Your browser is old and dusty. Try Google Chrome!

Details for slr1488

ORF slr1488
Accession NP_439927.1
Symbol
Category multidrug resistance family ABC transporter
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -289 -303 4.42448 0.148
NP_441061.1_2 Reverse -226 -240 -0.983719 0.246
NP_441061.1_2 Reverse -178 -192 -2.06536 0.281
NP_440557.1_1 Reverse -184 -203 0.58944 0.265
NP_441418.1_6 Forward -297 -278 -20.65 0.121
NP_441418.1_6 Forward -303 -284 -30.0898 0.256
NP_442291.1_5 Reverse -287 -303 8.71166 0.0558
NP_440295.1_2 Forward -315 -296 5.99764 0.283
NP_440897.1_6 Reverse -288 -307 -0.787962 0.185
NP_441453.1_4 Reverse -288 -296 7.29591 0.0589
NP_441453.1_4 Forward -297 -289 6.70593 0.121
NP_441623.1_1 Forward -32 -14 -2.83245 0.248
NP_442151.1_6 Reverse -294 -308 6.19444 0.244
NP_441818.1_1 Reverse -289 -300 9.30127 0.246
NP_441818.1_9 Forward -180 -161 -10.6203 0.296
NP_440226.1_1 Forward -297 -278 2.45773 0.263
NP_441465.1_8 Reverse -284 -302 6.70565 0.254
NP_442169.1_1 Forward -336 -317 5.99764 0.26
NP_442173.1_1 Forward -296 -288 7.59091 0.163
NP_442173.1_1 Reverse -289 -297 5.82095 0.2
NP_442752.1_4 Forward -297 -290 13.8055 0.0199
NP_443027.1_4 Forward -299 -289 10.2065 0.138
NP_443027.1_4 Forward -390 -380 7.35486 0.24
NP_442975.1_10 Reverse -284 -298 9.34041 0.0722
NP_440784.1_7 Reverse -289 -296 6.23397 0.241
NP_440784.1_7 Forward -296 -289 6.13563 0.241
NP_440061.1_9 Forward -258 -244 5.01387 0.298
NP_441054.1_4 Forward -334 -316 -3.22577 0.26
NP_440631.1_9 Forward -216 -197 10.417 0.286
NP_442062.1_8 Forward -297 -287 9.61647 0.0587
NP_442062.1_8 Reverse -288 -298 5.19158 0.181
NP_440761.1_4 Reverse -283 -302 -12.2919 0.241
NP_441859.1_3 Forward -298 -279 9.7334 0.125
NP_441802.1_1 Forward -201 -182 7.37428 0.248
NP_442242.1_4 Forward -296 -289 12.4288 0.0393
NP_440044.1_8 Reverse -289 -308 1.86774 0.161
NP_441581.1_6 Reverse -279 -298 10.9408 0.283
NP_442110.1_7 Reverse -288 -302 10.7177 0.0644
NP_440769.1_8 Forward -87 -68 9.0459 0.218
NP_441083.1_5 Reverse -288 -298 1.84832 0.198
NP_442827.1_1 Forward -393 -374 16.4644 0.272
NP_441434.1_6 Forward -215 -205 14.533 0.278
NP_441738.1_2 Reverse -290 -297 15.28 0.0102
NP_441645.1_1 Forward -302 -283 11.11 0.191
NP_440209.1_1 Forward -297 -289 14.8674 0.012
NP_441770.1_4 Forward -302 -283 -3.73712 0.204
NP_440906.1_5 Forward -296 -289 12.0355 0.0724
NP_440906.1_5 Reverse -289 -296 12.0355 0.0724
NP_440747.1_10 Forward -300 -288 -12.1541 0.227
NP_441130.1_10 Forward -299 -285 8.16106 0.14
NP_441486.1_1 Forward -300 -286 4.03116 0.0508
NP_441486.1_1 Reverse -285 -299 0.589577 0.132
NP_439964.1_10 Forward -129 -115 20.0591 0.245
NP_442634.1_4 Forward -395 -381 -5.40861 0.253
NP_440057.1_6 Reverse -58 -77 19.3225 0.179
