.02229 0.218
NP_442354.1_7 Forward -270 -251 16.9124 0.0569
NP_442275.1_1 Reverse -306 -325 -0.197208 0.295
NP_440679.1_5 Forward -249 -230 7.66927 0.292
NP_443010.1_4 Reverse -283 -302 12.8808 0.103
NP_441122.1_1 Reverse -364 -379 4.79811 0.28
NP_441122.1_1 Forward -382 -367 3.81481 0.28
NP_442753.1_6 Reverse -297 -316 6.58682 0.26
NP_440149.1_8 Forward -282 -263 -5.9004 0.235
NP_441105.1_3 Reverse -364 -383 -3.63879 0.184
NP_441105.1_3 Forward -388 -369 -6.68705 0.239
NP_441105.1_3 Reverse -357 -376 -9.83364 0.297
NP_441105.1_3 Reverse -370 -389 -10.0303 0.3
NP_440216.1_1 Reverse -351 -365 -2.85201 0.0608
NP_440216.1_1 Forward -371 -357 -2.95034 0.0635
NP_440216.1_9 Reverse -302 -311 7.76787 0.286
NP_440216.1_9 Forward -141 -132 6.48957 0.289
NP_440172.1_1 Forward -360 -350 8.82982 0.0586
NP_440172.1_1 Reverse -351 -361 2.24165 0.279
NP_440172.1_1 Forward -371 -361 1.84832 0.294
NP_440167.1_3 Forward -225 -206 11.3075 0.231
NP_442015.1_10 Forward -244 -231 1.19926 0.21
NP_442015.1_10 Reverse -166 -179 0.117615 0.241
NP_441226.1_7 Forward -359 -352 12.7234 0.0312
NP_441226.1_7 Reverse -352 -359 11.5435 0.0757
NP_441111.1_7 Reverse -352 -360 8.86921 0.0589
NP_441766.1_2 Reverse -351 -360 14.7494 0.00772
NP_441766.1_9 Forward -239 -220 -2.36049 0.278
NP_442252.1_4 Forward -70 -51 16.6174 0.221
NP_443052.1_8 Forward -262 -243 -1.27885 0.0786
NP_442403.1_8 Forward -298 -279 -1.7705 0.258
NP_442403.1_8 Forward -250 -231 -2.36049 0.267
NP_442154.1_1 Forward -317 -299 -5.38906 0.127
NP_442154.1_1 Forward -245 -227 -6.4707 0.139
NP_442154.1_1 Forward -308 -290 -7.35568 0.141
NP_442154.1_1 Forward -239 -221 -15.1238 0.218
NP_441430.1_7 Reverse -77 -96 10.1275 0.277
NP_442564.1_6 Reverse -306 -325 15.1424 0.28
NP_440988.1_10 Forward -233 -219 8.57771 0.205
NP_440988.1_10 Reverse -220 -234 4.41476 0.261
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCATTCTTGCTGAGAATGCCTTGGCCAATGGCAATGGACTGGCGATCGGGTTCAATGGTCACAGTCTGCTGACTTGGACTTTTGCTGTAGTTGCCATGGTGGTGATGATGTTCTTGCTGGTCATGGTCATCATGGCTGTGGGCAAAATTTCCATCGCCATGGTGATGGTGGCTATGGGCAACGGTTCCCACCGCACTACAACCGCAGTTTTGGCACATAATAACCTTCCCCCTCGGGCGGAAATATTAATGTTATGACCCCATGGTAAGAGAGGATGCTTGAAAGAGGTTCTACTTTAATTGCCATTTGGCACAGTAATCTGGAATTGATGGTGGAGACCCAGGTTTGTCTTTTCTGGCTCCATTGATTAAATATCCAATTTCCCAGCCCCATTTTTGTA

CDS

ATGACAGCTCCCCTAACCCTCAACTTACTCCAAGGTTCTGTTCGTTTTCCCTTTAGTGCCGAAGCGGCGATCACCCTCCAGGGGGAGATCAACCAATTGGTCAATCAATTAAAGGCCATTGGTGCTCAGGTTAACCAGGGAGGCCGACCGGAGAAGCAACAGAATTTGGAATATTGCCACAGTGGAGAAGTCTTTTTAGAAGTATTTTGCAACCCAAATATTTACCCCAGCCCCTTTGCGGCTAAGGTATTGCTCACACTACGGGATGACCGGATTCGTTTGACCACGGAAGCGGAATTGCCCAGACTCATTGAAGATTTGGCTGAATATCTAGCCCAGCATGGTTAG

Protein

MTAPLTLNLLQGSVRFPFSAEAAITLQGEINQLVNQLKAIGAQVNQGGRPEKQQNLEYCHSGEVFLEVFCNPNIYPSPFAAKVLLTLRDDRIRLTTEAELPRLIEDLAEYLAQHG