Your browser is old and dusty. Try Google Chrome!

Details for slr1531

ORF slr1531
Accession NP_441626.1
Symbol ffh
Category Protein and peptide secretion
Definition signal recognition particle protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -141 -127 11.2093 0.0531
NP_440795.1_7 Forward -141 -134 14.6904 0.0123
NP_440795.1_7 Reverse -134 -141 14.6904 0.0123
NP_441418.1_6 Reverse -133 -152 -2.65548 0.0201
NP_441418.1_6 Forward -142 -123 -8.94866 0.0273
NP_442291.1_5 Forward -143 -127 3.30346 0.112
NP_440897.1_6 Forward -142 -123 9.63507 0.0705
NP_441453.1_1 Forward -149 -131 4.44329 0.26
NP_441453.1_4 Reverse -133 -141 16.539 0.00633
NP_441453.1_4 Forward -142 -134 16.539 0.00633
NP_441623.1_3 Reverse -241 -260 20.8591 0.0471
NP_442151.1_6 Forward -142 -128 19.7641 0.0045
NP_442151.1_6 Reverse -133 -147 6.29277 0.24
NP_441818.1_1 Forward -141 -130 18.8393 0.00301
NP_441818.1_9 Forward -108 -89 -11.0136 0.3
NP_440226.1_1 Reverse -133 -152 18.9773 0.0124
NP_440226.1_1 Forward -142 -123 3.93269 0.209
NP_441630.1_3 Reverse -125 -144 6.78429 0.126
NP_442623.1_3 Forward -141 -122 -0.590531 0.0786
NP_440931.1_7 Reverse -87 -105 18.7012 0.12
NP_442655.1_1 Forward -147 -128 0.786102 0.24
NP_442173.1_1 Forward -141 -133 15.4574 0.00633
NP_442173.1_1 Reverse -134 -142 15.4574 0.00633
NP_442752.1_4 Forward -142 -135 13.8055 0.0199
NP_442752.1_4 Reverse -133 -140 13.8055 0.0199
NP_442752.1_4 Forward -97 -90 12.1338 0.0546
NP_443027.1_4 Forward -144 -134 14.828 0.0437
NP_443027.1_4 Reverse -131 -141 14.0414 0.0452
NP_441812.1_3 Reverse -132 -146 16.8142 0.0639
NP_442975.1_10 Forward -146 -132 13.7653 0.0459
NP_442975.1_10 Reverse -129 -143 5.01387 0.234
NP_440784.1_7 Forward -141 -134 15.9687 0.0123
NP_440784.1_7 Reverse -134 -141 15.9687 0.0123
NP_441054.1_4 Forward -152 -134 1.00246 0.173
NP_441476.1_5 Reverse -122 -141 -6.68705 0.275
NP_440878.1_9 Reverse -123 -142 -2.75381 0.276
NP_442062.1_3 Reverse -237 -256 -0.590531 0.248
NP_442062.1_3 Forward -41 -22 -0.787193 0.25
NP_442062.1_8 Reverse -133 -143 19.4496 0.000558
NP_442062.1_8 Forward -142 -132 17.3846 0.00193
NP_441900.1_2 Forward -249 -231 -4.2098 0.288
NP_441802.1_1 Forward -345 -326 11.4058 0.197
NP_440304.1_4 Forward -144 -134 10.8948 0.051
NP_440304.1_4 Reverse -131 -141 10.8948 0.051
NP_442242.1_4 Forward -141 -134 14.3954 0.0124
NP_442242.1_4 Reverse -134 -141 14.3954 0.0124
NP_440044.1_8 Forward -141 -122 2.16274 0.155
NP_441781.1_7 Forward -142 -123 3.6377 0.188
NP_440908.1_3 Reverse -67 -86 18.9765 0.188
NP_440011.1_1 Forward -144 -125 11.9958 0.265
NP_441594.1_6 Forward -75 -56 -0.39387 0.299
NP_442276.1_2 Reverse -121 -140 8.65258 0.285
NP_442110.1_7 Forward -142 -128 18.9775 0.0138
NP_441925.1_4 Reverse -111 -130 -16.0292 0.278
NP_440014.1_7 Reverse -124 -138 16.2235 0.225
NP_441083.1_3 Reverse -62 -72 16.8925 0.091
NP_441083.1_5 Forward -142 -132 20.3345 0.00053
NP_441083.1_5 Reverse -133 -143 11.3864 0.0159
NP_442827.1_8 Reverse -125 -144 3.63691 0.144
NP_441434.1_1 Forward -37 -23 7.93745 0.26
NP_441738.1_2 Forward -140 -133 15.28 0.0102
NP_441738.1_2 Reverse -135 -142 15.28 0.0102
NP_441558.1_5 Reverse -131 -150 11.6025 0.0789
NP_440209.1_1 Reverse -133 -141 18.1123 0.00295
NP_440209.1_1 Forward -142 -134 18.1123 0.00295
NP_442889.1_8 Forward -145 -131 11.897 0.0729
NP_441713.1_1 Forward -148 -129 -12.4886 0.245
NP_441713.1_1 Forward -73 -54 -14.9469 0.26
NP_440178.1_7 Forward -143 -124 -15.2418 0.159
NP_442706.1_10 Forward -140 -122 15.5554 0.229
NP_442570.1_3 Forward -144 -125 -4.42544 0.23
NP_442462.1_2 Reverse -309 -328 9.14423 0.172
NP_442462.1_2 Forward -132 -113 6.09597 0.208
NP_441716.1_1 Reverse -133 -147 11.111 0.0936
NP_441716.1_1 Forward -142 -128 6.09611 0.207
NP_442111.1_4 Reverse -132 -146 10.226 0.0553
NP_441624.1_7 Reverse -94 -108 7.76774 0.245
NP_440343.1_9 Forward -107 -88 6.29264 0.3
NP_440906.1_5 Forward -141 -134 15.8704 0.0124
NP_440906.1_5 Reverse -134 -141 15.8704 0.0124
NP_440012.1_6 Reverse -179 -198 9.43923 0.247
NP_440747.1_10 Forward -145 -133 7.70879 0.00236
NP_440747.1_10 Reverse -130 -142 7.51213 0.00286
NP_440322.1_9 Forward -232 -213 20.944 0.104
NP_441130.1_10 Forward -144 -130 10.816 0.11
NP_441486.1_1 Reverse -130 -144 19.6658 0.00323
NP_441486.1_1 Forward -145 -131 11.2093 0.0168
