Your browser is old and dusty. Try Google Chrome!

Details for slr1519

ORF slr1519
Accession NP_441351.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -184 -170 7.9644 0.0955
NP_441061.1_2 Forward -337 -323 1.57289 0.186
NP_441418.1_6 Forward -185 -166 -21.7317 0.159
NP_441453.1_4 Reverse -176 -184 14.7691 0.0119
NP_441453.1_4 Forward -185 -177 6.80426 0.121
NP_441453.1_8 Forward -160 -143 9.18362 0.239
NP_441818.1_1 Forward -119 -108 8.61296 0.288
NP_440226.1_1 Reverse -176 -195 5.01433 0.17
NP_443002.1_5 Forward -283 -265 9.06482 0.297
NP_442173.1_1 Forward -184 -176 12.0158 0.0316
NP_442173.1_1 Reverse -177 -185 12.0158 0.0316
NP_442752.1_4 Forward -185 -178 13.8055 0.0199
NP_441812.1_3 Forward -186 -172 6.98109 0.287
NP_442975.1_10 Reverse -172 -186 4.42388 0.245
NP_440784.1_7 Forward -184 -177 6.23397 0.241
NP_440784.1_7 Reverse -177 -184 6.13563 0.241
NP_441250.1_3 Forward -271 -252 3.24438 0.266
NP_440061.1_9 Reverse -109 -123 7.07881 0.219
NP_440061.1_9 Reverse -267 -281 5.01387 0.298
NP_442062.1_8 Forward -185 -175 10.0098 0.0527
NP_442062.1_8 Reverse -176 -186 9.61647 0.0587
NP_440304.1_4 Forward -95 -85 4.40493 0.266
NP_441352.1_2 Reverse -294 -313 0.687771 0.268
NP_441200.1_4 Forward -249 -230 15.2408 0.156
NP_441200.1_4 Reverse -380 -399 6.88262 0.272
NP_441935.1_1 Forward -184 -165 5.89931 0.292
NP_441208.1_9 Forward -292 -278 5.40779 0.267
NP_441594.1_6 Reverse -320 -339 3.24438 0.235
NP_441083.1_5 Reverse -176 -186 10.1081 0.0208
NP_441083.1_5 Forward -185 -175 8.82982 0.03
NP_441738.1_2 Reverse -178 -185 15.28 0.0102
NP_441738.1_2 Forward -265 -258 8.29857 0.176
NP_441738.1_2 Forward -107 -100 8.29857 0.176
NP_440209.1_1 Forward -185 -177 8.57422 0.0425
NP_440209.1_1 Reverse -176 -184 8.47588 0.0457
NP_442889.1_8 Reverse -173 -187 7.96378 0.136
NP_440053.1_2 Forward -179 -160 9.93088 0.291
NP_440906.1_5 Forward -184 -177 6.23397 0.234
NP_440906.1_5 Reverse -177 -184 6.13563 0.241
NP_440747.1_10 Forward -188 -176 -11.8591 0.161
NP_440747.1_10 Reverse -173 -185 -11.8591 0.161
NP_440747.1_10 Forward -281 -269 -11.9574 0.178
NP_441486.1_1 Reverse -173 -187 8.84938 0.0297
NP_441486.1_1 Forward -188 -174 0.196253 0.143
NP_440403.1_4 Forward -194 -175 -8.26035 0.251
NP_441014.1_10 Forward -44 -25 1.17865 0.231
NP_441012.1_4 Forward -157 -144 6.50913 0.278
NP_443018.1_3 Reverse -177 -184 11.7405 0.0655
NP_443018.1_3 Reverse -151 -158 10.2655 0.107
NP_443018.1_3 Forward -184 -177 5.44732 0.193
NP_441634.1_8 Reverse -148 -162 -0.197071 0.25
NP_441634.1_8 Forward -236 -222 -2.06536 0.295
NP_441634.1_8 Reverse -115 -129 -4.32697 0.295
NP_440376.1_1 Forward -185 -176 15.7327 0.00625
NP_440376.1_1 Reverse -176 -185 9.63616 0.0385
NP_442687.1_7 Forward -186 -176 13.5497 0.0466
NP_442687.1_7 Reverse -175 -185 5.97822 0.179
NP_442687.1_7 Forward -154 -144 3.91327 0.278
NP_440667.1_2 Reverse -272 -291 -8.65367 0.29
