Your browser is old and dusty. Try Google Chrome!

Details for slr1515

ORF slr1515
Accession NP_441345.1
Symbol ictB
Category putative membrane protein required for bicarbonate uptake
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -189 -203 14.7492 0.126
NP_440694.1_6 Reverse -89 -108 5.89931 0.241
NP_443032.1_8 Forward -58 -39 14.7491 0.0463
NP_442291.1_5 Forward -227 -211 13.8249 0.0261
NP_442291.1_5 Reverse -314 -330 -4.56302 0.28
NP_441453.1_4 Reverse -217 -225 6.70593 0.121
NP_440226.1_1 Reverse -217 -236 4.12936 0.202
NP_440150.1_2 Forward -70 -51 5.40686 0.269
NP_440996.1_4 Forward -89 -79 17.5813 0.15
NP_442173.1_1 Forward -225 -217 5.82095 0.2
NP_442752.1_4 Reverse -217 -224 13.8055 0.0199
NP_443027.1_4 Reverse -215 -225 7.25653 0.24
NP_443027.1_4 Forward -228 -218 6.07655 0.294
NP_442975.1_10 Forward -230 -216 2.5556 0.273
NP_440784.1_7 Forward -225 -218 6.23397 0.241
NP_440784.1_7 Reverse -218 -225 6.13563 0.241
NP_440061.1_9 Forward -228 -214 5.89884 0.266
NP_440110.1_4 Reverse -112 -131 2.55606 0.249
NP_441054.1_2 Forward -100 -81 9.93088 0.284
NP_442062.1_8 Reverse -217 -227 9.22315 0.0658
NP_442974.1_4 Forward -210 -191 14.6508 0.292
NP_442242.1_4 Reverse -218 -225 12.4288 0.0393
NP_442196.1_10 Forward -300 -281 12.5858 0.217
NP_441925.1_4 Forward -205 -186 -16.6192 0.284
NP_441083.1_5 Forward -226 -216 1.74999 0.198
NP_439957.1_9 Forward -362 -343 6.54077 0.3
NP_441738.1_2 Forward -224 -217 15.28 0.0102
NP_440209.1_1 Reverse -217 -225 14.8674 0.012
NP_441716.1_2 Reverse -111 -130 -2.00377 0.293
NP_442111.1_4 Reverse -216 -230 5.60446 0.158
NP_441624.1_7 Forward -59 -45 9.93102 0.217
NP_441163.1_4 Forward -208 -189 13.5982 0.278
NP_440906.1_5 Forward -225 -218 12.0355 0.0724
NP_440906.1_5 Reverse -218 -225 12.0355 0.0724
NP_440747.1_10 Reverse -214 -226 -2.81262 0.0713
NP_441014.1_8 Forward -211 -192 -6.68705 0.276
NP_443018.1_3 Forward -58 -51 9.38056 0.128
NP_443018.1_3 Forward -225 -218 5.34899 0.212
NP_443018.1_3 Reverse -218 -225 5.34899 0.212
NP_441634.1_8 Reverse -215 -229 -2.85201 0.295
NP_440376.1_1 Forward -391 -382 1.86802 0.238
NP_440376.1_1 Reverse -217 -226 -0.000272808 0.285
NP_440376.1_1 Forward -226 -217 -0.0986038 0.285
NP_441588.1_4 Forward -224 -214 6.46988 0.193
NP_442770.1_1 Reverse -327 -341 16.2235 0.271
NP_441950.1_7 Reverse -183 -202 -8.16202 0.287
NP_442658.1_1 Forward -228 -218 10.6976 0.11