NP_442634.1_4 Reverse -131 -145 -1.5737 0.149
NP_441265.1_3 Forward -148 -134 1.86788 0.2
NP_440403.1_4 Forward -135 -116 -3.3438 0.197
NP_440057.1_5 Forward -255 -236 12.29 0.297
NP_442848.1_1 Reverse -127 -141 6.98109 0.0791
NP_442848.1_9 Reverse -100 -119 8.06259 0.182
NP_441012.1_4 Forward -70 -57 12.704 0.237
NP_443018.1_3 Forward -141 -134 14.8871 0.0123
NP_443018.1_3 Reverse -134 -141 14.8871 0.0123
NP_441634.1_8 Forward -74 -60 5.50613 0.114
NP_441634.1_8 Reverse -131 -145 3.63784 0.145
NP_440376.1_1 Forward -142 -133 19.4693 0.000692
NP_440376.1_1 Reverse -133 -142 19.4693 0.000692
NP_440376.1_1 Forward -115 -106 2.94966 0.213
NP_440376.1_1 Forward -97 -88 0.196389 0.283
NP_441588.1_4 Forward -140 -130 8.63316 0.14
NP_442687.1_1 Forward -339 -326 11.5234 0.273
NP_442687.1_7 Forward -143 -133 15.8113 0.0125
NP_442687.1_7 Reverse -132 -142 8.92815 0.0994
NP_442687.1_7 Forward -67 -57 4.0116 0.271
NP_442485.1_3 Reverse -104 -123 -2.45882 0.262
NP_441013.1_2 Forward -354 -336 -3.02911 0.288
NP_441388.1_1 Reverse -100 -119 11.4058 0.257
NP_441763.1_10 Forward -153 -134 8.35677 0.218
NP_442658.1_1 Forward -144 -134 15.9091 0.00966
NP_442658.1_1 Reverse -131 -141 6.76441 0.214
NP_442161.1_7 Reverse -83 -102 21.4356 0.00773
NP_442782.1_2 Reverse -133 -147 1.67122 0.281
NP_442782.1_2 Forward -124 -110 0.687908 0.286
NP_442544.1_6 Forward -149 -130 -6.39206 0.298
NP_441414.1_9 Forward -142 -123 -8.35868 0.234
NP_441256.1_1 Forward -145 -126 -5.21209 0.233
NP_441958.1_5 Forward -143 -133 12.2714 0.00183
NP_441958.1_5 Reverse -132 -142 12.2714 0.00183
NP_442876.1_3 Reverse -242 -261 4.32602 0.281
NP_441097.1_2 Forward -106 -89 15.0835 0.125
NP_439990.1_5 Reverse -128 -141 9.95071 0.128
NP_439990.1_5 Forward -77 -64 9.06573 0.153
NP_442911.1_2 Forward -152 -133 6.78429 0.0277
NP_442911.1_2 Reverse -123 -142 -2.16383 0.0946
NP_441580.1_6 Reverse -122 -141 -5.01543 0.235
NP_440153.1_5 Forward -141 -127 0.392915 0.299
NP_440153.1_8 Forward -72 -59 -2.73398 0.256
NP_440993.1_2 Reverse -128 -144 1.43517 0.279
NP_439975.1_2 Forward -102 -84 7.88563 0.215
NP_441099.1_5 Reverse -123 -142 -3.14714 0.131
NP_441099.1_5 Forward -152 -133 -7.27704 0.172
NP_442002.1_1 Forward -106 -88 5.42735 0.116
NP_442002.1_9 Forward -143 -136 10.7572 0.185
NP_440809.1_9 Forward -151 -133 -8.14232 0.227
NP_442438.1_10 Reverse -128 -142 14.4542 0.0311
NP_442438.1_10 Forward -147 -133 4.22782 0.15
NP_441000.1_6 Reverse -132 -146 -3.83532 0.225
NP_441000.1_6 Forward -143 -129 -4.91696 0.254
NP_441000.1_6 Reverse -105 -119 -5.01529 0.257
NP_440147.1_4 Forward -144 -131 3.36254 0.188
NP_440147.1_4 Reverse -131 -144 0.805932 0.244
NP_441295.1_4 Reverse -128 -147 -1.47551 0.29
NP_441550.1_8 Reverse -131 -141 12.3692 0.0336
NP_441550.1_8 Forward -90 -80 7.64939 0.153
NP_441550.1_8 Forward -144 -134 6.0761 0.214
NP_441550.1_8 Reverse -188 -198 5.97777 0.22
NP_441550.1_8 Reverse -77 -87 4.99446 0.274
NP_441916.1_7 Reverse -133 -143 18.4663 0.00144
NP_441916.1_7 Forward -142 -132 10.3048 0.0261
NP_440345.1_5 Forward -58 -44 16.8168 0.263
NP_441041.1_4 Reverse -133 -152 8.35759 0.0331
NP_441041.1_4 Forward -142 -123 -1.7705 0.103
NP_441041.1_7 Forward -145 -133 7.61196 0.162
NP_442004.1_6 Forward -142 -128 1.86788 0.276
NP_440703.1_9 Forward -72 -59 9.5568 0.216
NP_441725.1_5 Forward -141 -131 11.2881 0.0247
NP_441725.1_5 Reverse -134 -144 11.2881 0.0247
NP_439966.1_7 Forward -144 -134 18.4657 0.00473
NP_439966.1_7 Reverse -131 -141 15.8108 0.0124
NP_439966.1_9 Forward -144 -135 0.983037 0.253
NP_442941.1_3 Forward -141 -131 19.9412 0.00262
NP_442941.1_3 Reverse -134 -144 11.4848 0.0116
NP_440289.1_2 Forward -145 -132 11.819 0.0171
NP_440289.1_2 Reverse -130 -143 6.60746 0.0591
NP_442281.1_1 Reverse -128 -142 16.8135 0.00698
NP_442281.1_1 Forward -147 -133 12.0937 0.0409
NP_442281.1_1 Reverse -83 -97 2.35894 0.269
NP_442281.1_5 Forward -139 -120 13.7649 0.288
NP_440437.1_1 Reverse -127 -146 5.01433 0.092
NP_440437.1_1 Forward -148 -129 -5.40875 0.282
NP_440498.1_1 Forward -151 -133 0.21581 0.218
NP_442982.1_5 Reverse -123 -142 -3.24547 0.297
NP_441644.1_6 Forward -142 -132 17.3841 0.00127
NP_441644.1_6 Reverse -133 -143 10.1076 0.0628
NP_442215.1_2 Forward -144 -128 15.4965 0.0171
NP_442215.1_2 Forward -117 -101 -4.46469 0.233