NP_442658.1_1 Reverse -174 -184 6.27276 0.234
NP_442658.1_1 Forward -187 -177 6.17443 0.235
NP_442198.1_3 Reverse -260 -279 4.916 0.268
NP_440656.1_8 Reverse -165 -184 -9.047 0.273
NP_442544.1_6 Forward -192 -173 -4.42544 0.243
NP_441414.1_9 Reverse -176 -195 0.196116 0.0845
NP_441414.1_9 Forward -185 -166 -8.16202 0.23
NP_440800.1_2 Forward -199 -180 13.7063 0.299
NP_441256.1_1 Reverse -5 -24 -7.27704 0.239
NP_441958.1_5 Forward -186 -176 10.0098 0.0167
NP_441958.1_5 Reverse -175 -185 2.43831 0.0422
NP_441127.1_1 Reverse -298 -312 16.3225 0.1
NP_442486.1_6 Forward -29 -10 -5.11376 0.27
NP_440269.1_2 Reverse -24 -38 14.3559 0.281
NP_442690.1_1 Forward -319 -300 -14.9469 0.276
NP_442911.1_2 Forward -195 -176 -7.08038 0.2
NP_442911.1_2 Reverse -166 -185 -8.65367 0.239
NP_443055.1_3 Reverse -167 -186 14.3693 0.132
NP_443055.1_6 Reverse -168 -186 -0.571569 0.263
NP_440602.1_8 Forward -185 -171 15.2409 0.126
NP_442002.1_9 Forward -186 -179 10.7572 0.185
NP_442002.1_9 Forward -327 -320 9.67555 0.27
NP_441294.1_4 Forward -126 -107 12.8808 0.214
NP_440377.1_1 Reverse -251 -268 15.3323 0.181
NP_441000.1_6 Forward -186 -172 3.53951 0.111
NP_442771.1_1 Reverse -315 -333 -10.8956 0.29
NP_440147.1_4 Forward -187 -174 0.314277 0.257
NP_441550.1_8 Reverse -174 -184 5.09279 0.267
NP_441550.1_8 Forward -187 -177 4.7978 0.283
NP_441916.1_7 Reverse -176 -186 8.82982 0.0409
NP_441916.1_7 Forward -185 -175 8.73149 0.042
NP_441916.1_10 Forward -161 -142 2.94938 0.236
NP_440206.1_9 Forward -299 -280 10.6192 0.272
NP_442396.1_5 Forward -189 -176 7.09911 0.215
NP_441725.1_5 Forward -184 -174 1.55333 0.133
NP_441725.1_5 Reverse -177 -187 1.455 0.135
NP_439966.1_7 Reverse -174 -184 17.4824 0.00636
NP_439966.1_7 Forward -187 -177 8.73102 0.13
NP_439966.1_9 Forward -187 -178 0.983037 0.253
NP_442941.1_3 Forward -184 -174 1.74999 0.147
NP_442941.1_3 Reverse -177 -187 1.65166 0.147
NP_440289.1_2 Reverse -173 -186 4.8375 0.0644
NP_440289.1_2 Forward -188 -175 -4.60227 0.29
NP_440983.1_5 Reverse -329 -348 -4.91709 0.261
NP_442281.1_1 Reverse -171 -185 19.0751 0.00329
NP_443030.1_4 Reverse -104 -123 -6.88371 0.291
NP_442068.1_4 Forward -283 -264 15.0432 0.137
NP_441644.1_6 Reverse -176 -186 9.81266 0.0678
NP_441644.1_6 Reverse -269 -279 3.22451 0.293
NP_442029.1_6 Forward -250 -231 5.89931 0.248
NP_442029.1_10 Reverse -224 -243 15.3391 0.145
NP_440253.1_2 Forward -185 -167 5.82068 0.0889
NP_440253.1_2 Reverse -176 -194 3.46073 0.116
NP_440929.1_8 Reverse -176 -185 16.5193 0.00413
NP_440929.1_8 Forward -185 -176 9.53783 0.0296
NP_440469.1_8 Reverse -114 -133 15.1424 0.165
NP_442933.1_10 Reverse -176 -185 8.06287 0.0885
NP_442933.1_10 Forward -185 -176 7.96454 0.0937
NP_442554.1_8 Forward -184 -174 11.4848 0.0355
NP_442554.1_8 Reverse -177 -187 4.0116 0.2
NP_442554.1_8 Forward -125 -115 2.14332 0.281
NP_441762.1_7 Forward -186 -174 2.30059 0.0676