NP_442848.1_1 Forward -303 -289 -2.75368 0.263
NP_441012.1_4 Forward -301 -288 5.72248 0.291
NP_443018.1_3 Forward -296 -289 5.34899 0.212
NP_443018.1_3 Reverse -289 -296 5.34899 0.212
NP_441634.1_8 Forward -299 -285 4.71948 0.119
NP_440376.1_1 Reverse -288 -297 -0.000272808 0.285
NP_440376.1_1 Forward -297 -288 -0.0986038 0.285
NP_441857.1_5 Reverse -281 -299 1.98577 0.282
NP_441588.1_4 Reverse -290 -300 8.63316 0.14
NP_442687.1_7 Forward -298 -288 6.37155 0.171
NP_442687.1_7 Forward -367 -357 5.48657 0.2
NP_442191.1_4 Reverse -385 -399 11.3809 0.262
NP_440642.1_10 Forward -381 -367 3.04726 0.277
NP_442658.1_1 Reverse -286 -296 14.5325 0.0229
NP_442782.1_7 Forward -305 -286 1.0811 0.207
NP_442205.1_9 Forward -394 -378 -1.02311 0.264
NP_441414.1_9 Reverse -294 -313 -7.67036 0.223
NP_441958.1_5 Forward -298 -288 1.455 0.0956
NP_439905.1_1 Forward -296 -283 7.19745 0.264
NP_440984.1_7 Reverse -242 -256 10.226 0.126
NP_439990.1_5 Forward -302 -289 7.88576 0.185
NP_442690.1_1 Reverse -261 -280 -5.70374 0.161
NP_442064.1_4 Reverse -284 -303 8.55343 0.232
NP_442064.1_4 Reverse -353 -372 4.42355 0.287
NP_443055.1_6 Reverse -307 -325 7.3932 0.16
NP_443055.1_6 Reverse -271 -289 4.93494 0.181
NP_441913.1_3 Forward -278 -265 16.2954 0.218
NP_440809.1_9 Reverse -348 -366 -9.12563 0.297
NP_442438.1_10 Forward -302 -288 4.71948 0.142
NP_441398.1_9 Forward -266 -247 14.3549 0.288
NP_440879.1_6 Reverse -283 -302 14.2574 0.0335
NP_441916.1_7 Forward -297 -287 6.56821 0.0919
NP_441916.1_7 Reverse -288 -298 1.455 0.285
NP_441916.1_10 Forward -57 -38 4.42435 0.223
NP_441041.1_4 Reverse -241 -260 -5.80207 0.159
NP_441041.1_4 Forward -303 -284 -13.1769 0.282
NP_441041.1_7 Reverse -285 -297 5.47405 0.255
NP_441547.1_2 Forward -308 -290 8.86894 0.212
NP_442004.1_6 Reverse -379 -393 1.76955 0.278
NP_441725.1_5 Reverse -289 -299 1.55333 0.133
NP_439966.1_7 Forward -299 -289 5.97777 0.199
NP_439966.1_9 Reverse -286 -295 0.983037 0.253
NP_442941.1_1 Forward -218 -199 17.9043 0.191
NP_442941.1_3 Reverse -289 -299 10.2065 0.0213
NP_441514.1_6 Forward -394 -387 14.2971 0.248
NP_441514.1_6 Forward -325 -318 14.2971 0.248
NP_442281.1_1 Forward -302 -288 3.24392 0.238
NP_440437.1_1 Forward -303 -284 3.93269 0.114
NP_440437.1_1 Forward -262 -243 -4.52377 0.261
NP_442049.1_6 Reverse -286 -305 4.22769 0.252
NP_441644.1_6 Reverse -288 -298 6.17443 0.165
NP_443049.1_6 Forward -144 -134 11.0554 0.282
NP_442215.1_2 Reverse -286 -302 2.61514 0.112
NP_442215.1_2 Forward -306 -290 -0.138127 0.162
NP_442215.1_2 Forward -312 -296 -7.51295 0.297
NP_442933.1_10 Forward -297 -288 13.9627 0.0192
NP_442933.1_10 Reverse -288 -297 8.1612 0.0885
NP_442933.1_10 Reverse -123 -132 7.86621 0.103