NP_440253.1_2 Reverse -133 -151 8.7706 0.0526
NP_440253.1_2 Forward -142 -124 -3.42244 0.294
NP_440929.1_8 Forward -142 -133 19.2726 0.000701
NP_440929.1_8 Reverse -133 -142 19.2726 0.000701
NP_442933.1_10 Forward -142 -133 17.601 0.00325
NP_442933.1_10 Reverse -133 -142 17.601 0.00325
NP_441751.2_8 Reverse -134 -148 -1.8687 0.132
NP_441751.2_8 Forward -141 -127 -3.04867 0.134
NP_442554.1_8 Forward -141 -131 15.9097 0.00747
NP_442554.1_8 Reverse -134 -144 13.8447 0.0145
NP_442554.1_8 Reverse -64 -74 4.50326 0.184
NP_442554.1_8 Forward -71 -61 3.12662 0.239
NP_442075.1_10 Reverse -133 -152 10.5209 0.299
NP_441762.1_7 Reverse -132 -144 2.89058 0.0676
NP_441762.1_7 Forward -143 -131 2.30059 0.0676
NP_442142.1_4 Forward -145 -132 17.1282 0.0264
NP_442142.1_4 Reverse -130 -143 16.7349 0.0264
NP_442292.1_1 Forward -141 -132 18.486 0.00229
NP_442292.1_1 Reverse -134 -143 9.63616 0.0183
NP_441711.1_4 Reverse -124 -143 3.93269 0.228
NP_443009.1_5 Reverse -132 -143 18.3477 0.00265
NP_442408.2_1 Forward -142 -123 8.35759 0.143
NP_441715.1_4 Reverse -134 -144 16.303 0.0117
NP_441715.1_4 Forward -141 -131 14.828 0.0268
NP_440357.1_3 Forward -99 -80 2.85105 0.245
NP_440183.1_9 Reverse -113 -132 -14.9469 0.273
NP_441468.1_1 Forward -141 -134 15.8704 0.0124
NP_441468.1_1 Reverse -134 -141 15.8704 0.0124
NP_441020.2_6 Forward -144 -127 8.88863 0.185
NP_441015.1_10 Forward -141 -122 -8.06369 0.272
NP_441015.1_10 Forward -129 -110 -10.6203 0.286
NP_441673.1_1 Forward -142 -133 20.8459 0.000698
NP_441673.1_1 Reverse -133 -142 20.8459 0.000698
NP_441826.1_2 Reverse -127 -141 15.6342 0.0196
NP_441826.1_2 Forward -142 -128 -0.492064 0.213
NP_442868.1_6 Reverse -131 -141 9.91146 0.038
NP_442868.1_6 Forward -144 -134 0.963343 0.205
NP_441251.1_8 Reverse -240 -253 10.1839 0.298
NP_441056.1_1 Forward -142 -123 -0.590531 0.166
NP_441612.1_2 Forward -142 -132 8.54929 0.21
NP_441612.1_2 Forward -343 -333 6.80666 0.277
NP_443058.1_7 Reverse -132 -151 4.03102 0.26
NP_443058.1_7 Forward -137 -118 2.85105 0.279
NP_442361.1_3 Reverse -127 -140 19.5871 0.0363
NP_442808.1_1 Forward -143 -133 18.4657 0.00201
NP_442808.1_1 Reverse -132 -142 8.63269 0.0481
NP_440031.1_10 Forward -108 -89 -0.000545616 0.282
NP_442718.1_2 Forward -187 -168 -2.85214 0.277
NP_442542.1_2 Forward -144 -131 11.4257 0.114
NP_442542.1_9 Reverse -126 -140 10.9137 0.111
NP_442050.1_5 Reverse -131 -141 16.4991 0.00812
NP_442050.1_5 Forward -144 -134 9.12434 0.193
NP_440558.1_2 Reverse -60 -79 -0.688862 0.204
NP_440558.1_2 Reverse -107 -126 -7.37537 0.293
NP_441518.1_3 Reverse -123 -142 -11.8986 0.261
NP_441878.1_6 Forward -143 -133 10.4031 0.0176
NP_441878.1_6 Reverse -132 -142 10.4031 0.0176
NP_441878.1_6 Reverse -109 -119 0.373358 0.144
NP_441878.1_6 Reverse -62 -72 -0.118297 0.167
NP_441036.1_8 Forward -143 -133 17.7779 0.000554
NP_441036.1_8 Reverse -132 -142 8.33817 0.174
NP_441557.1_5 Forward -142 -133 19.9609 0.000699
NP_441557.1_5 Reverse -133 -142 19.9609 0.000699
NP_441445.1_1 Forward -151 -132 18.1907 0.0287
NP_441590.1_4 Reverse -95 -114 5.01354 0.279
NP_442066.2_4 Forward -356 -337 -2.36049 0.211
NP_442419.1_2 Reverse -128 -147 -1.18052 0.246
NP_441308.1_8 Forward -144 -134 10.1081 0.22
NP_441308.1_8 Reverse -77 -87 8.73149 0.248
NP_441458.1_10 Reverse -124 -143 1.37609 0.29
NP_442183.1_1 Forward -142 -128 9.14437 0.101
NP_442183.1_1 Reverse -133 -147 8.16106 0.121
NP_442183.1_1 Forward -97 -83 4.03116 0.282
NP_442397.1_9 Forward -142 -123 5.60432 0.246
NP_441549.1_9 Forward -130 -112 -5.09406 0.198
NP_442347.1_2 Forward -141 -132 12.4878 0.056
NP_442347.1_2 Reverse -134 -143 11.1111 0.056
NP_442645.1_2 Forward -144 -125 -21.3384 0.29
NP_441037.1_4 Forward -144 -134 7.02532 0.237
NP_440151.1_5 Forward -120 -101 15.3391 0.0828
NP_441633.1_3 Reverse -131 -144 1.29759 0.109
NP_441633.1_3 Forward -144 -131 -3.81562 0.177
NP_440136.1_2 Forward -141 -134 15.9687 0.0123
NP_440136.1_2 Reverse -134 -141 15.9687 0.0123
NP_442590.1_10 Forward -142 -123 4.81767 0.27
NP_442998.1_10 Forward -140 -133 15.5754 0.0102
NP_442998.1_10 Reverse -135 -142 15.5754 0.0102
NP_440299.1_1 Reverse -129 -142 14.08 0.0259
NP_440299.1_1 Forward -146 -133 10.5401 0.0569
NP_441799.1_1 Forward -146 -132 10.6187 0.0702
NP_441799.1_1 Reverse -129 -143 5.99717 0.187
NP_441007.1_10 Reverse -128 -141 0.707601 0.219