NP_441762.1_7 Reverse -175 -187 2.20226 0.0676
NP_442142.1_4 Reverse -173 -186 9.85179 0.0854
NP_442292.1_1 Forward -184 -175 -0.0986038 0.239
NP_442292.1_1 Reverse -177 -186 -0.196935 0.239
NP_442476.1_6 Reverse -177 -191 -0.197071 0.29
NP_443009.1_2 Reverse -133 -152 3.04771 0.216
NP_443009.1_2 Forward -151 -132 2.65439 0.216
NP_443009.1_5 Reverse -316 -327 9.00628 0.0965
NP_441715.1_4 Forward -184 -174 6.56821 0.138
NP_441715.1_4 Reverse -177 -187 6.46988 0.143
NP_440357.1_3 Forward -340 -321 1.67108 0.272
NP_441448.1_1 Reverse -114 -133 3.83436 0.287
NP_440183.1_1 Reverse -368 -387 5.40766 0.282
NP_440183.1_9 Forward -157 -138 -12.4886 0.256
NP_440183.1_9 Forward -86 -67 -14.6519 0.267
NP_440379.1_5 Forward -293 -274 -5.21209 0.221
NP_440379.1_5 Reverse -265 -284 -11.5053 0.297
NP_441468.1_1 Forward -184 -177 6.13563 0.209
NP_441468.1_1 Reverse -177 -184 6.0373 0.223
NP_441020.2_6 Forward -187 -170 15.5751 0.0385
NP_441020.2_6 Reverse -174 -191 8.69197 0.191
NP_441015.1_9 Forward -269 -256 17.4232 0.246
NP_441015.1_10 Forward -289 -270 -4.22878 0.201
NP_441015.1_10 Forward -22 -3 -11.6036 0.298
NP_441673.1_1 Forward -185 -176 11.1111 0.0121
NP_441673.1_1 Reverse -176 -185 11.0128 0.018
NP_442490.1_9 Forward -338 -319 -8.65367 0.293
NP_442868.1_3 Reverse -103 -122 13.6675 0.284
NP_442677.1_3 Forward -136 -117 -5.31042 0.287
NP_442808.1_1 Reverse -175 -185 19.0557 0.00201
NP_442808.1_1 Forward -186 -176 8.73102 0.0481
NP_442808.1_1 Reverse -223 -233 1.74956 0.281
NP_442050.1_5 Reverse -174 -184 6.96107 0.27
NP_441114.1_3 Reverse -112 -121 8.55452 0.231
NP_440558.1_2 Forward -129 -110 -0.4922 0.203
NP_440558.1_2 Reverse -147 -166 -4.52377 0.246
NP_441048.1_6 Forward -268 -254 14.3354 0.296
NP_442593.1_9 Reverse -362 -381 15.8819 0.257
NP_441518.1_3 Reverse -166 -185 -14.8485 0.283
NP_441878.1_6 Forward -186 -176 0.668351 0.139
NP_441878.1_6 Reverse -175 -185 0.57002 0.14
NP_441036.1_8 Forward -186 -176 16.4996 0.00407
NP_441036.1_8 Reverse -175 -185 8.4365 0.174
NP_441557.1_5 Forward -185 -176 10.2261 0.0144
NP_441557.1_5 Reverse -176 -185 10.1278 0.0188
NP_441557.1_8 Reverse -66 -76 12.6642 0.236
NP_441445.1_1 Reverse -167 -186 3.83436 0.205
NP_441445.1_8 Reverse -270 -289 -10.6203 0.277
NP_441433.1_8 Forward -124 -105 -4.52377 0.294
NP_441308.1_8 Forward -187 -177 8.4365 0.254
NP_441458.1_10 Forward -194 -175 1.47442 0.288
NP_442183.1_1 Forward -185 -171 15.8309 0.0182
NP_442183.1_1 Reverse -176 -190 13.3726 0.0437
NP_442347.1_2 Reverse -177 -186 8.94785 0.0718
NP_442347.1_2 Reverse -330 -339 6.09625 0.191
NP_442594.1_8 Reverse -257 -276 5.11266 0.254
NP_441633.1_3 Forward -187 -174 -6.17557 0.238
NP_441633.1_3 Reverse -174 -187 -6.2739 0.242
NP_440136.1_2 Forward -184 -177 6.23397 0.171
NP_440136.1_2 Reverse -177 -184 6.13563 0.193
NP_442998.1_10 Reverse -178 -185 15.5754 0.0102
NP_442998.1_10 Reverse -86 -93 7.21728 0.144