NP_441414.1_9 Reverse -217 -236 4.03102 0.0557
NP_442937.1_5 Reverse -212 -231 11.0125 0.148
NP_441958.1_5 Reverse -216 -226 -6.41148 0.28
NP_441127.1_1 Forward -277 -263 8.06273 0.3
NP_442911.1_2 Forward -236 -217 15.7324 0.0103
NP_440153.1_8 Forward -198 -185 6.60746 0.17
NP_440993.1_2 Forward -318 -302 6.05672 0.233
NP_441646.1_1 Forward -205 -186 1.27776 0.232
NP_442438.1_10 Forward -231 -217 3.44117 0.162
NP_441000.1_6 Forward -227 -213 -4.22864 0.231
NP_442771.1_1 Reverse -258 -276 -8.83064 0.208
NP_440484.1_3 Reverse -215 -229 20.9441 0.0821
NP_440147.1_4 Forward -200 -187 2.57589 0.207
NP_441550.1_8 Reverse -215 -225 5.78111 0.23
NP_441916.1_10 Forward -272 -253 1.57275 0.264
NP_441041.1_4 Reverse -183 -202 -13.4719 0.288
NP_440569.1_10 Reverse -16 -35 10.9334 0.219
NP_441725.1_5 Reverse -218 -228 0.176696 0.206
NP_439966.1_7 Forward -228 -218 6.96107 0.16
NP_439966.1_7 Reverse -215 -225 5.48612 0.22
NP_442941.1_3 Forward -225 -215 9.51814 0.0306
NP_440260.1_8 Reverse -286 -304 -2.83245 0.246
NP_442281.1_1 Forward -203 -189 7.07881 0.108
NP_442281.1_1 Forward -64 -50 1.67063 0.293
NP_441644.1_6 Reverse -217 -227 3.32285 0.288
NP_441644.1_6 Forward -59 -49 3.22451 0.293
NP_442215.1_2 Reverse -42 -58 -6.43131 0.271
NP_440929.1_8 Forward -226 -217 7.86621 0.0522
NP_440929.1_8 Reverse -217 -226 7.57121 0.0706
NP_441346.1_7 Reverse -252 -271 13.8641 0.183
NP_442933.1_10 Reverse -217 -226 5.40793 0.19
NP_441751.2_8 Forward -225 -211 -2.65535 0.133
NP_441751.2_8 Reverse -89 -103 -6.58858 0.273
NP_442554.1_8 Forward -225 -215 6.46988 0.117
NP_442142.1_4 Forward -62 -49 2.28034 0.295
NP_442292.1_1 Forward -225 -216 8.75118 0.0306
NP_442292.1_1 Reverse -218 -227 -0.786921 0.287
NP_442476.1_6 Reverse -218 -232 1.76955 0.205
NP_442381.1_8 Forward -229 -210 -14.9469 0.29
NP_443009.1_5 Reverse -216 -227 7.43299 0.129
NP_440125.1_6 Forward -393 -374 16.0274 0.112
NP_441715.1_4 Forward -225 -215 7.64985 0.108
NP_440279.1_8 Forward -177 -158 15.5357 0.242
NP_440158.1_1 Reverse -119 -138 11.2199 0.219
NP_441468.1_1 Forward -225 -218 6.13563 0.209
NP_441468.1_1 Reverse -218 -225 6.0373 0.223
NP_441015.1_10 Reverse -184 -203 0.491109 0.165
NP_441673.1_1 Forward -226 -217 1.27803 0.155
NP_441673.1_1 Reverse -217 -226 1.27803 0.155
NP_442868.1_6 Reverse -215 -225 9.41981 0.0485
NP_442808.1_1 Forward -227 -217 8.53436 0.0493