NP_442333.2_5 Reverse -122 -141 -14.8485 0.284
NP_440256.1_1 Forward -145 -126 9.93088 0.0193
NP_440256.1_1 Reverse -130 -149 -2.95047 0.125
NP_440256.1_1 Reverse -96 -115 -9.047 0.273
NP_440087.1_1 Forward -124 -105 5.60432 0.166
NP_441362.1_2 Forward -299 -280 4.5041 0.269
NP_440709.1_1 Forward -44 -25 5.99684 0.162
NP_441559.1_8 Forward -147 -133 2.5562 0.143
NP_441270.1_5 Forward -182 -163 12.5063 0.236
NP_442860.1_9 Reverse -90 -103 19.7832 0.159
NP_440915.1_6 Reverse -129 -143 4.52282 0.0953
NP_441704.1_8 Reverse -122 -141 14.2566 0.105
NP_442069.1_8 Reverse -124 -143 5.70265 0.237
NP_439985.1_7 Reverse -57 -76 5.40766 0.224
NP_442993.1_1 Reverse -133 -149 1.33684 0.0555
NP_442386.1_9 Forward -143 -134 15.7322 0.0144
NP_442386.1_9 Reverse -132 -141 13.8639 0.0289
NP_442386.1_9 Reverse -126 -135 8.06244 0.209
NP_441340.1_5 Forward -141 -134 15.6737 0.0124
NP_441340.1_5 Reverse -134 -141 15.6737 0.0124
NP_442484.1_2 Reverse -122 -141 14.7491 0.042
NP_440168.1_8 Reverse -57 -76 23.3039 0.0375
NP_440168.1_8 Forward -84 -65 5.01433 0.216
NP_440168.1_9 Reverse -116 -135 -4.22878 0.296
NP_440194.1_3 Reverse -53 -72 0.884433 0.277
NP_440161.1_3 Reverse -131 -150 9.83255 0.237
NP_440586.1_8 Forward -141 -134 13.2151 0.026
NP_440586.1_8 Reverse -134 -141 13.2151 0.026
NP_442251.1_6 Forward -141 -134 15.2804 0.0124
NP_442251.1_6 Reverse -134 -141 15.2804 0.0124
NP_440684.1_9 Reverse -184 -198 14.8476 0.11
NP_441262.1_3 Reverse -133 -140 14.7888 0.0223
NP_441262.1_3 Forward -142 -135 14.7888 0.0223
NP_441262.1_5 Reverse -141 -160 9.53756 0.214
NP_443051.1_1 Reverse -132 -141 10.4228 0.00754
NP_443051.1_1 Forward -143 -134 10.4228 0.00754
NP_439937.1_9 Reverse -114 -131 -11.4665 0.256
NP_439937.1_9 Forward -354 -337 -14.9081 0.287
NP_439937.1_9 Reverse -132 -149 -16.5797 0.287
NP_440408.1_3 Reverse -127 -146 -1.57384 0.238
NP_440408.1_7 Forward -142 -123 7.37428 0.29
NP_440439.1_1 Forward -145 -132 8.37742 0.0537
NP_440439.1_1 Reverse -130 -143 0.117615 0.202
NP_440439.1_1 Reverse -76 -89 -1.45568 0.269
NP_440372.1_2 Forward -141 -134 16.3621 0.0124
NP_440372.1_2 Reverse -134 -141 16.3621 0.0124
NP_440574.1_3 Forward -147 -128 11.9958 0.0708
NP_441803.1_2 Forward -147 -128 7.57094 0.134
NP_439977.1_5 Forward -148 -129 4.81767 0.15
NP_439977.1_5 Reverse -63 -82 -3.24547 0.298
NP_440139.1_1 Forward -148 -129 4.32522 0.187
NP_441572.1_7 Reverse -127 -146 -3.83545 0.22
NP_442384.1_10 Forward -142 -129 10.049 0.047
NP_442384.1_10 Reverse -133 -146 6.80412 0.0939
NP_442384.1_10 Forward -199 -186 2.87088 0.21
NP_442384.1_10 Reverse -190 -203 2.57589 0.22
NP_442262.1_10 Forward -141 -134 14.1988 0.0123
NP_442262.1_10 Reverse -134 -141 14.1988 0.0123
NP_441689.1_5 Reverse -131 -141 15.3192 0.0403
NP_441689.1_5 Forward -144 -134 8.53436 0.132
NP_440163.1_10 Forward -145 -135 16.303 0.0762
NP_440163.1_10 Reverse -130 -140 11.3864 0.169
NP_440344.1_10 Reverse -126 -143 8.10198 0.0114
NP_440344.1_10 Forward -149 -132 2.79211 0.028
NP_440531.1_6 Reverse -125 -144 0.0977854 0.199
NP_440487.1_1 Forward -145 -126 -5.99873 0.232
NP_441965.1_10 Reverse -130 -146 6.05672 0.187
NP_441640.1_8 Forward -141 -122 0.982764 0.187
NP_442693.1_7 Reverse -98 -117 8.25926 0.273
NP_442693.1_7 Forward -131 -112 8.06259 0.275
NP_440297.1_9 Forward -141 -131 9.32148 0.0917
NP_440297.1_9 Reverse -134 -144 9.32148 0.0917
NP_440350.1_5 Forward -222 -203 -3.3438 0.26
NP_442280.1_10 Reverse -59 -77 8.86344 0.246
NP_442280.1_10 Forward -82 -64 7.40243 0.268
NP_440894.1_10 Forward -147 -128 8.55425 0.175
NP_440999.1_9 Forward -146 -132 3.63784 0.126
NP_440888.1_2 Forward -142 -128 20.7467 0.000502
NP_440888.1_2 Reverse -133 -147 13.2736 0.0307
NP_440888.1_2 Forward -62 -48 7.3738 0.198
NP_440491.1_1 Forward -145 -126 19.2941 0.0298
NP_441917.1_2 Forward -139 -121 4.9357 0.288
NP_441543.1_2 Reverse -134 -143 18.486 0.00236
NP_441543.1_2 Forward -141 -132 16.9127 0.00359
NP_442845.1_2 Forward -103 -89 14.9459 0.0763
NP_442845.1_2 Forward -142 -128 7.9644 0.195
NP_442845.1_2 Reverse -127 -141 6.29277 0.212
NP_442845.1_2 Forward -126 -112 3.24451 0.298
NP_441178.1_5 Reverse -121 -140 11.5042 0.225
NP_441469.1_8 Forward -143 -134 16.126 0.00797
NP_441469.1_8 Reverse -132 -141 6.48957 0.227
NP_442315.1_2 Forward -102 -90 9.38042 0.291