NP_442998.1_10 Forward -183 -176 5.84064 0.235
NP_441799.1_1 Reverse -172 -186 7.47213 0.141
NP_441799.1_1 Forward -189 -175 3.8339 0.279
NP_440256.1_1 Reverse -173 -192 -3.93378 0.143
NP_440256.1_1 Forward -188 -169 -6.09707 0.201
NP_441559.1_8 Forward -229 -215 -4.62196 0.231
NP_442866.1_1 Forward -190 -171 -5.70374 0.244
NP_440695.1_6 Reverse -357 -371 16.4227 0.135
NP_442993.1_1 Forward -185 -169 0.0585348 0.0668
NP_442993.1_1 Forward -231 -215 -13.2161 0.288
NP_440677.1_6 Reverse -271 -290 12.8808 0.194
NP_442386.1_9 Reverse -175 -184 11.8973 0.0799
NP_442386.1_9 Forward -186 -177 5.9975 0.23
NP_441340.1_5 Forward -184 -177 13.5105 0.0314
NP_441340.1_5 Reverse -177 -184 5.84064 0.208
NP_440161.1_3 Forward -187 -168 12.4875 0.177
NP_440161.1_3 Reverse -174 -193 8.94757 0.262
NP_441160.1_1 Forward -277 -258 -9.63698 0.254
NP_441160.1_5 Reverse -258 -277 -4.32711 0.288
NP_440586.1_8 Reverse -177 -184 9.47853 0.146
NP_440586.1_8 Reverse -151 -158 9.08521 0.178
NP_440586.1_8 Forward -184 -177 5.74197 0.283
NP_440684.1_9 Reverse -170 -184 7.66941 0.256
NP_441262.1_3 Forward -185 -178 14.7888 0.0223
NP_443051.1_1 Forward -186 -177 7.47288 0.0571
NP_443051.1_1 Reverse -175 -184 0.589713 0.143
NP_442294.1_5 Forward -51 -41 18.3679 0.232
NP_440926.1_9 Reverse -257 -276 9.43923 0.275
NP_440439.1_1 Reverse -173 -186 6.1158 0.0818
NP_440439.1_1 Forward -188 -175 6.01747 0.0831
NP_440372.1_2 Forward -184 -177 13.8055 0.0214
NP_440372.1_2 Reverse -177 -184 6.52896 0.188
NP_441138.1_5 Forward -49 -36 3.97694 0.297
NP_441789.1_7 Forward -276 -257 0.490334 0.245
NP_440819.1_5 Forward -272 -264 7.59091 0.272
NP_440139.1_1 Reverse -170 -189 5.11187 0.168
NP_442549.1_3 Reverse -318 -337 7.7676 0.271
NP_442384.1_10 Reverse -176 -189 11.0324 0.039
NP_442384.1_10 Reverse -329 -342 2.77255 0.213
NP_442384.1_10 Forward -289 -276 1.39592 0.26
NP_442790.1_4 Forward -194 -175 -7.96535 0.161
NP_442262.1_10 Reverse -177 -184 13.2155 0.0213
NP_442262.1_10 Reverse -151 -158 9.18389 0.211
NP_441689.1_5 Reverse -174 -184 6.27276 0.197
NP_441689.1_5 Forward -187 -177 5.97777 0.197
NP_440163.1_10 Forward -188 -178 14.238 0.102
NP_440163.1_10 Forward -329 -319 12.7631 0.154
NP_440344.1_10 Reverse -169 -186 -2.02611 0.06
NP_440344.1_10 Forward -192 -175 -9.79426 0.156
NP_440344.1_10 Reverse -217 -234 -11.7609 0.227
NP_440531.1_8 Reverse -257 -276 19.2723 0.0613
NP_442556.1_10 Reverse -265 -284 11.791 0.217
NP_440297.1_9 Forward -184 -174 -0.41329 0.283
NP_440297.1_9 Reverse -177 -187 -0.511621 0.289
NP_442280.1_10 Forward -135 -117 6.13623 0.28
NP_440888.1_2 Reverse -176 -190 11.9953 0.0539
NP_442277.1_7 Reverse -190 -206 7.26419 0.205
NP_441543.1_2 Forward -184 -175 9.14451 0.0856
NP_441543.1_2 Reverse -177 -186 8.65285 0.0968
NP_441178.1_6 Forward -311 -292 2.26028 0.27
NP_441469.1_8 Forward -186 -177 6.39124 0.227
NP_441469.1_8 Reverse -175 -184 6.29291 0.227