NP_440430.1_1 Reverse -349 -368 16.8651 0.0858
NP_441751.2_8 Reverse -289 -303 -2.75368 0.133
NP_442554.1_8 Reverse -289 -299 6.17489 0.125
NP_442554.1_8 Reverse -295 -305 2.63497 0.265
NP_441762.1_7 Forward -298 -286 -4.87757 0.183
NP_441762.1_7 Reverse -287 -299 -5.66422 0.228
NP_442142.1_4 Forward -300 -287 5.42692 0.192
NP_442142.1_4 Forward -135 -122 4.54195 0.217
NP_442142.1_4 Reverse -174 -187 2.96866 0.269
NP_442292.1_1 Reverse -289 -298 8.75118 0.0306
NP_443009.1_4 Forward -192 -173 16.0274 0.223
NP_443009.1_5 Forward -298 -287 7.43299 0.129
NP_442408.2_1 Reverse -135 -154 -7.57203 0.3
NP_441715.1_4 Reverse -289 -299 5.09324 0.233
NP_441468.1_1 Reverse -289 -296 6.13563 0.209
NP_441468.1_1 Forward -296 -289 6.0373 0.223
NP_441673.1_1 Reverse -288 -297 1.37636 0.114
NP_441673.1_1 Forward -297 -288 1.1797 0.163
NP_441826.1_2 Forward -303 -289 15.2409 0.0196
NP_441826.1_2 Reverse -288 -302 4.12949 0.105
NP_441826.1_2 Forward -372 -358 -4.81863 0.3
NP_442868.1_6 Forward -299 -289 0.0783647 0.248
NP_441612.1_2 Reverse -300 -310 8.25885 0.228
NP_442361.1_3 Forward -303 -290 9.95071 0.272
NP_442808.1_1 Reverse -287 -297 8.63269 0.0481
NP_442808.1_1 Reverse -133 -143 1.84789 0.281
NP_442542.1_2 Reverse -286 -299 7.88576 0.168
NP_442050.1_5 Forward -299 -289 6.66608 0.286
NP_440558.1_2 Forward -297 -278 -5.01543 0.251
NP_440558.1_2 Reverse -285 -304 -6.29373 0.273
NP_441036.1_8 Reverse -287 -297 15.9097 0.00724
NP_441557.1_5 Forward -297 -288 8.84951 0.0343
NP_441557.1_5 Reverse -288 -297 0.786375 0.106
NP_442267.1_4 Forward -330 -311 3.93269 0.207
NP_440101.1_3 Reverse -283 -302 2.94938 0.242
NP_442830.1_5 Reverse -133 -147 -1.57428 0.299
NP_440356.1_10 Reverse -281 -299 13.9821 0.23
NP_441116.1_9 Forward -336 -322 12.4876 0.252
NP_442347.1_2 Reverse -289 -298 3.93297 0.284
NP_442645.1_2 Forward -258 -239 -7.67036 0.112
NP_442645.1_2 Reverse -286 -305 -19.5684 0.288
NP_440136.1_2 Reverse -289 -296 6.23397 0.171
NP_440136.1_2 Forward -296 -289 6.13563 0.193
NP_442998.1_10 Reverse -290 -297 15.5754 0.0102
NP_440299.1_1 Forward -301 -288 10.3434 0.0573
NP_440299.1_1 Reverse -227 -240 3.16532 0.256
NP_440299.1_6 Forward -367 -348 11.6025 0.201
NP_441799.1_1 Reverse -284 -298 4.52221 0.247
NP_442283.1_5 Forward -68 -49 17.2074 0.217
NP_442158.1_4 Reverse -276 -286 11.4848 0.271
NP_441296.1_9 Reverse -384 -397 13.49 0.214
NP_442866.1_1 Reverse -283 -302 -1.57384 0.204
NP_442386.1_9 Reverse -287 -296 7.07914 0.219
NP_441340.1_5 Forward -296 -289 6.13563 0.175
NP_441340.1_5 Reverse -289 -296 5.93897 0.198
NP_442240.1_2 Reverse -248 -267 -10.522 0.137
NP_440586.1_8 Forward -296 -289 11.4451 0.0645
NP_442251.1_6 Reverse -289 -296 12.0355 0.0627
NP_442251.1_6 Reverse -358 -365 7.11894 0.274