NP_442808.1_1 Reverse -380 -390 0.962914 0.299
NP_442050.1_5 Reverse -86 -96 7.94438 0.243
NP_441493.2_7 Forward -319 -300 12.5858 0.283
NP_441036.1_8 Forward -227 -217 15.2213 0.0116
NP_441534.1_5 Forward -41 -22 3.44104 0.293
NP_441557.1_5 Forward -226 -217 7.66954 0.0443
NP_441557.1_5 Reverse -217 -226 0.983037 0.0911
NP_441433.1_8 Reverse -45 -64 -0.787193 0.251
NP_441655.1_10 Reverse -205 -223 6.60732 0.21
NP_442347.1_2 Forward -225 -216 3.93297 0.284
NP_440136.1_2 Forward -225 -218 6.23397 0.171
NP_440136.1_2 Reverse -218 -225 6.13563 0.193
NP_442998.1_5 Reverse -56 -66 7.25653 0.298
NP_442998.1_10 Forward -224 -217 15.5754 0.0102
NP_440299.1_1 Forward -230 -217 12.5067 0.0369
NP_440256.1_1 Reverse -214 -233 -9.047 0.273
NP_441559.1_3 Forward -199 -180 14.7483 0.274
NP_440915.1_6 Reverse -46 -60 -2.45868 0.272
NP_440164.1_5 Reverse -375 -394 2.16274 0.211
NP_440134.1_2 Forward -48 -29 6.39097 0.296
NP_442866.1_1 Reverse -299 -318 -9.83364 0.3
NP_440787.1_5 Forward -265 -251 13.4709 0.256
NP_442386.1_9 Forward -227 -218 4.81753 0.282
NP_441340.1_5 Reverse -218 -225 6.13563 0.175
NP_441340.1_5 Forward -225 -218 5.93897 0.198
NP_440168.1_9 Reverse -187 -206 -0.39387 0.273
NP_440059.1_3 Reverse -291 -310 5.01354 0.299
NP_439976.1_5 Forward -89 -75 13.372 0.257
NP_441134.1_9 Forward -318 -299 17.7974 0.193
NP_440586.1_1 Reverse -185 -204 -3.63879 0.272
NP_440586.1_8 Reverse -218 -225 11.4451 0.0645
NP_442251.1_6 Forward -225 -218 12.0355 0.0627
NP_440192.1_5 Reverse -181 -200 6.68596 0.224
NP_440684.1_9 Reverse -211 -225 11.0127 0.183
NP_441262.1_3 Reverse -217 -224 14.7888 0.0223
NP_441262.1_3 Forward -226 -219 5.15232 0.265
NP_440027.1_3 Forward -198 -180 10.0481 0.177
NP_443051.1_1 Reverse -216 -225 0.786375 0.125
NP_439937.1_9 Forward -199 -182 -11.1715 0.245
NP_440372.1_2 Reverse -218 -225 6.72562 0.0929
NP_440372.1_2 Forward -225 -218 6.62729 0.151
NP_442783.1_8 Reverse -270 -289 13.3716 0.296
NP_440316.1_10 Reverse -49 -59 6.66654 0.256
NP_442384.1_10 Forward -208 -195 1.9859 0.24
NP_442790.1_4 Reverse -208 -227 -12.8819 0.255
NP_442262.1_10 Forward -58 -51 9.47889 0.187
NP_440282.1_3 Reverse -39 -58 7.66927 0.221
NP_442123.1_10 Reverse -353 -372 5.70265 0.288
NP_440297.1_9 Reverse -218 -228 -0.216628 0.282
NP_440350.1_5 Reverse -309 -328 -1.96717 0.215
NP_440350.1_5 Reverse -336 -355 -4.03212 0.273
NP_440350.1_5 Reverse -333 -352 -7.08038 0.299