NP_442578.1_7 Forward -184 -177 6.0373 0.18
NP_441462.1_2 Forward -185 -175 9.81313 0.0143
NP_441462.1_2 Reverse -176 -186 1.74999 0.0811
NP_443062.1_1 Forward -185 -167 7.27833 0.18
NP_443062.1_6 Forward -334 -315 6.88262 0.179
NP_443062.1_6 Forward -148 -129 4.52268 0.217
NP_440939.1_5 Reverse -295 -311 11.1699 0.273
NP_440277.1_2 Reverse -115 -134 11.5042 0.251
NP_441351.1_1 Forward -211 -192 15.9291 0.171
NP_441351.1_3 Forward -111 -92 19.2591 0.214
NP_441351.1_8 Forward -277 -258 22.8122 0.017
NP_442780.1_3 Forward -57 -38 14.1801 0.154
NP_440516.1_8 Forward -185 -176 16.9127 0.00442
NP_440516.1_8 Reverse -176 -185 14.8477 0.00685
NP_442428.1_5 Forward -184 -177 6.13563 0.209
NP_442428.1_5 Reverse -177 -184 6.0373 0.212
NP_440618.1_1 Reverse -209 -228 -6.88371 0.25
NP_442120.1_10 Reverse -138 -157 -14.1602 0.288
NP_440673.1_3 Reverse -178 -185 12.4288 0.0426
NP_441052.1_2 Reverse -329 -339 2.83163 0.19
NP_441052.1_2 Forward -185 -175 0.963343 0.255
NP_441052.1_2 Reverse -176 -186 0.668351 0.256
NP_440436.1_4 Forward -184 -175 8.65242 0.0997
NP_440436.1_4 Reverse -177 -186 8.55409 0.0997
NP_442577.1_9 Forward -391 -377 14.5519 0.209
NP_441719.1_4 Forward -184 -177 6.82395 0.0855
NP_441719.1_4 Reverse -177 -184 6.52896 0.188
NP_441733.1_10 Forward -188 -175 5.91914 0.203
NP_442366.1_3 Forward -186 -168 12.8022 0.0272
NP_440129.1_10 Forward -333 -319 3.53951 0.194
NP_442694.1_4 Reverse -259 -268 12.9794 0.225
NP_442694.1_4 Forward -179 -170 12.1928 0.257
NP_442206.1_10 Reverse -176 -191 1.55319 0.226
NP_443054.1_2 Forward -187 -173 3.04785 0.24
NP_443054.1_2 Reverse -174 -188 2.35953 0.245
NP_441851.1_10 Forward -186 -176 6.37155 0.172
NP_441851.1_10 Reverse -175 -185 6.17489 0.182
NP_441046.1_2 Reverse -258 -277 -0.197208 0.276
NP_440940.1_7 Reverse -166 -184 3.95163 0.267
NP_440432.1_9 Forward -184 -169 -1.39674 0.167
NP_442843.1_1 Reverse -380 -399 -8.26035 0.255
NP_442843.1_1 Reverse -252 -271 -9.93197 0.272
NP_440474.1_8 Forward -184 -170 5.01387 0.26
NP_440431.1_4 Reverse -27 -46 -9.1199 0.275
NP_440431.1_7 Forward -57 -38 3.83436 0.174
NP_442335.1_7 Reverse -177 -191 15.7319 0.172
NP_442006.1_2 Reverse -289 -306 -17.1691 0.27
NP_442243.1_1 Forward -284 -266 -3.02983 0.298
NP_441570.1_1 Forward -185 -167 -9.42063 0.137
NP_441078.1_4 Forward -185 -176 9.93116 0.0203
NP_441078.1_4 Reverse -176 -185 9.83282 0.0226
NP_442729.1_8 Forward -189 -176 9.16406 0.125
NP_441663.1_7 Forward -188 -169 11.2092 0.202
NP_442348.1_2 Reverse -258 -267 17.011 0.055
NP_440707.1_6 Forward -275 -256 12.88 0.197
NP_442443.1_1 Reverse -77 -96 -2.36049 0.256
NP_441432.1_8 Forward -186 -177 5.50626 0.151
NP_442320.1_8 Reverse -170 -184 3.04785 0.0691
NP_442320.1_8 Forward -191 -177 -5.31028 0.217
NP_441057.1_3 Forward -374 -355 -11.7019 0.24
NP_442727.1_10 Reverse -97 -116 -3.63879 0.256
NP_442400.1_10 Reverse -35 -48 8.56056 0.278
NP_442489.1_7 Reverse -176 -185 10.5211 0.0102
