Your browser is old and dusty. Try Google Chrome!

Details for slr1468

ORF slr1468
Accession NP_441560.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -190 -176 9.73436 0.0698
NP_441061.1_2 Forward -215 -201 8.94771 0.0824
NP_441061.1_2 Forward -221 -207 3.73617 0.16
NP_441061.1_2 Reverse -183 -197 -0.0987402 0.221
NP_440795.1_7 Forward -190 -183 14.6904 0.0123
NP_440795.1_7 Reverse -183 -190 14.6904 0.0123
NP_440795.1_7 Reverse -202 -209 10.2655 0.154
NP_441418.1_6 Forward -117 -98 -28.8115 0.211
NP_441418.1_6 Reverse -182 -201 -29.6965 0.234
NP_440815.1_5 Forward -191 -172 10.1275 0.225
NP_441480.1_1 Reverse -222 -241 0.392778 0.287
NP_442291.1_5 Reverse -181 -197 -1.80975 0.202
NP_441453.1_4 Reverse -182 -190 16.539 0.00633
NP_441453.1_4 Forward -191 -183 16.539 0.00633
NP_441453.1_7 Reverse -126 -133 11.9372 0.298
NP_442151.1_6 Forward -191 -177 13.9626 0.0421
NP_442151.1_6 Forward -216 -202 9.14437 0.157
NP_442151.1_6 Reverse -182 -196 8.75105 0.164
NP_442151.1_6 Forward -210 -196 6.3911 0.236
NP_442151.1_6 Reverse -201 -215 5.40779 0.278
NP_440226.1_1 Reverse -182 -201 12.2908 0.0456
NP_440226.1_1 Forward -191 -172 3.04771 0.241
NP_442169.1_1 Reverse -218 -237 1.37609 0.261
NP_442744.1_8 Reverse -206 -225 -6.88371 0.297
NP_442173.1_1 Forward -190 -182 15.4574 0.00633
NP_442173.1_1 Reverse -183 -191 15.4574 0.00633
NP_442752.1_4 Forward -191 -184 13.8055 0.0199
NP_442752.1_4 Reverse -182 -189 13.8055 0.0199
NP_442975.1_10 Forward -195 -181 1.37564 0.299
NP_440784.1_7 Forward -190 -183 15.9687 0.0123
NP_440784.1_7 Reverse -183 -190 15.9687 0.0123
NP_442909.1_7 Reverse -183 -197 9.93039 0.14
NP_440061.1_9 Reverse -94 -108 13.1753 0.0839
NP_440061.1_9 Forward -193 -179 10.8154 0.122
NP_440061.1_9 Reverse -180 -194 9.53707 0.143
NP_440061.1_9 Forward -218 -204 6.29216 0.251
NP_441054.1_1 Forward -106 -92 17.9942 0.129
NP_441054.1_4 Reverse -191 -209 -0.472507 0.185
NP_441476.1_5 Reverse -202 -221 6.4893 0.132
NP_441476.1_5 Reverse -85 -104 -4.03212 0.245
NP_441499.1_3 Reverse -166 -176 17.9741 0.28
NP_442062.1_8 Forward -191 -181 17.3846 0.00193
NP_442062.1_8 Reverse -182 -192 17.3846 0.00193
NP_441802.1_1 Forward -132 -113 5.40766 0.286
NP_440304.1_4 Forward -193 -183 1.84832 0.299
NP_440304.1_4 Reverse -180 -190 1.84832 0.299
NP_442242.1_4 Forward -190 -183 14.3954 0.0124
NP_442242.1_4 Reverse -183 -190 14.3954 0.0124
NP_440044.1_8 Reverse -97 -116 2.94938 0.142
NP_440044.1_8 Reverse -183 -202 -2.65548 0.265
NP_439918.1_2 Reverse -131 -150 -0.197208 0.227
NP_441200.1_4 Forward -134 -115 15.1424 0.156
NP_441619.1_8 Forward -197 -183 15.3386 0.0847
NP_441594.1_6 Reverse -198 -217 11.5042 0.116
NP_441594.1_6 Forward -225 -206 7.66927 0.17
NP_441594.1_6 Forward -108 -89 5.70265 0.209
NP_441594.1_6 Reverse -93 -112 4.12936 0.222
NP_441594.1_6 Reverse -204 -223 -0.000545616 0.294
NP_442196.1_10 Forward -65 -46 11.3075 0.225
NP_442110.1_7 Forward -191 -177 0.589577 0.256