NP_442280.1_1 Reverse -187 -206 3.04771 0.296
NP_442280.1_10 Reverse -286 -304 9.74004 0.231
NP_441592.1_10 Forward -70 -56 12.2903 0.298
NP_443036.1_10 Reverse -294 -313 4.42435 0.251
NP_440999.1_9 Forward -202 -188 6.48943 0.0969
NP_440888.1_2 Reverse -304 -318 5.50552 0.276
NP_440888.1_2 Forward -198 -184 5.30886 0.284
NP_441345.1_4 Forward -281 -262 18.1907 0.225
NP_441345.1_7 Forward -213 -194 19.4681 0.13
NP_440575.1_1 Reverse -258 -277 3.73524 0.256
NP_441543.1_2 Forward -225 -216 7.17789 0.131
NP_442845.1_2 Reverse -44 -58 5.99778 0.219
NP_441469.1_8 Forward -227 -218 6.78456 0.227
NP_441306.1_4 Forward -65 -46 14.8474 0.145
NP_442578.1_7 Reverse -218 -225 5.93897 0.183
NP_440710.1_1 Reverse -66 -84 -9.12563 0.294
NP_441929.1_6 Forward -25 -6 13.7658 0.261
NP_442204.1_1 Reverse -46 -57 -0.334653 0.295
NP_440516.1_8 Reverse -217 -226 8.25953 0.0391
NP_442428.1_5 Forward -225 -218 6.13563 0.209
NP_442428.1_5 Reverse -218 -225 6.0373 0.212
NP_440603.1_9 Forward -113 -94 1.76941 0.278
NP_440673.1_3 Forward -224 -217 12.4288 0.0426
NP_441052.1_2 Forward -226 -216 1.65166 0.233
NP_442219.1_9 Forward -225 -216 8.06287 0.0696
NP_440436.1_4 Forward -225 -216 13.9623 0.0193
NP_440436.1_4 Reverse -218 -227 5.80084 0.182
NP_440314.1_9 Forward -225 -206 -1.7705 0.14
NP_442907.1_2 Forward -197 -179 9.75391 0.238
NP_441719.1_4 Reverse -218 -225 6.72562 0.093
NP_441719.1_4 Forward -225 -218 6.62729 0.151
NP_441733.1_10 Reverse -206 -219 6.4108 0.188
NP_442813.1_4 Reverse -240 -259 -9.24366 0.3
NP_442854.1_6 Reverse -255 -274 3.44104 0.259
NP_441851.1_10 Reverse -216 -226 5.87989 0.196
NP_441851.1_10 Forward -227 -217 4.69992 0.254
NP_442856.1_7 Forward -207 -188 -4.03212 0.254
NP_441349.1_10 Reverse -207 -226 -1.86883 0.109
NP_440432.1_9 Forward -168 -153 -3.16669 0.179
NP_440432.1_9 Forward -225 -210 -4.15 0.198
NP_442843.1_1 Reverse -51 -70 4.62101 0.151
NP_440474.1_8 Reverse -218 -232 6.88214 0.215
NP_440483.1_1 Reverse -45 -64 8.25926 0.154
NP_440483.1_1 Forward -60 -41 -7.96535 0.276
NP_441078.1_4 Reverse -217 -226 0.0980582 0.205
NP_441078.1_4 Forward -226 -217 0.0980582 0.205
NP_442348.1_2 Forward -392 -383 7.37455 0.28
NP_441432.1_8 Reverse -216 -225 7.17789 0.102
NP_442320.1_8 Forward -232 -218 -4.32697 0.159
NP_442320.1_8 Reverse -211 -225 -6.09693 0.265
NP_440290.1_1 Reverse -104 -113 16.6071 0.24
NP_440578.1_10 Reverse -281 -300 8.75091 0.286