NP_440684.1_9 Forward -303 -289 7.47274 0.263
NP_441262.1_3 Forward -297 -290 14.7888 0.0223
NP_443051.1_1 Forward -298 -289 0.786375 0.125
NP_441657.1_5 Forward -260 -241 0.884433 0.205
NP_441595.1_2 Forward -84 -71 11.4253 0.277
NP_440372.1_2 Forward -296 -289 6.72562 0.0929
NP_440372.1_2 Reverse -289 -296 6.62729 0.151
NP_440574.1_3 Reverse -283 -302 2.65439 0.173
NP_442663.1_1 Forward -49 -30 8.4551 0.193
NP_439977.1_5 Reverse -282 -301 2.45773 0.173
NP_442384.1_10 Reverse -288 -301 6.1158 0.11
NP_442114.1_4 Forward -297 -286 9.00679 0.176
NP_441689.1_5 Forward -299 -289 5.68278 0.215
NP_440163.1_10 Forward -300 -290 11.3864 0.169
NP_440344.1_10 Reverse -281 -298 -11.1709 0.205
NP_441965.1_10 Reverse -244 -260 7.13836 0.155
NP_440297.1_9 Reverse -289 -299 -0.41329 0.283
NP_441103.1_9 Reverse -386 -396 14.1497 0.23
NP_441103.1_9 Reverse -317 -327 14.1497 0.23
NP_440894.1_10 Reverse -283 -302 11.2092 0.148
NP_440999.1_9 Reverse -284 -298 9.2427 0.0667
NP_440888.1_2 Reverse -288 -302 9.43874 0.127
NP_442892.1_9 Forward -317 -303 13.372 0.295
NP_440491.1_1 Reverse -285 -304 13.0568 0.133
NP_440575.1_8 Reverse -168 -187 -2.26216 0.228
NP_441543.1_2 Reverse -289 -298 7.17789 0.131
NP_441543.1_2 Forward -296 -287 5.99792 0.159
NP_442845.1_2 Forward -303 -289 7.07942 0.199
NP_441319.1_2 Reverse -131 -150 11.2084 0.3
NP_443064.1_6 Reverse -357 -367 8.97947 0.254
NP_443064.1_6 Reverse -288 -298 8.6886 0.276
NP_442578.1_7 Forward -296 -289 5.93897 0.183
NP_440148.1_1 Forward -51 -32 3.44104 0.186
NP_441462.1_2 Forward -297 -287 1.16001 0.0976
NP_443062.1_6 Forward -305 -286 5.40766 0.204
NP_442204.1_1 Forward -301 -290 0.353664 0.281
NP_440516.1_8 Forward -297 -288 8.1612 0.0417
NP_441785.1_1 Reverse -219 -233 12.1566 0.266
NP_442428.1_5 Reverse -289 -296 6.13563 0.209
NP_442428.1_5 Forward -296 -289 6.0373 0.212
NP_441867.1_2 Forward -258 -239 -11.7019 0.231
NP_440673.1_3 Reverse -290 -297 12.4288 0.0426
NP_441714.1_3 Reverse -281 -299 13.1947 0.248
NP_441052.1_2 Reverse -288 -298 1.74999 0.229
NP_442219.1_8 Reverse -284 -303 19.8597 0.0434
NP_442219.1_9 Reverse -289 -298 8.06287 0.0696
NP_440436.1_4 Reverse -289 -298 13.9623 0.0193
NP_440436.1_4 Forward -296 -287 13.6673 0.0225
NP_440436.1_4 Reverse -178 -187 8.35743 0.109
NP_441884.1_9 Forward -300 -281 -21.7317 0.261
NP_441719.1_4 Forward -296 -289 6.72562 0.093
NP_441719.1_4 Reverse -289 -296 6.62729 0.151
NP_442366.1_3 Reverse -287 -305 15.1621 0.021
NP_442694.1_4 Forward -213 -204 15.536 0.164
NP_440328.1_4 Forward -303 -284 3.04771 0.186
NP_442430.1_6 Reverse -83 -102 15.1424 0.271
NP_441851.1_3 Forward -344 -325 8.65258 0.299
NP_441851.1_10 Forward -298 -288 7.25653 0.144
NP_441668.1_4 Forward -313 -294 3.44104 0.187