NP_443064.1_6 Forward -142 -132 12.5669 0.0796
NP_442578.1_7 Forward -141 -134 14.5921 0.026
NP_442578.1_7 Reverse -134 -141 14.5921 0.026
NP_441462.1_2 Forward -142 -132 11.5831 0.00406
NP_441462.1_2 Reverse -133 -143 11.5831 0.00406
NP_441621.1_7 Reverse -131 -145 -3.34366 0.188
NP_443062.1_1 Reverse -133 -151 9.42349 0.134
NP_443062.1_1 Reverse -88 -106 5.6207 0.224
NP_443062.1_1 Forward -142 -124 4.93815 0.244
NP_443062.1_6 Reverse -125 -144 7.17762 0.173
NP_443062.1_6 Forward -150 -131 1.0811 0.28
NP_442204.1_1 Reverse -129 -140 0.353664 0.281
NP_442204.1_1 Forward -146 -135 -0.0396598 0.285
NP_442780.1_1 Forward -39 -20 9.63589 0.206
NP_442780.1_3 Forward -301 -282 6.15881 0.269
NP_440516.1_8 Forward -142 -133 16.9127 0.00442
NP_440516.1_8 Reverse -133 -142 16.9127 0.00442
NP_442428.1_4 Forward -143 -124 8.06259 0.18
NP_442428.1_5 Forward -141 -134 15.8704 0.0124
NP_442428.1_5 Reverse -134 -141 15.8704 0.0124
NP_441032.1_4 Reverse -82 -101 9.53674 0.263
NP_441835.1_2 Reverse -282 -301 4.12936 0.276
NP_440673.1_3 Forward -140 -133 12.4288 0.0426
NP_440673.1_3 Reverse -135 -142 12.4288 0.0426
NP_440673.1_3 Forward -351 -344 7.80726 0.244
NP_440673.1_7 Reverse -122 -141 19.9606 0.0432
NP_441052.1_2 Forward -142 -132 19.9412 0.00106
NP_441052.1_2 Reverse -133 -143 10.5014 0.0285
NP_442219.1_9 Forward -141 -132 17.7976 0.00718
NP_442219.1_9 Reverse -134 -143 8.35786 0.0681
NP_440436.1_4 Reverse -134 -143 18.1905 0.00233
NP_440436.1_4 Forward -141 -132 17.2072 0.00233
NP_441884.1_9 Forward -145 -126 -3.73712 0.0594
NP_440314.1_1 Forward -50 -31 11.7008 0.219
NP_441719.1_4 Forward -141 -134 16.3621 0.0124
NP_441719.1_4 Reverse -134 -141 16.3621 0.0124
NP_441733.1_10 Reverse -130 -143 9.95071 0.106
NP_442366.1_3 Forward -143 -125 14.2771 0.0233
NP_442366.1_3 Reverse -132 -150 -5.09406 0.281
NP_442873.1_9 Reverse -123 -142 5.30853 0.268
NP_440296.1_10 Forward -145 -126 -14.3569 0.269
NP_441115.1_4 Forward -143 -125 7.3932 0.286
NP_442206.1_8 Reverse -300 -316 15.7561 0.278
NP_442854.1_6 Forward -72 -53 4.42435 0.252
NP_442854.1_6 Reverse -53 -72 3.14605 0.272
NP_443054.1_2 Forward -144 -130 3.34284 0.24
NP_443054.1_2 Reverse -131 -145 3.04785 0.24
NP_441851.1_10 Forward -143 -133 16.008 0.00552
NP_441851.1_10 Reverse -132 -142 15.8113 0.00552
NP_442856.1_7 Reverse -124 -143 -0.787193 0.21
NP_441668.1_4 Reverse -60 -79 5.70265 0.165
NP_442515.1_1 Reverse -132 -146 2.85119 0.129
NP_441982.1_6 Reverse -235 -244 12.1989 0.288
NP_441982.1_6 Forward -344 -335 11.5304 0.288
NP_441349.1_10 Reverse -123 -142 -8.752 0.278
NP_441409.1_6 Forward -148 -129 3.34271 0.0491
NP_441409.1_6 Reverse -127 -146 -8.35868 0.167
NP_440432.1_9 Forward -141 -126 -0.511758 0.164
NP_439960.1_10 Reverse -126 -144 -4.11075 0.292
NP_440474.1_8 Reverse -134 -148 4.8172 0.266
NP_440431.1_4 Reverse -201 -220 -10.0748 0.295
NP_442450.1_5 Reverse -131 -141 9.32148 0.115
NP_442450.1_5 Forward -144 -134 9.32148 0.115
NP_440588.1_2 Reverse -124 -143 -2.16383 0.161
NP_441031.1_1 Reverse -20 -39 6.24429 0.276
NP_442006.1_2 Forward -136 -119 -18.3491 0.29
NP_441570.1_1 Forward -142 -124 17.9154 0.00322
NP_441570.1_1 Forward -88 -70 -10.9939 0.184
NP_441078.1_4 Forward -142 -133 19.6659 0.0007
NP_441078.1_4 Reverse -133 -142 19.6659 0.0007
NP_442729.1_8 Reverse -129 -142 8.47575 0.125
NP_440539.1_9 Forward -351 -332 -3.63879 0.286
NP_440526.1_3 Forward -141 -130 10.1862 0.0646
NP_441432.1_8 Reverse -132 -141 16.8143 0.00595
NP_441432.1_8 Forward -143 -134 8.25953 0.0755
NP_441432.1_9 Forward -254 -241 10.2466 0.254
NP_442320.1_8 Reverse -127 -141 12.1926 0.0175
NP_442320.1_8 Forward -148 -134 6.88276 0.0227
NP_441732.1_2 Forward -146 -130 -7.90627 0.0983
NP_441732.1_2 Reverse -129 -145 -16.2644 0.165
NP_440760.1_1 Forward -142 -123 -15.6352 0.152
NP_442797.1_7 Reverse -126 -144 6.01734 0.212
NP_440199.1_10 Reverse -130 -140 16.7946 0.0381
NP_442353.1_3 Reverse -108 -127 7.07848 0.299
NP_440713.1_4 Reverse -123 -142 6.4893 0.189
NP_442489.1_2 Reverse -122 -141 1.17943 0.293
NP_442489.1_2 Forward -147 -128 0.58944 0.297
NP_442489.1_7 Forward -142 -133 20.1576 0.000695
NP_442489.1_7 Reverse -133 -142 20.1576 0.000695
NP_442079.1_7 Reverse -134 -153 3.24438 0.212
NP_440559.1_1 Forward -141 -132 17.4043 0.00658