NP_442489.1_7 Forward -185 -176 10.4228 0.0151
NP_440757.1_7 Forward -241 -223 -1.45582 0.275
NP_440565.1_7 Reverse -290 -309 -2.36049 0.3
NP_440559.1_1 Forward -184 -175 5.99792 0.135
NP_441659.2_8 Reverse -176 -186 8.82982 0.0393
NP_441659.2_8 Forward -185 -175 2.43831 0.2
NP_441022.1_1 Reverse -369 -378 11.1625 0.284
NP_442913.1_10 Reverse -115 -134 -2.85214 0.192
NP_442346.1_5 Reverse -78 -88 4.3066 0.291
NP_441833.1_4 Reverse -177 -184 6.52896 0.0924
NP_441833.1_4 Forward -184 -177 6.23397 0.163
NP_441329.1_6 Reverse -31 -50 2.43462 0.227
NP_441895.1_2 Reverse -242 -261 -17.5035 0.234
NP_442162.1_9 Forward -184 -177 12.9205 0.0282
NP_442162.1_9 Reverse -177 -184 12.9205 0.0282
NP_440671.1_4 Reverse -170 -184 6.48943 0.245
NP_442073.1_6 Reverse -265 -284 -2.0655 0.286
NP_442199.1_5 Reverse -109 -128 -3.73712 0.211
NP_442140.1_3 Reverse -177 -187 6.27322 0.176
NP_441813.1_5 Reverse -174 -184 14.0414 0.0172
NP_441813.1_5 Forward -187 -177 7.45319 0.0746
NP_442028.1_1 Forward -323 -310 10.9479 0.251
NP_440590.1_4 Forward -184 -171 -4.20895 0.258
NP_440567.1_4 Reverse -257 -276 2.55606 0.261
NP_442497.1_10 Forward -184 -175 0.688044 0.141
NP_442497.1_10 Reverse -177 -186 0.589713 0.153
NP_440821.1_4 Forward -187 -177 9.32148 0.03
NP_440821.1_4 Reverse -174 -184 9.22315 0.0334
NP_441239.1_9 Reverse -174 -186 14.592 0.0271
NP_441239.1_9 Forward -286 -274 12.4287 0.0477
NP_441239.1_9 Forward -187 -175 6.1355 0.2
NP_441892.1_1 Forward -168 -151 -1.33779 0.203
NP_440833.1_6 Forward -269 -255 8.75042 0.272
NP_440354.1_7 Forward -191 -173 10.2456 0.224
NP_442138.1_1 Reverse -6 -25 -0.29631 0.298
NP_440546.1_4 Forward -185 -175 12.8578 0.0572
NP_440546.1_4 Reverse -176 -186 9.27034 0.146
NP_440462.1_6 Reverse -174 -184 12.4681 0.0351
NP_440462.1_6 Forward -187 -177 5.87989 0.135
NP_440868.1_4 Forward -189 -177 8.10212 0.0602
NP_440868.1_4 Reverse -172 -184 -0.846001 0.282
NP_442479.1_9 Forward -378 -359 -8.94866 0.266
NP_441843.2_2 Forward -300 -281 15.9282 0.219
NP_442923.1_4 Reverse -379 -398 1.57275 0.179
NP_442039.1_4 Forward -184 -177 11.6422 0.0747
NP_442039.1_7 Forward -157 -147 13.648 0.211
NP_442380.1_10 Forward -169 -151 8.37728 0.263
NP_441926.1_3 Forward -185 -169 4.3851 0.191
NP_442837.1_3 Forward -184 -177 6.0373 0.25
NP_442837.1_3 Reverse -177 -184 6.0373 0.25
NP_440160.1_3 Forward -304 -285 9.04509 0.268
NP_442053.1_1 Reverse -176 -185 16.6177 0.00257
NP_442053.1_1 Forward -185 -176 8.65285 0.0741
NP_440505.1_3 Forward -187 -177 12.2714 0.0543
NP_441252.1_6 Forward -96 -89 11.9372 0.25
NP_442255.1_5 Reverse -74 -93 9.24257 0.257
NP_440914.1_1 Reverse -176 -186 6.66328 0.269
NP_441011.1_8 Forward -184 -175 13.3727 0.0328
NP_441011.1_8 Reverse -177 -186 7.07956 0.179
NP_442533.1_6 Reverse -176 -185 14.2577 0.0132
NP_442533.1_6 Forward -185 -176 7.47288 0.0898
NP_442533.1_6 Reverse -329 -338 2.75299 0.241