NP_441683.1_7 Forward -67 -48 -4.03212 0.244
NP_441982.1_6 Reverse -299 -308 12.6763 0.274
NP_442689.1_8 Reverse -265 -282 -2.02611 0.227
NP_442689.1_8 Forward -96 -79 -8.0243 0.292
NP_440431.1_3 Forward -295 -276 -9.93197 0.264
NP_440588.1_2 Forward -306 -287 -3.14714 0.179
NP_440588.1_2 Forward -168 -149 -6.58872 0.285
NP_440040.1_8 Reverse -75 -94 8.45061 0.203
NP_442243.1_1 Forward -294 -276 -2.43985 0.292
NP_441570.1_1 Forward -303 -285 -8.83064 0.122
NP_440078.1_5 Reverse -335 -354 13.5691 0.076
NP_441078.1_4 Reverse -288 -297 0.196389 0.205
NP_441078.1_4 Forward -297 -288 -0.000272808 0.205
NP_442388.1_3 Forward -300 -281 5.11266 0.282
NP_442348.1_2 Forward -214 -205 7.47288 0.28
NP_440526.1_3 Reverse -289 -300 7.33466 0.153
NP_441432.1_8 Forward -298 -289 7.17789 0.102
NP_441432.1_8 Forward -187 -178 5.60459 0.147
NP_441432.1_8 Forward -304 -295 5.21127 0.185
NP_442320.1_8 Forward -303 -289 2.45787 0.0775
NP_441732.1_2 Forward -301 -285 -16.3627 0.165
NP_440199.1_10 Forward -300 -290 16.7946 0.0381
NP_440199.1_10 Forward -369 -359 7.74818 0.231
NP_442178.1_8 Forward -217 -199 15.7521 0.228
NP_442400.1_10 Reverse -328 -341 14.5765 0.173
NP_442489.1_7 Reverse -288 -297 0.884706 0.145
NP_442489.1_7 Forward -297 -288 0.491382 0.178
NP_440565.1_7 Reverse -146 -165 -1.57384 0.284
NP_440559.1_1 Reverse -289 -298 14.1594 0.0317
NP_441659.2_8 Reverse -288 -298 6.37155 0.0774
NP_440336.1_1 Reverse -73 -92 17.8957 0.204
NP_442346.1_5 Forward -298 -288 14.828 0.00967
NP_442346.1_5 Forward -367 -357 7.64985 0.162
NP_442346.1_5 Reverse -284 -294 4.60159 0.281
NP_440352.1_5 Reverse -290 -309 14.2131 0.16
NP_440545.1_3 Reverse -243 -260 -2.41943 0.184
NP_441856.1_3 Forward -231 -212 5.30933 0.132
NP_441856.1_3 Reverse -244 -263 -3.14714 0.278
NP_441786.1_3 Forward -328 -309 6.4893 0.29
NP_440250.1_4 Forward -99 -80 4.71854 0.253
NP_440459.1_2 Reverse -286 -303 11.1502 0.181
NP_440010.1_4 Reverse -24 -43 0.0970122 0.25
NP_442900.1_1 Forward -336 -317 7.57094 0.078
NP_442875.1_2 Forward -218 -199 17.109 0.0858
NP_441833.1_4 Reverse -289 -296 14.1004 0.0258
NP_441833.1_4 Forward -296 -289 6.13563 0.198
NP_442799.1_2 Forward -305 -286 0.884433 0.266
NP_441329.1_1 Forward -93 -74 6.06331 0.265
NP_442162.1_8 Reverse -282 -301 -2.85214 0.291
NP_442162.1_9 Reverse -289 -296 6.62729 0.142
NP_442162.1_9 Forward -296 -289 6.52896 0.178
NP_440671.1_4 Forward -303 -289 9.34103 0.184
NP_442045.1_5 Forward -306 -287 8.25926 0.182
NP_440204.1_5 Forward -108 -89 13.8918 0.23
NP_442140.1_3 Forward -296 -286 15.713 0.0367
NP_441671.1_10 Forward -399 -380 4.03102 0.219
NP_441813.1_5 Forward -299 -289 6.07655 0.104
NP_441813.1_5 Reverse -286 -296 -0.314959 0.239
NP_440594.1_3 Reverse -288 -306 14.3755 0.236