NP_440559.1_1 Reverse -134 -143 8.75118 0.0586
NP_441659.2_8 Forward -142 -132 18.1713 0.00133
NP_441659.2_8 Reverse -133 -143 11.9764 0.0147
NP_442913.1_10 Reverse -124 -143 2.65439 0.123
NP_442849.1_1 Reverse -235 -249 8.25939 0.282
NP_439956.1_7 Reverse -47 -66 5.211 0.257
NP_440708.1_6 Reverse -95 -114 -5.80207 0.234
NP_440708.1_6 Forward -315 -296 -9.73531 0.273
NP_440779.1_5 Forward -142 -125 -5.56602 0.149
NP_442346.1_5 Reverse -132 -142 16.6963 0.00248
NP_442346.1_5 Forward -143 -133 9.02648 0.118
NP_440545.1_3 Reverse -129 -146 -4.97604 0.237
NP_440545.1_3 Forward -101 -84 -6.35267 0.276
NP_441856.1_3 Reverse -130 -149 7.7676 0.101
NP_440025.1_1 Forward -146 -127 9.24257 0.194
NP_440831.1_3 Reverse -124 -143 10.2702 0.179
NP_441629.1_3 Reverse -126 -145 2.35861 0.218
NP_440555.1_4 Reverse -52 -71 5.89931 0.257
NP_441923.1_6 Forward -135 -121 9.14437 0.278
NP_440459.1_2 Reverse -124 -141 11.3469 0.177
NP_441653.1_2 Reverse -122 -141 2.46664 0.291
NP_440010.1_4 Forward -146 -127 1.37531 0.236
NP_442603.1_7 Forward -142 -128 13.6669 0.0819
NP_442603.1_7 Reverse -190 -204 6.98048 0.221
NP_443022.1_9 Reverse -111 -130 16.8141 0.199
NP_440449.1_6 Reverse -104 -122 6.01878 0.263
NP_441948.1_4 Reverse -126 -144 -2.14413 0.16
NP_441047.1_7 Reverse -381 -400 21.4356 0.0636
NP_440170.1_2 Forward -154 -135 6.4893 0.296
NP_441833.1_4 Forward -141 -134 15.9687 0.0124
NP_441833.1_4 Reverse -134 -141 15.9687 0.0124
NP_442799.1_2 Reverse -125 -144 3.24438 0.202
NP_441329.1_6 Reverse -212 -231 1.95716 0.231
NP_442162.1_9 Forward -141 -134 16.2637 0.0124
NP_442162.1_9 Reverse -134 -141 16.2637 0.0124
NP_440671.1_4 Forward -148 -134 16.8142 0.0258
NP_440671.1_4 Reverse -127 -141 9.14437 0.184
NP_442045.1_5 Reverse -124 -143 10.4225 0.182
NP_442199.1_5 Forward -150 -131 -4.81876 0.231
NP_442140.1_3 Reverse -134 -144 8.33817 0.119
NP_442140.1_3 Forward -141 -131 4.40493 0.243
NP_441671.1_10 Forward -130 -111 -0.39387 0.293
NP_440875.1_9 Reverse -135 -145 9.05339 0.233
NP_441813.1_5 Forward -144 -134 17.188 0.00979
NP_441813.1_5 Reverse -131 -141 15.9097 0.01
NP_440590.1_4 Forward -141 -128 12.409 0.0141
NP_440590.1_4 Reverse -134 -147 -3.02898 0.252
NP_440567.1_1 Forward -141 -127 12.7826 0.0216
NP_440567.1_1 Reverse -134 -148 1.37622 0.208
NP_442497.1_10 Forward -141 -132 10.4228 0.0087
NP_442497.1_10 Reverse -134 -143 10.4228 0.0087
NP_440821.1_4 Forward -144 -134 19.0562 0.00399
NP_440821.1_4 Reverse -131 -141 18.2696 0.00448
NP_441239.1_9 Forward -144 -132 13.3137 0.037
NP_441239.1_9 Reverse -131 -143 6.92215 0.173
NP_441239.1_9 Reverse -61 -73 6.23383 0.197
NP_441239.1_9 Reverse -86 -98 3.97222 0.269
NP_441892.1_1 Reverse -124 -141 1.31714 0.154
NP_441892.1_4 Forward -73 -54 1.17943 0.266
NP_442044.1_1 Forward -97 -78 -11.2103 0.271
NP_442270.1_9 Reverse -122 -141 0.294447 0.14
NP_441017.1_6 Reverse -129 -143 15.7319 0.0926
NP_441017.1_6 Forward -76 -62 11.5037 0.262
NP_440392.1_2 Forward -374 -355 13.47 0.274
NP_440546.1_4 Reverse -133 -143 11.8882 0.0679
NP_440546.1_4 Forward -142 -132 10.046 0.109
NP_440546.1_4 Forward -120 -110 6.65249 0.288
NP_440462.1_6 Forward -144 -134 15.418 0.0142
NP_440462.1_6 Reverse -131 -141 7.74818 0.0699
NP_442340.1_3 Forward -351 -332 -5.70374 0.223
NP_440868.1_4 Forward -146 -134 15.4769 0.0164
NP_440868.1_4 Reverse -129 -141 -0.846001 0.282
NP_441868.1_4 Forward -74 -60 21.1407 0.0266
NP_442402.1_4 Forward -253 -234 -7.96609 0.278
NP_442402.1_4 Reverse -326 -345 -8.16275 0.278
NP_441848.1_7 Reverse -112 -131 -3.54122 0.284
NP_441084.1_6 Reverse -228 -242 11.962 0.179
NP_440696.1_3 Forward -119 -101 5.03403 0.198
NP_442039.1_4 Forward -141 -134 15.1821 0.0124
NP_442039.1_4 Reverse -134 -141 15.1821 0.0124
NP_442837.1_3 Forward -141 -134 15.7721 0.0124
NP_442837.1_3 Reverse -134 -141 15.7721 0.0124
NP_439994.1_3 Forward -143 -124 10.292 0.221
NP_442053.1_1 Forward -142 -133 18.3876 0.0007
NP_442053.1_1 Reverse -133 -142 18.3876 0.0007
NP_440505.1_3 Reverse -131 -141 16.303 0.00696
NP_440505.1_3 Forward -144 -134 13.8447 0.0247
NP_441203.1_1 Forward -141 -122 -19.7651 0.297
NP_442009.1_4 Reverse -239 -258 16.4207 0.299
NP_440009.1_4 Reverse -83 -102 6.19431 0.299
NP_440914.1_1 Forward -142 -132 17.5935 0.000537
NP_440914.1_1 Reverse -127 -137 8.71269 0.186
NP_440914.1_1 Reverse -133 -143 8.6151 0.186