NP_440713.1_4 Reverse -179 -198 6.4893 0.189
NP_442489.1_7 Forward -226 -217 0.786375 0.152
NP_442489.1_7 Reverse -217 -226 0.589713 0.17
NP_440559.1_1 Forward -225 -216 14.1594 0.0317
NP_441659.2_8 Reverse -217 -227 5.28991 0.112
NP_441022.1_1 Forward -117 -108 11.5462 0.274
NP_439956.1_7 Reverse -183 -202 4.32602 0.257
NP_442346.1_5 Reverse -216 -226 14.0414 0.0173
NP_440025.1_4 Forward -400 -381 14.6508 0.222
NP_441126.1_6 Forward -42 -28 17.9304 0.218
NP_440459.1_2 Forward -307 -290 9.67528 0.224
NP_440847.1_3 Forward -196 -182 14.5519 0.199
NP_441888.1_7 Forward -203 -189 11.0127 0.0977
NP_441833.1_4 Forward -225 -218 14.1004 0.0258
NP_441833.1_4 Reverse -218 -225 6.13563 0.198
NP_442162.1_9 Forward -225 -218 6.62729 0.142
NP_442162.1_9 Reverse -218 -225 6.52896 0.178
NP_442140.1_3 Reverse -218 -228 7.84651 0.126
NP_442021.1_9 Forward -210 -191 9.53756 0.161
NP_441813.1_5 Reverse -215 -225 8.33817 0.047
NP_441813.1_5 Forward -228 -218 6.8632 0.0784
NP_440590.1_4 Forward -225 -212 -0.275709 0.182
NP_440590.1_4 Forward -197 -184 -5.78224 0.289
NP_440567.1_1 Reverse -218 -232 0.491246 0.244
NP_442497.1_10 Forward -225 -216 0.688044 0.141
NP_440821.1_4 Forward -228 -218 8.73149 0.0426
NP_440821.1_4 Reverse -215 -225 -0.41329 0.257
NP_441239.1_9 Forward -61 -49 5.15219 0.227
NP_441239.1_9 Forward -228 -216 4.07055 0.264
NP_440156.1_4 Reverse -37 -47 9.22267 0.208
NP_441892.1_1 Reverse -41 -58 -1.82945 0.214
NP_441892.1_1 Forward -201 -184 -4.18939 0.256
NP_440546.1_4 Reverse -50 -60 13.5365 0.0459
NP_440546.1_4 Forward -59 -49 7.62206 0.23
NP_441537.1_3 Reverse -122 -136 17.6002 0.208
NP_442402.1_4 Forward -177 -158 -3.63955 0.219
NP_441848.1_4 Forward -44 -28 11.8478 0.213
NP_441084.1_6 Forward -300 -286 10.6046 0.234
NP_439942.1_2 Reverse -24 -43 13.9582 0.228
NP_440696.1_3 Reverse -179 -197 1.49411 0.217
NP_442679.1_1 Forward -367 -348 7.96426 0.147
NP_442679.1_1 Forward -346 -327 6.29264 0.147
NP_442380.1_10 Reverse -179 -197 9.45892 0.262
NP_442829.1_2 Forward -265 -249 18.4809 0.12
NP_442696.1_6 Reverse -377 -396 -2.85214 0.147
NP_442837.1_3 Forward -225 -218 6.13563 0.25
NP_442837.1_3 Reverse -218 -225 5.93897 0.265
NP_441760.1_4 Reverse -183 -201 14.8671 0.235
NP_440505.1_3 Reverse -215 -225 17.0896 0.00449
NP_440914.1_1 Forward -226 -216 6.95605 0.257
NP_442533.1_6 Forward -59 -50 1.67135 0.293