NP_440594.1_8 Forward -296 -283 9.36014 0.186
NP_440590.1_4 Reverse -289 -302 9.55739 0.0347
NP_440590.1_4 Forward -296 -283 -4.60227 0.263
NP_440567.1_1 Reverse -289 -303 2.2612 0.179
NP_440567.1_1 Forward -296 -282 1.17956 0.214
NP_442497.1_10 Reverse -289 -298 0.688044 0.141
NP_440821.1_4 Forward -299 -289 8.4365 0.0503
NP_440821.1_4 Reverse -286 -296 0.275027 0.19
NP_441239.1_9 Reverse -286 -298 5.25052 0.223
NP_442044.1_1 Forward -393 -374 -8.16202 0.244
NP_440219.1_1 Forward -94 -75 14.2738 0.216
NP_441017.1_6 Forward -301 -287 13.6669 0.179
NP_440833.1_6 Reverse -339 -353 13.8636 0.157
NP_442138.1_5 Forward -195 -176 10.1275 0.276
NP_440546.1_4 Forward -297 -287 11.5004 0.0806
NP_440546.1_6 Forward -59 -40 10.2259 0.247
NP_440462.1_6 Reverse -286 -296 7.74818 0.0699
NP_440868.1_4 Reverse -284 -296 4.36554 0.121
NP_441879.1_3 Reverse -289 -308 2.65439 0.261
NP_441249.1_8 Forward -228 -209 7.57094 0.207
NP_441848.1_4 Forward -86 -70 11.2749 0.228
NP_441084.1_6 Forward -258 -244 10.6046 0.234
NP_440696.1_3 Reverse -284 -302 5.13236 0.198
NP_442039.1_7 Reverse -297 -307 15.713 0.211
NP_442039.1_7 Reverse -281 -291 6.8632 0.292
NP_441811.1_8 Reverse -282 -296 5.80112 0.289
NP_442679.1_1 Forward -134 -115 -5.40875 0.293
NP_442696.1_2 Forward -298 -280 12.1139 0.146
NP_442837.1_3 Reverse -289 -296 6.13563 0.25
NP_442837.1_3 Forward -296 -289 5.93897 0.265
NP_440505.1_3 Forward -299 -289 15.0247 0.0149
NP_442532.1_4 Reverse -33 -51 12.0371 0.223
NP_440914.1_1 Reverse -288 -298 14.7634 0.00997
NP_440914.1_1 Forward -303 -293 11.2501 0.103
NP_441011.1_8 Forward -296 -287 8.45619 0.144
NP_442533.1_6 Reverse -247 -256 5.60459 0.137
NP_442533.1_6 Forward -297 -288 5.3096 0.145
NP_442293.1_5 Reverse -371 -390 14.6508 0.28
NP_439944.1_9 Reverse -289 -299 9.32148 0.1
NP_439944.1_9 Forward -296 -286 6.76487 0.168
NP_441527.1_4 Forward -204 -185 -10.6478 0.272
NP_441106.1_1 Reverse -287 -296 13.9627 0.0279
NP_441825.1_4 Forward -214 -204 15.8113 0.186
NP_442306.1_3 Reverse -149 -168 14.1591 0.192
NP_441286.1_1 Forward -298 -286 2.98891 0.051
NP_441286.1_1 Reverse -287 -299 -7.04085 0.3
NP_440670.1_8 Reverse -288 -297 6.98123 0.0882
NP_441784.1_3 Forward -358 -339 18.9773 0.124
NP_440513.1_8 Reverse -200 -219 17.101 0.256
NP_441808.1_8 Forward -351 -332 5.70265 0.298
NP_440907.2_4 Forward -94 -75 8.55804 0.299
NP_440907.2_8 Forward -296 -286 4.99446 0.228
NP_442264.1_2 Reverse -284 -301 9.87194 0.193
NP_441463.1_2 Forward -222 -204 4.98393 0.174
NP_441463.1_6 Forward -236 -222 10.1846 0.242
NP_441626.1_2 Forward -296 -289 6.0373 0.212
NP_441626.1_2 Reverse -289 -296 6.0373 0.212
NP_442794.1_1 Forward -307 -295 2.20226 0.299
NP_442615.1_1 Reverse -279 -297 -6.27403 0.241
NP_441836.1_2 Reverse -282 -301 7.37428 0.109