NP_442533.1_6 Reverse -117 -126 1.57302 0.294
NP_442541.1_10 Reverse -116 -130 2.06395 0.269
NP_441482.1_7 Forward -191 -177 -3.73699 0.138
NP_441028.1_6 Reverse -89 -99 5.78111 0.243
NP_441602.1_3 Forward -343 -324 -3.44213 0.246
NP_441972.1_5 Reverse -112 -131 -5.70374 0.224
NP_441106.1_1 Reverse -175 -184 8.55452 0.0538
NP_441106.1_1 Forward -186 -177 8.45619 0.0548
NP_439903.1_6 Reverse -173 -192 -0.492971 0.282
NP_441286.1_1 Forward -186 -174 -4.48425 0.161
NP_441286.1_1 Reverse -175 -187 -4.87757 0.18
NP_441286.1_1 Reverse -149 -161 -7.04085 0.3
NP_440670.1_8 Forward -185 -176 18.0926 0.00136
NP_440670.1_8 Reverse -176 -185 15.831 0.00494
NP_440886.1_7 Reverse -175 -185 16.4991 0.0104
NP_440886.1_7 Forward -186 -176 8.14104 0.0805
NP_442072.1_9 Forward -186 -168 -22.9903 0.271
NP_441753.1_10 Reverse -167 -186 8.25926 0.186
NP_440907.2_8 Reverse -177 -187 6.0761 0.179
NP_442264.1_2 Forward -195 -178 8.00365 0.223
NP_441021.1_8 Reverse -171 -189 2.28076 0.25
NP_441021.1_8 Forward -190 -172 1.10079 0.281
NP_441463.1_3 Forward -336 -317 -5.80207 0.232
NP_441463.1_3 Reverse -166 -185 -10.3253 0.293
NP_441626.1_2 Forward -184 -177 12.2322 0.0511
NP_441626.1_2 Reverse -177 -184 5.93897 0.231
NP_441589.1_5 Forward -127 -108 16.2725 0.262
NP_441962.1_4 Reverse -324 -343 -11.3086 0.239
NP_440387.1_1 Reverse -176 -192 3.30346 0.0612
NP_440387.1_1 Forward -185 -169 -2.10475 0.146
NP_441836.1_2 Forward -344 -325 2.3594 0.174
NP_440143.1_9 Forward -47 -28 5.89851 0.126
NP_440467.1_3 Reverse -269 -288 13.0141 0.214
NP_440114.1_10 Forward -185 -171 15.4376 0.0252
NP_440114.1_10 Reverse -176 -190 7.57108 0.231
NP_440114.1_10 Reverse -251 -265 6.19444 0.282
NP_442684.1_2 Reverse -161 -180 14.4541 0.288
NP_442698.1_10 Reverse -294 -313 4.42435 0.279
NP_441510.2_7 Reverse -170 -184 11.012 0.28
NP_441510.2_7 Forward -191 -177 9.14375 0.296
NP_440766.1_4 Forward -189 -175 2.45787 0.184
NP_439988.1_3 Reverse -146 -160 3.53951 0.298
NP_439910.1_2 Reverse -168 -185 -12.1542 0.0788
NP_440457.1_1 Forward -189 -177 2.20226 0.216
NP_441801.1_4 Reverse -113 -123 2.63497 0.29
NP_442680.1_5 Reverse -303 -322 1.83066 0.237
NP_441984.1_3 Forward -288 -270 6.80398 0.264
NP_441984.1_3 Forward -130 -112 6.214 0.273
NP_440473.1_9 Reverse -165 -184 -9.53865 0.261
NP_442509.1_5 Reverse -168 -185 13.1161 0.265
NP_442509.1_9 Reverse -176 -186 13.4509 0.0553
NP_442509.1_9 Forward -185 -175 13.4509 0.0553
NP_442514.1_5 Reverse -109 -128 1.37531 0.178
NP_442514.1_5 Forward -285 -266 0.490334 0.178
NP_440554.1_4 Reverse -177 -187 11.6814 0.0377
NP_440554.1_4 Forward -184 -174 4.89658 0.171
NP_442737.1_9 Forward -325 -306 18.3879 0.199
NP_441885.1_5 Forward -185 -175 9.22315 0.0223
NP_441885.1_5 Reverse -176 -186 1.65166 0.106
NP_442341.1_7 Reverse -175 -189 15.3392 0.0229
NP_442341.1_7 Forward -339 -325 12.1926 0.0467
NP_442341.1_7 Forward -186 -172 6.58777 0.123