NP_441482.1_4 Reverse -381 -400 9.83255 0.296
NP_439944.1_9 Reverse -218 -228 6.07655 0.199
NP_441527.1_4 Forward -358 -339 -7.40105 0.232
NP_441527.1_4 Forward -362 -343 -7.68752 0.236
NP_441527.1_4 Forward -365 -346 -10.2658 0.268
NP_440115.1_6 Reverse -214 -224 6.76487 0.167
NP_441106.1_1 Forward -227 -218 5.70292 0.131
NP_441286.1_1 Reverse -216 -228 2.79224 0.0532
NP_440670.1_8 Forward -226 -217 13.2744 0.0157
NP_440670.1_8 Reverse -217 -226 7.37455 0.0774
NP_440268.1_5 Forward -271 -252 11.0117 0.198
NP_439995.1_5 Forward -236 -217 9.0459 0.235
NP_441021.1_1 Forward -225 -206 -11.1119 0.257
NP_442893.1_4 Reverse -234 -253 2.45694 0.192
NP_441626.1_2 Forward -225 -218 6.0373 0.212
NP_441626.1_2 Reverse -218 -225 6.0373 0.212
NP_441401.1_4 Forward -360 -347 13.9823 0.253
NP_441431.1_2 Forward -201 -187 10.3237 0.162
NP_441431.1_2 Reverse -47 -61 8.06211 0.226
NP_441431.1_2 Forward -62 -48 6.58715 0.266
NP_441993.1_1 Reverse -183 -202 2.8238 0.25
NP_440114.1_10 Reverse -50 -64 9.04604 0.186
NP_439988.1_3 Reverse -46 -60 3.53951 0.298
NP_442930.1_1 Reverse -123 -133 10.0093 0.28
NP_440458.1_3 Reverse -142 -161 7.96426 0.3
NP_439910.1_2 Forward -234 -217 -22.2823 0.22
NP_440801.1_8 Forward -227 -208 -1.47551 0.278
NP_442509.1_9 Reverse -382 -392 13.1559 0.061
NP_440554.1_4 Reverse -218 -228 6.07655 0.128
NP_441885.1_5 Forward -226 -216 1.35667 0.11
NP_442395.2_4 Reverse -216 -235 0.293673 0.274
NP_443000.1_7 Reverse -215 -225 10.1081 0.0376
NP_441561.1_4 Reverse -178 -197 6.39097 0.254
NP_440275.1_3 Forward -228 -218 5.68323 0.136
NP_440275.1_3 Reverse -215 -225 5.48657 0.145
NP_442932.1_9 Forward -270 -251 6.88262 0.249
NP_440091.1_1 Forward -230 -218 8.6921 0.0602
NP_441902.1_3 Forward -41 -31 12.3986 0.253
NP_439962.1_4 Reverse -272 -291 -7.37537 0.288
NP_441105.1_3 Reverse -39 -58 3.83436 0.086
NP_440216.1_1 Reverse -217 -231 -3.147 0.0729
NP_440216.1_1 Forward -226 -212 -12.2918 0.256
NP_442788.1_2 Forward -214 -195 11.7992 0.23
NP_441111.1_7 Forward -225 -217 8.96754 0.0463
NP_441766.1_2 Forward -226 -217 6.5879 0.0918
NP_440416.1_9 Reverse -308 -327 -17.4051 0.239
NP_440416.1_9 Reverse -278 -297 -18.9784 0.267
NP_443052.1_8 Forward -236 -217 -11.7019 0.236
NP_443052.1_9 Forward -202 -183 -3.83545 0.252
NP_442116.1_6 Forward -128 -111 5.3042 0.299
NP_442154.1_1 Reverse -187 -205 -17.8771 0.272
NP_442226.1_8 Forward -89 -79 16.6963 0.164