NP_440914.1_1 Reverse -378 -388 6.76087 0.267
NP_441011.1_8 Reverse -134 -143 16.9127 0.00602
NP_441011.1_8 Forward -141 -132 8.25953 0.144
NP_442101.1_10 Forward -150 -131 -7.27704 0.21
NP_442533.1_6 Forward -142 -133 17.2076 0.00137
NP_442533.1_6 Reverse -133 -142 17.2076 0.00137
NP_442533.1_6 Forward -72 -63 4.52295 0.179
NP_442533.1_6 Reverse -88 -97 4.0313 0.194
NP_442533.1_6 Forward -108 -99 1.67135 0.293
NP_442541.1_10 Forward -72 -58 9.24208 0.211
NP_442541.1_10 Forward -119 -105 2.26061 0.263
NP_443016.1_1 Forward -103 -84 -7.86702 0.288
NP_441482.1_7 Reverse -127 -141 -8.75187 0.193
NP_441482.1_7 Forward -148 -134 -9.14519 0.194
NP_439944.1_9 Forward -141 -131 19.0562 0.00329
NP_439944.1_9 Reverse -134 -144 10.3048 0.0887
NP_441028.1_6 Forward -332 -322 6.46942 0.23
NP_441028.1_6 Reverse -335 -345 5.19112 0.265
NP_440116.1_8 Forward -141 -122 0.58944 0.0958
NP_441527.1_4 Reverse -215 -234 -12.9396 0.296
NP_440007.1_9 Reverse -129 -143 2.16287 0.281
NP_439965.1_1 Reverse -124 -143 -6.39206 0.213
NP_441972.1_5 Forward -141 -122 7.7676 0.0748
NP_441106.1_1 Forward -143 -134 18.191 0.0028
NP_441106.1_1 Reverse -132 -141 9.63616 0.0311
NP_441815.1_6 Reverse -333 -352 9.34008 0.135
NP_440646.1_1 Forward -352 -333 17.699 0.0131
NP_439903.1_6 Forward -145 -126 4.81688 0.189
NP_441286.1_1 Reverse -132 -144 14.4936 0.00418
NP_441286.1_1 Forward -143 -131 11.8387 0.0114
NP_442674.1_3 Reverse -125 -144 6.48849 0.236
NP_440670.1_8 Forward -142 -133 18.3876 0.000699
NP_440670.1_8 Reverse -133 -142 18.3876 0.000699
NP_440103.1_3 Reverse -333 -343 15.8714 0.286
NP_440886.1_7 Forward -143 -133 17.7774 0.0011
NP_440886.1_7 Reverse -132 -142 7.94438 0.0805
NP_442614.1_2 Forward -97 -83 7.66941 0.268
NP_442614.1_2 Forward -142 -128 5.89945 0.296
NP_442072.1_9 Forward -143 -125 -21.5153 0.209
NP_442072.1_9 Reverse -132 -150 -21.9087 0.215
NP_441753.1_10 Forward -151 -132 3.44104 0.216
NP_440907.2_8 Reverse -134 -144 7.84605 0.117
NP_441021.1_1 Forward -141 -122 -8.45701 0.195
NP_441021.1_8 Reverse -128 -146 2.47742 0.246
NP_441463.1_3 Forward -197 -178 5.89931 0.0683
NP_441463.1_3 Forward -152 -133 0.884433 0.129
NP_441463.1_3 Reverse -123 -142 -9.83364 0.286
NP_441463.1_6 Reverse -131 -145 15.113 0.152
NP_441626.1_2 Forward -141 -134 15.7721 0.0124
NP_441626.1_2 Reverse -134 -141 15.7721 0.0124
NP_442365.1_7 Forward -76 -57 -3.44213 0.22
NP_442794.1_1 Reverse -129 -141 10.1671 0.0721
NP_442794.1_1 Reverse -186 -198 8.00379 0.123
NP_442794.1_1 Reverse -123 -135 6.33216 0.185
NP_442615.1_1 Forward -151 -133 -3.6191 0.165
NP_441962.1_4 Forward -304 -285 -14.9469 0.296
NP_440387.1_1 Forward -142 -126 -2.69473 0.148
NP_440387.1_1 Reverse -133 -149 -2.69473 0.148
NP_441836.1_2 Forward -114 -95 5.80098 0.121
NP_441993.1_1 Forward -142 -123 4.87041 0.211
NP_441993.1_1 Reverse -127 -146 2.04414 0.265
NP_441510.2_7 Reverse -127 -141 10.5204 0.28
NP_441552.1_3 Reverse -126 -145 17.6982 0.123
NP_440293.1_3 Forward -104 -85 3.73603 0.192
NP_440293.1_9 Reverse -58 -72 11.6342 0.257
NP_440766.1_4 Reverse -129 -143 17.7975 0.0255
NP_440766.1_4 Forward -140 -126 1.96621 0.205
NP_442743.1_4 Forward -141 -122 -7.76869 0.28
NP_442743.1_5 Forward -141 -122 10.8159 0.142
NP_441133.1_1 Forward -103 -84 12.2908 0.269
NP_439910.1_2 Forward -150 -133 16.0668 0.00131
NP_440457.1_1 Reverse -129 -141 7.02048 0.105
NP_440457.1_1 Forward -146 -134 1.31728 0.241
NP_440798.1_6 Reverse -134 -147 2.57589 0.17
NP_442680.1_5 Reverse -235 -254 2.4168 0.237
NP_442680.1_7 Reverse -281 -300 -4.13045 0.265
NP_441332.1_4 Reverse -316 -335 3.6377 0.293
NP_441332.1_6 Reverse -87 -97 12.6149 0.221
NP_440473.1_9 Forward -99 -80 0.491109 0.123
NP_442509.1_9 Reverse -133 -143 16.2041 0.00739
NP_442509.1_9 Forward -142 -132 8.14104 0.192
NP_440524.1_2 Forward -140 -121 3.6377 0.206
NP_440554.1_4 Reverse -134 -144 14.6313 0.02
NP_440554.1_4 Forward -141 -131 7.05986 0.106
NP_441885.1_5 Forward -142 -132 20.9245 0.000538
NP_441885.1_5 Reverse -133 -143 11.4848 0.00668
NP_442341.1_7 Forward -143 -129 18.0925 0.0111
NP_442341.1_7 Reverse -132 -146 8.06273 0.0947
NP_442341.1_9 Forward -144 -130 14.2569 0.0695
NP_441756.1_5 Forward -146 -127 -4.42544 0.294
NP_443000.1_7 Reverse -131 -141 17.0896 0.00865
NP_443000.1_7 Forward -144 -134 8.73149 0.0437