NP_440856.1_7 Forward -96 -77 -2.85214 0.192
NP_441083.1_3 Forward -106 -96 17.1874 0.0864
NP_441083.1_5 Forward -191 -181 20.3345 0.00053
NP_441083.1_5 Reverse -182 -192 20.3345 0.00053
NP_442827.1_8 Reverse -222 -241 1.57197 0.176
NP_441738.1_2 Forward -189 -182 15.28 0.0102
NP_441738.1_2 Reverse -184 -191 15.28 0.0102
NP_441558.1_5 Reverse -94 -113 8.45592 0.15
NP_441558.1_5 Forward -212 -193 5.30933 0.254
NP_440209.1_1 Reverse -182 -190 18.1123 0.00295
NP_440209.1_1 Forward -191 -183 18.1123 0.00295
NP_440209.1_5 Forward -190 -172 16.6371 0.0924
NP_442889.1_1 Forward -222 -203 -12.3902 0.227
NP_442889.1_8 Forward -194 -180 11.4053 0.0733
NP_442889.1_8 Reverse -179 -193 3.53891 0.275
NP_441713.1_1 Reverse -176 -195 -16.6185 0.285
NP_440178.1_7 Forward -192 -173 -12.3902 0.121
NP_442570.1_3 Forward -193 -174 -9.34199 0.298
NP_441716.1_1 Forward -216 -202 6.48943 0.198
NP_442111.1_4 Forward -192 -178 2.75286 0.266
NP_442111.1_4 Reverse -181 -195 1.76955 0.294
NP_440906.1_5 Forward -190 -183 15.8704 0.0124
NP_440906.1_5 Reverse -183 -190 15.8704 0.0124
NP_440747.1_10 Reverse -179 -191 24.7201 0.00036
NP_440747.1_10 Forward -194 -182 14.887 0.00223
NP_440747.1_10 Forward -219 -207 -2.91095 0.0732
NP_440747.1_10 Forward -213 -201 -11.9574 0.178
NP_440322.1_4 Reverse -300 -319 8.06259 0.259
NP_441486.1_1 Forward -194 -180 15.1426 0.0061
NP_441486.1_1 Reverse -179 -193 15.1426 0.0061
NP_441486.1_10 Forward -171 -154 17.1906 0.167
NP_442634.1_4 Reverse -199 -213 -5.11362 0.235
NP_440403.1_10 Forward -191 -172 1.17943 0.291
NP_441014.1_5 Reverse -127 -145 9.45892 0.276
NP_441014.1_8 Forward -61 -42 -5.70374 0.274
NP_441014.1_10 Forward -192 -173 0.686995 0.239
NP_442848.1_1 Forward -197 -183 -0.885388 0.263
NP_442848.1_5 Reverse -95 -113 6.214 0.232
NP_441012.1_4 Reverse -98 -111 8.86907 0.272
NP_441012.1_4 Forward -103 -90 6.31247 0.282
NP_443018.1_3 Forward -190 -183 14.8871 0.0123
NP_443018.1_3 Reverse -183 -190 14.8871 0.0123
NP_443018.1_3 Reverse -202 -209 4.36568 0.254
NP_443018.1_3 Forward -209 -202 4.07068 0.299
NP_441634.1_8 Reverse -94 -108 2.2612 0.169
NP_441634.1_8 Forward -212 -198 -0.393733 0.255
NP_441634.1_8 Forward -218 -204 -4.03198 0.295
NP_440376.1_1 Forward -191 -182 19.4693 0.000692
NP_440376.1_1 Reverse -182 -191 19.4693 0.000692
NP_440376.1_1 Reverse -96 -105 4.12963 0.173
NP_440376.1_1 Reverse -230 -239 0.786375 0.26
NP_441588.1_4 Reverse -184 -194 15.9097 0.0369
NP_441588.1_4 Forward -189 -179 9.02648 0.14
NP_442687.1_7 Forward -192 -182 8.92815 0.0994
NP_442687.1_7 Reverse -181 -191 8.92815 0.0994
NP_441846.1_10 Forward -116 -97 -12.5869 0.191
NP_441013.1_3 Forward -117 -98 7.57094 0.266
NP_441422.1_7 Forward -218 -201 -5.76269 0.247
NP_440887.1_6 Reverse -27 -46 16.4207 0.169
NP_440360.1_5 Forward -216 -197 -5.9004 0.297
NP_442658.1_1 Reverse -180 -190 6.76441 0.214
NP_442658.1_1 Forward -193 -183 6.76441 0.214
NP_442782.1_2 Reverse -304 -318 7.9644 0.202
NP_442782.1_2 Forward -117 -103 3.8345 0.261