NP_440358.1_8 Forward -341 -322 -1.7705 0.288
NP_442090.1_2 Reverse -75 -94 10.3605 0.243
NP_441510.2_7 Reverse -288 -302 9.53707 0.281
NP_441720.1_2 Reverse -173 -192 7.57013 0.213
NP_441272.1_4 Forward -306 -287 14.2574 0.103
NP_440766.1_4 Forward -301 -287 11.996 0.0581
NP_440766.1_5 Reverse -298 -310 13.1943 0.224
NP_441979.1_5 Forward -303 -284 -10.9153 0.228
NP_440502.1_7 Reverse -293 -312 21.3373 0.0882
NP_440457.1_1 Forward -147 -135 4.16888 0.171
NP_440457.1_1 Forward -301 -289 -0.0593532 0.25
NP_440457.1_1 Forward -136 -124 -0.354346 0.262
NP_440213.1_5 Forward -315 -296 14.3558 0.186
NP_442680.1_5 Forward -199 -180 -1.00237 0.297
NP_442297.1_4 Forward -397 -378 13.7941 0.221
NP_441984.1_3 Reverse -284 -302 14.4738 0.136
NP_441436.1_9 Reverse -387 -397 16.2041 0.27
NP_441489.1_3 Reverse -298 -312 10.7067 0.231
NP_441489.1_3 Forward -85 -71 7.3645 0.272
NP_442582.1_8 Reverse -255 -273 5.23069 0.28
NP_442439.1_8 Forward -295 -276 6.68596 0.299
NP_440554.1_4 Forward -296 -286 6.17489 0.126
NP_441885.1_5 Reverse -288 -298 1.455 0.11
NP_441885.1_5 Forward -297 -287 0.668351 0.133
NP_442128.1_2 Forward -176 -158 7.78729 0.298
NP_442341.1_7 Reverse -287 -301 1.17956 0.297
NP_441173.1_9 Forward -307 -299 13.2937 0.17
NP_440750.1_6 Reverse -298 -317 8.73709 0.291
NP_443000.1_7 Forward -299 -289 7.25653 0.0927
NP_441842.1_1 Forward -295 -282 12.3101 0.219
NP_441842.1_10 Forward -304 -290 7.86607 0.241
NP_440275.1_3 Reverse -286 -296 6.56821 0.101
NP_440091.1_1 Reverse -284 -296 10.5604 0.0458
NP_440091.1_1 Forward -301 -289 -0.944332 0.3
NP_442275.1_1 Forward -297 -278 1.86774 0.284
NP_443010.1_10 Reverse -285 -302 5.18664 0.207
NP_442451.1_2 Forward -305 -286 -8.35868 0.246
NP_441122.1_1 Forward -308 -293 4.60145 0.28
NP_442918.1_6 Forward -55 -36 15.5553 0.223
NP_441105.1_3 Forward -191 -172 -5.80207 0.224
NP_441105.1_3 Forward -308 -289 -8.35868 0.272
NP_440216.1_1 Reverse -384 -398 -11.8001 0.219
NP_440216.1_9 Forward -286 -277 5.99792 0.289
NP_440678.1_9 Forward -393 -374 7.96426 0.281
NP_440172.1_1 Forward -303 -293 7.05986 0.0929
NP_440172.1_1 Forward -186 -176 3.12662 0.244
NP_441111.1_7 Reverse -289 -297 8.96754 0.0463
NP_441766.1_2 Forward -297 -288 8.06287 0.0691
NP_440416.1_9 Forward -304 -285 -10.4236 0.141
NP_440416.1_9 Reverse -277 -296 -17.3068 0.237
NP_443052.1_8 Reverse -278 -297 -5.11376 0.126
NP_443052.1_9 Reverse -132 -151 -7.17871 0.294
NP_442564.1_9 Forward -43 -29 13.4454 0.294
NP_440261.1_5 Forward -296 -283 -5.29059 0.19