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AATCCTACGGGGGTTTGTCCGACTTGAGGAACTACAACGCAGAAATGAAGAAATACAACGAAGAAATGAGGAAGCTAGAGAACGAAAAGCAGACGCGGCACGAGCAAAGGATGAAAGAGCTGAGGCGGCAGAACGAGAAACTCGCCGAACTAGAATCGAAACTCGATATCGTACTACGATCGCCAGATTCCAACTGGACCCCAGCCAACTCCACCGAAGACAGTTAGCGGATATTATCGCCCTATTGGAAGAGTACCGAGATACGCTGTGAAATTGTTTGACACTAAACTTTTGTCAGAGCCGCGGGATCTAATTTTGGCTGTATCCCTACCGAGAATATGCCCCATGGCTTAGGCTAATTGGTGAGAAAGTTGTTCAGAATTCACGGGCAAAGTATTTA

CDS

ATGGTGTCTCCCATCTCTATCTGGCGATCGCTGATGTTTGGCGGTTTTTCCCCCCAGGAATGGGGCCGGGGCAGTGTGCTCCATCGTTTGGTGGGCTGGGGACAGAGTTGGATACAGGCTAGTGTGCTCTGGCCCCACTTCGAGGCATTGGGTACGGCTCTAGTGGCAATAATTTTTATTGCGGCTCCCTTCACCTCCACCACCATGTTGGGCATTTTTATGCTGCTCTGTGGAGCCTTTTGGGCTCTGCTGACCTTTGCTGATCAACCAGGGAAGGGTTTGACTCCCATCCATGTTTTAGTTTTTGCCTACTGGTGCATTTCGGCGATCGCCGTGGGATTTTCTCCGGTAAAAATGGCGGCGGCGTCGGGGTTAGCGAAATTAACAGCTAATTTATGTCTGTTTCTACTGGCGGCGAGGTTATTGCAAAACAAACAATGGTTGAACCGGTTAGTAACCGTTGTTTTACTGGTAGGGCTATTGGTGGGGAGTTACGGTCTGCGACAACAGGTGGACGGGGTAGAACAGTTAGCCACTTGGAATGACCCCACCTCTACCTTGGCCCAGGCCACTAGGGTATATAGCTTTTTAGGTAATCCCAATCTCTTGGCGGCTTACCTGGTGCCCATGACGGGTTTGAGCTTGAGTGCCCTGGTGGTATGGCGACGGTGGTGGCCCAAACTGCTGGGAGCAACCATGGTGATTGTTAACCTACTCTGTCTCTTTTTTACCCAGAGCCGGGGCGGTTGGCTAGCAGTGCTGGCCCTGGGAGCTACCTTCCTGGCCCTTTGTTACTTCTGGTGGTTACCCCAATTACCCAAATTTTGGCAACGGTGGTCTTTGCCCCTGGCGATCGCCGTGGCGGTTATATTAGGTGGGGGAGCGTTGATTGCGGTGGAACCGATTCGACTCAGGGCCATGAGCATTTTTGCTGGGCGGGAAGACAGCAGTAATAATTTCCGCATCAATGTTTGGGAAGGGGTAAAAGCCATGATCCGAGCCCGCCCTATCATTGGCATTGGCCCAGGTAACGAAGCCTTTAACCAAATTTATCCTTACTATATGCGGCCCCGCTTCACCGCCCTGAGTGCCTATTCCATTTACCTAGAAATTTTGGTGGAAACGGGTGTAGTTGGTTTTACCTGTATGCTCTGGCTGTTGGCCGTTACCCTAGGCAAAGGCGTAGAACTGGTTAAACGCTGTCGCCAAACCCTCGCCCCGGAAGGCATCTGGATTATGGGGGCTTTAGCGGCGATCATCGGTTTGTTGGTCCACGGCATGGTAGATACAGTCTGGTACCGTCCCCCGGTGAGCACTTTGTGGTGGTTGCTAGTGGCCATTGTTGCTAGTCAGTGGGCCAGCGCCCAGGCCCGTTTGGAGGCCAGTAAAGAAGAAAATGAGGACAAACCTCTTCTTGCTTCATAA

Protein

MVSPISIWRSLMFGGFSPQEWGRGSVLHRLVGWGQSWIQASVLWPHFEALGTALVAIIFIAAPFTSTTMLGIFMLLCGAFWALLTFADQPGKGLTPIHVLVFAYWCISAIAVGFSPVKMAAASGLAKLTANLCLFLLAARLLQNKQWLNRLVTVVLLVGLLVGSYGLRQQVDGVEQLATWNDPTSTLAQATRVYSFLGNPNLLAAYLVPMTGLSLSALVVWRRWWPKLLGATMVIVNLLCLFFTQSRGGWLAVLALGATFLALCYFWWLPQLPKFWQRWSLPLAIAVAVILGGGALIAVEPIRLRAMSIFAGREDSSNNFRINVWEGVKAMIRARPIIGIGPGNEAFNQIYPYYMRPRFTALSAYSIYLEILVETGVVGFTCMLWLLAVTLGKGVELVKRCRQTLAPEGIWIMGALAAIIGLLVHGMVDTVWYRPPVSTLWWLLVAIVASQWASAQARLEASKEENEDKPLLAS