NP_441414.1_9 Forward -191 -172 10.2259 0.0213
NP_441414.1_9 Reverse -182 -201 6.09597 0.0424
NP_442937.1_5 Forward -110 -91 16.5191 0.042
NP_442937.1_5 Forward -221 -202 14.7491 0.0731
NP_442937.1_5 Forward -104 -85 13.2741 0.095
NP_442937.1_5 Forward -196 -177 11.3075 0.141
NP_442937.1_5 Reverse -202 -221 10.4225 0.161
NP_442937.1_5 Reverse -177 -196 6.58763 0.275
NP_441958.1_5 Forward -192 -182 12.2714 0.00183
NP_441958.1_5 Reverse -181 -191 12.2714 0.00183
NP_442836.1_5 Reverse -195 -214 0.786102 0.295
NP_442836.1_10 Reverse -268 -278 12.6647 0.24
NP_440203.1_5 Forward -213 -203 12.6642 0.141
NP_440203.1_5 Forward -188 -178 11.8776 0.171
NP_440203.1_5 Reverse -209 -219 9.91099 0.245
NP_439905.1_1 Forward -238 -225 12.704 0.183
NP_439905.1_1 Forward -215 -202 6.1158 0.299
NP_440984.1_7 Forward -196 -182 11.0127 0.122
NP_440984.1_7 Reverse -177 -191 9.04604 0.131
NP_441097.1_2 Reverse -221 -238 4.56207 0.278
NP_439990.1_5 Reverse -177 -190 7.98409 0.183
NP_439990.1_5 Forward -221 -208 7.78743 0.186
NP_439990.1_5 Forward -196 -183 7.6891 0.186
NP_439990.1_5 Reverse -196 -209 5.91914 0.267
NP_442376.1_2 Reverse -220 -239 -6.09707 0.286
NP_442911.1_2 Reverse -172 -191 -2.0655 0.0939
NP_442911.1_2 Forward -201 -182 -3.44213 0.112
NP_440153.1_8 Reverse -96 -109 7.29578 0.166
NP_440153.1_8 Forward -210 -197 -1.94734 0.23
NP_443055.1_6 Forward -239 -221 2.77167 0.203
NP_440138.1_6 Reverse -202 -221 5.80018 0.227
NP_443044.1_1 Forward -162 -143 8.75091 0.233
NP_441348.1_3 Reverse -252 -271 8.45592 0.24
NP_441099.1_5 Reverse -172 -191 -3.24547 0.131
NP_441646.1_1 Reverse -200 -219 8.75091 0.14
NP_441646.1_1 Reverse -236 -255 1.17943 0.235
NP_441646.1_1 Forward -106 -87 -1.57384 0.291
NP_442438.1_10 Forward -116 -102 15.2409 0.0274
NP_442438.1_10 Reverse -202 -216 4.03116 0.152
NP_442438.1_10 Reverse -177 -191 3.34284 0.163
NP_440147.1_4 Forward -193 -180 11.4257 0.0326
NP_440147.1_4 Reverse -180 -193 11.4257 0.0326
NP_441175.1_7 Forward -191 -172 8.35759 0.21
NP_441550.1_8 Reverse -180 -190 14.6309 0.0132
NP_441550.1_8 Forward -193 -183 14.6309 0.0132
NP_441916.1_7 Forward -191 -181 10.3048 0.0261
NP_441916.1_7 Reverse -182 -192 10.3048 0.0261
NP_440206.1_4 Forward -226 -207 0.195343 0.289
NP_441041.1_4 Forward -191 -172 17.0107 0.0107
NP_441041.1_4 Forward -111 -92 -1.37718 0.1
NP_441041.1_4 Reverse -201 -220 -5.01543 0.146
NP_441041.1_4 Reverse -195 -214 -9.14533 0.213
NP_441041.1_7 Reverse -179 -191 8.58373 0.133
NP_442396.1_5 Forward -195 -182 21.1604 0.00421
NP_442396.1_5 Reverse -178 -191 11.6223 0.0913
NP_442004.1_6 Forward -191 -177 14.2576 0.078
NP_441725.1_5 Forward -190 -180 2.04498 0.115
NP_441725.1_5 Reverse -183 -193 2.04498 0.115
NP_439966.1_7 Reverse -180 -190 7.25606 0.15
NP_439966.1_7 Forward -193 -183 7.25606 0.15
NP_442941.1_3 Forward -190 -180 11.0914 0.0116
NP_442941.1_3 Reverse -183 -193 11.0914 0.0116
NP_440289.1_2 Forward -194 -181 -4.9956 0.294