NP_440076.1_5 Reverse -126 -145 18.1898 0.081
NP_440552.1_8 Reverse -26 -43 16.7632 0.0926
NP_440552.1_8 Forward -292 -275 12.1796 0.235
NP_442513.1_5 Reverse -125 -144 8.84842 0.266
NP_441842.1_10 Reverse -126 -140 14.4542 0.0586
NP_440275.1_3 Forward -144 -134 8.4365 0.0602
NP_440275.1_3 Reverse -131 -141 8.1415 0.0602
NP_440091.1_1 Forward -146 -134 8.9871 0.0567
NP_440091.1_1 Reverse -129 -141 8.88877 0.0567
NP_442275.1_1 Reverse -116 -135 5.11266 0.267
NP_442451.1_2 Reverse -125 -144 -4.52377 0.211
NP_442918.1_4 Forward -46 -32 21.4357 0.0382
NP_442495.1_5 Reverse -116 -135 8.06259 0.291
NP_440149.1_8 Forward -142 -123 16.2241 0.0186
NP_440149.1_8 Reverse -133 -152 -6.58872 0.255
NP_440216.1_1 Reverse -133 -147 5.70279 0.0186
NP_440216.1_1 Forward -142 -128 0.0979218 0.0284
NP_440172.1_1 Forward -142 -132 15.0247 0.00945
NP_440172.1_1 Reverse -133 -143 8.73149 0.0586
NP_440172.1_1 Reverse -190 -200 2.92996 0.258
NP_442015.1_10 Reverse -129 -142 10.344 0.0391
NP_442015.1_10 Forward -146 -133 9.45906 0.0486
NP_442015.1_10 Reverse -186 -199 2.08423 0.202
NP_441045.1_6 Reverse -168 -186 14.5713 0.295
NP_441226.1_7 Forward -141 -134 14.4934 0.0123
NP_441226.1_7 Reverse -134 -141 14.4934 0.0123
NP_441226.1_7 Reverse -89 -96 8.29857 0.205
NP_441226.1_7 Reverse -107 -114 5.93863 0.266
NP_441757.1_3 Reverse -132 -151 -1.37718 0.245
NP_441111.1_7 Forward -141 -133 18.7023 0.00294
NP_441111.1_7 Reverse -134 -142 18.7023 0.00294
NP_442379.1_10 Reverse -126 -143 -3.69774 0.265
NP_441766.1_2 Forward -142 -133 17.5026 0.00297
NP_441766.1_2 Reverse -133 -142 17.5026 0.00297
NP_440416.1_9 Reverse -126 -145 -0.4922 0.0598
NP_443052.1_8 Forward -152 -133 -10.522 0.21
NP_442564.1_9 Forward -72 -58 15.475 0.227
NP_440261.1_5 Reverse -134 -147 -3.02898 0.108
NP_440261.1_5 Forward -141 -128 -10.5021 0.201
NP_440988.1_10 Forward -74 -60 4.99564 0.247
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAATGATCCGGCTCCTGATTGTCTAGAACAGTCTGTTGTAAACACTCTACCGTTGCTGGCGAAAAAAACTGCTCTCCAGTTTCTTCATTAACCCGTGCTGGGACGTTTTCAATAATAATTAACCGACCATTTAAACTAAGGGTGTAATTTACCCTTTTTTCAACCAGAGTTTTGTTGTCCATTATTGGTTTCTCTCCTTCGAGTGATCAGCAAGGTCATTACTGGATTGTTGAGGTGGGTATCTAAACCAAATTACACGGCGATCGCCATTGGGGAGGAGAGGCCTGGGTCCGCCCATGGTTAGGGGATGGGACCGATCAGATTCTCTGGCCAGGGCAACCCTTTGCTACAGTTGAATTGGTTACAAATAGTTAAAGTTCCGTCCCGCCGTTAAAAGTCT

CDS

ATGTTTGATGCCTTAGCCGATCGCCTTGAAGATGCCTGGAAGAAGCTCCGGGGTCAGGACAAAATTAGTGAAAGCAATATTAAAGAGGCGCTTCAGGAAGTCAGGAGAGCCCTGTTGGCGGCGGACGTGAATCTCCAGGTGGTCAAGGGTTTCATCAAAGACGTAGAGCAAAAAGCCCTCGGTGCGGATGTGATCAGTGGGGTTAACCCAGGGCAACAGTTCATCAAAATTGTTTACGACGAACTGGTAAACCTGATGGGGGAAAGCAACGTGCCCCTAGCTCAAGCAGAGCAAGCTCCCACCGTCATTCTTATGGCCGGCTTGCAGGGGACCGGGAAAACCACCGCCACGGCCAAATTAGCCCTCTATCTCCGCAAACAAAAACGCAGTGCCCTGATGGTGGCCACGGACGTTTATCGCCCCGCCGCCATTGACCAACTAAAAACTCTGGGGCAACAGATTGATGTGCCTGTATTTGACCTGGGCAGTGATGCCAACCCGGTGGAAATTGCCCGCCAAGGGGTGGAAAAAGCCAAGGAATTGGGAGTCGATACGGTCTTAATCGATACCGCCGGTCGTTTGCAGATTGATCCCCAAATGATGGCGGAGTTGGCCGAAATTAAACAGGTTGTTAAACCTGACGATACTCTACTGGTAGTAGATGCCATGACGGGGCAAGAGGCGGCCAATTTAACCCATACTTTCCACGAGCAAATTGGTATTACCGGAGCAATTCTTACCAAGTTAGATGGGGATACTAGGGGCGGTGCAGCCCTATCGGTGCGGCAAATTTCCGGCCAGCCGATCAAATTTGTCGGGGTGGGGGAAAAAGTGGAGGCCCTGCAACCTTTCTATCCCGATCGCCTAGCCAGTCGGATTTTAAACATGGGGGATGTGCTGACCCTGGTGGAAAAAGCCCAAGAGGCGATCGATGTCGGGGACGTGGAGAAGTTACAGAACAAGATTCTCGAAGCCACCTTCGATTTTGATGACTTCATTAAGCAAATGCGCTTTATGAAGAATATGGGTTCCCTAGGGGGTCTGCTGAAAATGATTCCCGGCATGAATAAGCTCAGCAGTGGCGACATCGAAAAAGGGGAAAAGGAACTCAAGCGCACCGAAGCCATGATTAGTTCCATGACCACGGAGGAAAGGAAGAATCCCGATTTATTAGCTAAATCCCCCAGTCGGCGTCGTCGCATAGCCCAAGGATCGGGTCATAGTGAAACCGATGTGTCTAAGCTAATCACCAATTTCACCAAGATGCGGACCATGATGCAGCAAATGGGCATGGGAGGAATGCCTGGAGGTATGCCAGGGATGGGAGCAATGCCAGGCATGGGGGGAGGTATGTTTGGCGGTCAACCAGGCCCAGGTTTTCGAGGTTACAGAGGTGGTGGCGGTAAGCCGAAAAAGAAAAAGAAGAAAAAAGGTTTTGGCCAGCTTTAA

Protein

MFDALADRLEDAWKKLRGQDKISESNIKEALQEVRRALLAADVNLQVVKGFIKDVEQKALGADVISGVNPGQQFIKIVYDELVNLMGESNVPLAQAEQAPTVILMAGLQGTGKTTATAKLALYLRKQKRSALMVATDVYRPAAIDQLKTLGQQIDVPVFDLGSDANPVEIARQGVEKAKELGVDTVLIDTAGRLQIDPQMMAELAEIKQVVKPDDTLLVVDAMTGQEAANLTHTFHEQIGITGAILTKLDGDTRGGAALSVRQISGQPIKFVGVGEKVEALQPFYPDRLASRILNMGDVLTLVEKAQEAIDVGDVEKLQNKILEATFDFDDFIKQMRFMKNMGSLGGLLKMIPGMNKLSSGDIEKGEKELKRTEAMISSMTTEERKNPDLLAKSPSRRRRIAQGSGHSETDVSKLITNFTKMRTMMQQMGMGGMPGGMPGMGAMPGMGGGMFGGQPGPGFRGYRGGGGKPKKKKKKKGFGQL