NP_440988.1_10 Reverse -292 -306 6.15739 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCGGCAGGGGAAGGCATCTATACCTTTGCTAATGGTAATCGTTATCAAGGTCAATTTGTTGCCGGTAAGTTTGCAGGGGAAGGTGCATTTATTTTTGCCAATGGCGATCGTTGCCAAGGACAATTTAGCAATAATCAACTCCAAGGTATGGCCACCTGTGACTATGTCAATGGTGATACGTTTGAAGGGATTTTTGAACAGGGTAAGAAAAATGGCAAGGGCGTTTATTCTTTTGCTGATGGTACCCGCCTAGAAGGGGTATGGAAGGACGATCAATACCAAGAACGAGGTTAACCTTAACCCTGATTTTTTTTAATTTCAGAAAAGTTTGTCGGGAATTGTGAGGTCAAGAAATTAGCCATTATTACCCTTGTGTTCAGGTCTCCATCATCTTGATTT

CDS

ATGCTCCTTTCGCCCCAGTCTAATCGACAAGTTTTAATGGCTTATCTAAGTCCCCAGTGGGGGCAAGTGCTGGCTTTGGCGATCGCCTTGGGGGGAAGCATTATCCTACAAGTGCTTAATCCCCAGATTTTGCGCTATTTCATCGACACAGCCATGGCCGGAGGGCCCCAAACCATACTGGTGTGGCTAGCATTGGGCTTTATGGCGATCGCCGTTGTACGTCAAGGATTGGAAATCGTTGCCACCTATTGCAGTGAAACCGTTGCCTGGACTGCGACCAATAATCTCCGCTTGAACCTAGCTCGTCACACCCTCAATCTCGATCTAACTTTTCACAAAAATCATTGCCCCGGGGAACTAGTGGAACGCATTGATGGAGACGTGGACGCCCTGGCCCGCTTTTTCTCCCAATTTGTGCTCCAAGTACTGGGCAATGGCTTGCTAGTGGTGGGTGTTCTAGTCGTGTTGTGGTTCGAGCAGTGGCAGGCGGGATTGGGTTTGACTCTTTTTGCCCTAGTAGCCCTGGGTATTCTCAGCCGGTTGCAATCCTTGGCGGTGGGGCCATGGCAAGTTTACCGTGGCATCAGTGCTGATTTTTACGGTTTTATCACTGAATATTTAGCCGGATTGGAAGACATTCGGGGCAATGGAGCGGTGGACTATGTCATGAACCGCTTTTATACATTGATAAGAAACTGGCTAAGGGCGTTTCATCAAGCACGGTTGCAGAGCACCCTACTATGGGGCAGCACCGTTGGTCTATTCACGGTGGGCAATGCTATCGCCCTGGCCTTGGGCGCTTACCTGTGGCGTGTACAGGGTATCACCATTGGTACAGTCTATCTTTTGTTTTACTATGCCAGTCTTCTCCAAGATCCCATTGAACGGATACGGGAAGAACTAGAACAGTTTCAACAGGCCGTTGCCAGTCTTTATCGCATTCAAGACCTCATTCGTCAGTCTCCGTCACCCCGATTGGGCAGATCCCAAGCTTTGCCATCGGGGTCACTTTCCGTCGAAGGAAAAAATGTGTGGTTTAGTTATCCAACCACAGCGAGTTTAAAACCTGGGGACGGCAACCACGAATTACCTGAGCACCGCCAAGGTCACCACCACGAAGATGCTGATTACGCTCTGCAGAATTTAACCTGGCATCTACCCGCTGGAAAAGTGCTTGGGTTGCTGGGGCACACCGGCAGTGGCAAAAGTACATTCGCTCGACTCTTGTTGAATTTTTATGCCATTCAGCAGGGCCAAATTCAGCTTGGCGGCATCAACCTTGGGGAGATATCTCAGCGGGAGTTACATCAGCGGGTCGGTTTTGTCACCCAAGACGTGCAACTGTTCCAAACTTCCATACGCAATAATCTGACATTTTTTAATCCCCACATCCCAGACCGATTGATTTTACAAGCCCTGAACGACCTTGGGCTGGAGCCTTGGTTGGCAACATTACCCCAGGGTTTAGATACGGAACTAGGCACGGATGGGGGAGGATTATCGGCGGGGCAAGCCCAATTGCTAGCTTTTGCCAGGGTATTTCTCAAAGATCCTGGGCTAGTTATCCTCGATGAAGCTTCGTCACGGCTTGATCCTTTGACAGAACAGTTAATTGAGCGGGCTATCAATCGATTACTAGAGCATCGGACGGGAATTATCATTGCCCATCGCCTCAAGACGGTGGAACGGGCCGATCAAATTCTGATTCTAGACCGGGGCAAAGTGCTGGAATACGGCGATCGCCCAGCCCTGGCCCACAATCCTGCATCTCGTTTTTCTCAGTTACTGAGGACTAGCTCTGCGATCAAGTTAACCTAG

Protein

MLLSPQSNRQVLMAYLSPQWGQVLALAIALGGSIILQVLNPQILRYFIDTAMAGGPQTILVWLALGFMAIAVVRQGLEIVATYCSETVAWTATNNLRLNLARHTLNLDLTFHKNHCPGELVERIDGDVDALARFFSQFVLQVLGNGLLVVGVLVVLWFEQWQAGLGLTLFALVALGILSRLQSLAVGPWQVYRGISADFYGFITEYLAGLEDIRGNGAVDYVMNRFYTLIRNWLRAFHQARLQSTLLWGSTVGLFTVGNAIALALGAYLWRVQGITIGTVYLLFYYASLLQDPIERIREELEQFQQAVASLYRIQDLIRQSPSPRLGRSQALPSGSLSVEGKNVWFSYPTTASLKPGDGNHELPEHRQGHHHEDADYALQNLTWHLPAGKVLGLLGHTGSGKSTFARLLLNFYAIQQGQIQLGGINLGEISQRELHQRVGFVTQDVQLFQTSIRNNLTFFNPHIPDRLILQALNDLGLEPWLATLPQGLDTELGTDGGGLSAGQAQLLAFARVFLKDPGLVILDEASSRLDPLTEQLIERAINRLLEHRTGIIIAHRLKTVERADQILILDRGKVLEYGDRPALAHNPASRFSQLLRTSSAIKLT