NP_440289.1_2 Reverse -179 -192 -4.9956 0.294
NP_440983.1_5 Reverse -90 -109 -5.70374 0.27
NP_440983.1_5 Forward -216 -197 -8.55534 0.295
NP_440260.1_8 Forward -225 -207 10.0489 0.151
NP_440260.1_8 Reverse -173 -191 -2.63579 0.245
NP_442281.1_1 Reverse -177 -191 15.7319 0.011
NP_442281.1_1 Forward -196 -182 8.94708 0.0747
NP_440177.1_9 Forward -199 -180 12.0942 0.238
NP_442256.1_2 Forward -193 -175 -7.65067 0.214
NP_442012.1_1 Reverse -176 -195 -1.37718 0.286
NP_442012.1_5 Reverse -200 -219 -0.000545616 0.288
NP_441556.1_10 Reverse -177 -191 14.602 0.164
NP_440498.1_1 Reverse -173 -191 -1.84914 0.232
NP_440375.1_8 Forward -190 -171 6.88262 0.166
NP_441644.1_6 Forward -191 -181 17.3841 0.00127
NP_441644.1_6 Reverse -182 -192 17.3841 0.00127
NP_441644.1_6 Forward -105 -95 11.2876 0.0524
NP_441644.1_6 Reverse -201 -211 10.5993 0.0628
NP_441644.1_6 Forward -239 -229 5.09279 0.21
NP_441644.1_6 Reverse -96 -106 4.40448 0.239
NP_441644.1_6 Reverse -207 -217 3.12618 0.297
NP_442215.1_2 Forward -193 -177 12.4482 0.0306
NP_442215.1_2 Reverse -180 -196 4.48343 0.0838
NP_442029.1_6 Reverse -252 -271 3.14605 0.283
NP_440929.1_8 Forward -191 -182 19.2726 0.000701
NP_440929.1_8 Reverse -182 -191 19.2726 0.000701
NP_440929.1_8 Forward -239 -230 2.06468 0.268
NP_442933.1_10 Forward -191 -182 17.601 0.00325
NP_442933.1_10 Reverse -182 -191 17.601 0.00325
NP_441751.2_8 Forward -190 -176 5.01447 0.0448
NP_441751.2_8 Reverse -183 -197 -3.147 0.134
NP_441751.2_8 Reverse -202 -216 -5.40861 0.206
NP_442554.1_8 Forward -190 -180 15.3197 0.00882
NP_442554.1_8 Reverse -183 -193 15.3197 0.00882
NP_442554.1_8 Forward -209 -199 7.45319 0.092
NP_442554.1_8 Reverse -97 -107 6.37155 0.12
NP_442554.1_8 Forward -104 -94 4.3066 0.189
NP_442554.1_8 Reverse -231 -241 4.0116 0.2
NP_442554.1_8 Reverse -202 -212 2.04498 0.285
NP_441762.1_7 Forward -192 -180 0.432302 0.0747
NP_441762.1_7 Reverse -181 -193 0.432302 0.0747
NP_442142.1_4 Reverse -210 -223 14.375 0.0311
NP_442142.1_4 Reverse -179 -192 12.2117 0.0464
NP_442142.1_4 Forward -194 -181 2.96866 0.269
NP_442292.1_1 Forward -190 -181 18.486 0.00229
NP_442292.1_1 Reverse -183 -192 18.486 0.00229
NP_442292.1_1 Forward -209 -200 5.99792 0.125
NP_441024.1_7 Reverse -170 -188 17.4229 0.0992
NP_442476.1_6 Reverse -183 -197 8.16106 0.105
NP_442476.1_6 Forward -190 -176 2.2612 0.188
NP_440895.1_6 Reverse -176 -189 11.7207 0.202
NP_443009.1_2 Forward -208 -189 3.73603 0.216
NP_443009.1_5 Reverse -181 -192 8.90795 0.0965
NP_443009.1_5 Forward -192 -181 8.90795 0.0965
NP_441726.1_7 Forward -20 -1 17.699 0.0542
NP_441715.1_4 Reverse -183 -193 7.94484 0.107
NP_441715.1_4 Forward -190 -180 7.94484 0.107
NP_440357.1_3 Forward -193 -174 -0.983855 0.296
NP_440183.1_9 Reverse -215 -234 -13.8652 0.26
NP_440464.1_10 Forward -190 -180 13.0082 0.169
NP_440464.1_10 Reverse -183 -193 13.0082 0.169
NP_440464.1_10 Forward -385 -375 11.7668 0.282
NP_441468.1_1 Forward -190 -183 15.8704 0.0124