NP_442341.1_7 Forward -134 -120 2.75286 0.247
NP_442341.1_9 Forward -187 -173 5.99717 0.247
NP_442341.1_9 Reverse -266 -280 5.50552 0.267
NP_440423.1_6 Forward -193 -174 -17.2085 0.232
NP_440275.1_3 Forward -187 -177 5.87989 0.13
NP_442932.1_9 Reverse -292 -311 3.83436 0.289
NP_440091.1_1 Reverse -172 -184 8.88877 0.0567
NP_441105.1_3 Forward -131 -112 -6.29373 0.232
NP_441105.1_3 Reverse -106 -125 -7.17871 0.248
NP_441105.1_3 Forward -288 -269 -8.35868 0.272
NP_440216.1_1 Forward -185 -171 -3.44199 0.082
NP_440216.1_1 Reverse -176 -190 -4.81863 0.115
NP_440216.1_9 Forward -157 -148 16.9127 0.116
NP_440172.1_1 Reverse -176 -186 5.78156 0.132
NP_440172.1_1 Forward -326 -316 2.83163 0.264
NP_442371.1_1 Reverse -383 -393 12.2709 0.258
NP_441226.1_7 Forward -184 -177 12.7234 0.0312
NP_441226.1_7 Reverse -177 -184 11.5435 0.0757
NP_440198.1_10 Forward -121 -102 9.73422 0.296
NP_441111.1_7 Forward -184 -176 8.96754 0.0463
NP_441111.1_7 Reverse -177 -185 8.86921 0.0589
NP_441766.1_2 Reverse -176 -185 13.9627 0.0114
NP_441766.1_2 Forward -185 -176 7.76787 0.0714
NP_442417.1_5 Reverse -176 -190 10.521 0.113
NP_442179.1_2 Forward -311 -292 29.6954 0.000515
NP_443052.1_8 Reverse -166 -185 4.62101 0.0424
NP_443052.1_8 Forward -244 -225 -9.93197 0.198
NP_442116.1_6 Forward -54 -37 6.83207 0.271
NP_442116.1_6 Reverse -37 -54 6.54559 0.276
NP_442154.1_1 Reverse -258 -276 -17.6804 0.262
NP_442154.1_1 Forward -22 -4 -19.0571 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCCGCCTATTATTCCCAGAGCCAAAGTTTTAGCTGGAATTTGCTTACGCCTAGCGTTTTTGTGGGCATCAGCACGGCGATTATTCTTTTTTGCTCCCACTTCCACCAGGTAGAAGATGACCTGGCCGCCGGCAAAAAATCCCCCATTGTTCGTTTAGGCACCAAGTTGGGGTCCCAGGTTTTAACCCTGTCGGTTGTTAGTCTTTATCTAATTACGGCGATCGGCGTTTTGTGTCATCAGGCTCCATGGCAAACGTTACTGATAATTGCCAGTCTGCCCTGGGCAGTGCAATTAATTCGCCATGTGGGGCAATATCATGACCAGCCGGAGCAAGTCAGTAACTGTAAATTTATTGCTGTTAATTTACATTTCTTCAGCGGCATGTTAATGGCTGCGGGCT

CDS

ATGGCTGGGCTGGCCTGGGCTAAGGACTACCACCGCCAGTGGGTTAAGATGAATTACATTATGAGCAATGGTTTGTCCCCTACCCCCATCAACGCCCCAGGCTGGTTAAACAGTGGGGTTGCTAGTCTTTTGGTCAATGGCCATGTTCCCCAAGGCTTAGAACTGACCAATCAAAATTTGGCTGGGTTAGTGTTTCCCCATGGGGACCTCAGCCAGGTCGCCTTGATCGGCTGTGATTTACGCTTTGCCAATCTGGAAGGGGCGGATTTGACGGATGCCAATTTGATTGCTGCCAGTCTGCACAAAAGCAATTTGCGTCGGGCTAACCTCTGTCGGGCCACCCTCAATCGCTGCAATTTGAGTGAGGCGGATCTAACTGAAAGTGATGCTAACGAAGCCCTTTTTTGTCAGGCTGTTTTTACCGAAGTGGAAGCCCACGGCTTAAGACTTTACCGAGCTAAGGTCAGCCAAGCCCAATTAATGGGAGCCCATCTCCACCAAGCCTATGCTCCGGAGGCAGATTTTAGTGCGGTGGCGGCGATCGCCGTTGATTTGCGCTGGGCTAATTTAAGAAAGACTAATTTTCGGGGGGCGGATTTACGCTATGGCAATTTTCGGGGGGCGAATCTAACCCAGGCGGATTTTACCGGGGCCAACCTGAAAGGAGCTAATTTACGGGGGGCAAACTTAGTGGGCACTAACCTGCAACGGGCCGACCTCAGTGATGTTACTTGGTAG

Protein

MAGLAWAKDYHRQWVKMNYIMSNGLSPTPINAPGWLNSGVASLLVNGHVPQGLELTNQNLAGLVFPHGDLSQVALIGCDLRFANLEGADLTDANLIAASLHKSNLRRANLCRATLNRCNLSEADLTESDANEALFCQAVFTEVEAHGLRLYRAKVSQAQLMGAHLHQAYAPEADFSAVAAIAVDLRWANLRKTNFRGADLRYGNFRGANLTQADFTGANLKGANLRGANLVGTNLQRADLSDVTW