NP_441468.1_1 Reverse -183 -190 15.8704 0.0124
NP_441468.1_1 Reverse -202 -209 4.46401 0.224
NP_440920.1_1 Reverse -89 -108 7.86593 0.176
NP_441020.2_6 Forward -193 -176 9.97027 0.156
NP_441020.2_6 Reverse -180 -197 5.64371 0.293
NP_441015.1_8 Forward -141 -122 2.0644 0.272
NP_441015.1_10 Forward -110 -91 4.42435 0.125
NP_441015.1_10 Reverse -202 -221 0.687771 0.165
NP_441015.1_10 Forward -221 -202 -7.08038 0.262
NP_441015.1_10 Reverse -177 -196 -8.26035 0.272
NP_441015.1_10 Reverse -208 -227 -10.522 0.284
NP_441673.1_1 Forward -191 -182 20.8459 0.000698
NP_441673.1_1 Reverse -182 -191 20.8459 0.000698
NP_441673.1_1 Reverse -201 -210 -8.06341 0.254
NP_441339.1_4 Forward -112 -93 -4.72043 0.259
NP_442253.1_5 Forward -219 -202 -0.649475 0.227
NP_440265.1_7 Forward -203 -189 15.9285 0.195
NP_441826.1_2 Forward -222 -208 1.96621 0.137
NP_441826.1_2 Forward -105 -91 -3.83532 0.288
NP_442868.1_6 Forward -193 -183 9.81313 0.038
NP_442868.1_6 Reverse -180 -190 9.81313 0.038
NP_442719.1_2 Forward -323 -305 -10.6013 0.278
NP_442719.1_2 Reverse -282 -300 -11.7812 0.296
NP_441612.1_2 Reverse -182 -192 8.54929 0.21
NP_441612.1_2 Forward -191 -181 8.54929 0.21
NP_442427.1_8 Forward -200 -181 10.4225 0.165
NP_442808.1_1 Reverse -181 -191 8.63269 0.0481
NP_442808.1_1 Forward -192 -182 8.63269 0.0481
NP_442808.1_1 Forward -279 -269 1.35624 0.287
NP_440145.1_3 Reverse -172 -191 0.392778 0.136
NP_442050.1_1 Forward -118 -99 17.699 0.171
NP_442050.1_5 Forward -193 -183 7.64939 0.243
NP_442050.1_5 Reverse -180 -190 7.64939 0.243
NP_440346.1_6 Forward -362 -352 14.1473 0.273
NP_441114.1_3 Reverse -208 -217 7.66954 0.231
NP_440558.1_2 Forward -219 -200 10.7175 0.0935
NP_440558.1_2 Forward -225 -206 1.86774 0.175
NP_440558.1_2 Forward -108 -89 -3.73712 0.238
NP_440558.1_2 Reverse -204 -223 -5.80207 0.264
NP_440558.1_2 Reverse -93 -112 -5.99873 0.269
NP_440558.1_2 Reverse -173 -192 -7.4737 0.294
NP_441878.1_6 Forward -192 -182 10.4031 0.0176
NP_441878.1_6 Reverse -181 -191 10.4031 0.0176
NP_441878.1_6 Forward -106 -96 1.55333 0.0937
NP_441878.1_6 Reverse -95 -105 0.865012 0.132
NP_441878.1_6 Forward -223 -213 -0.118297 0.167
NP_441878.1_6 Reverse -200 -210 -7.19813 0.21
NP_441878.1_6 Reverse -206 -216 -7.49312 0.231
NP_441036.1_8 Forward -192 -182 8.33817 0.174
NP_441036.1_8 Reverse -181 -191 8.33817 0.174
NP_442650.1_2 Forward -191 -177 8.25939 0.13
NP_442650.1_2 Reverse -201 -215 4.71948 0.163
NP_441557.1_5 Forward -191 -182 19.9609 0.000699
NP_441557.1_5 Reverse -182 -191 19.9609 0.000699
NP_441520.1_8 Forward -219 -200 10.6192 0.238
NP_441445.1_1 Forward -114 -95 12.4875 0.068
NP_441445.1_1 Reverse -173 -192 10.3242 0.0963
NP_441445.1_1 Forward -200 -181 1.76941 0.247
NP_441445.1_1 Forward -225 -206 0.884433 0.266
NP_441445.1_1 Reverse -87 -106 0.491109 0.275
NP_442066.2_9 Forward -195 -182 11.1307 0.154
NP_440101.1_3 Reverse -202 -221 6.4893 0.181
NP_441458.1_10 Forward -200 -181 11.6025 0.108
NP_441458.1_10 Reverse -173 -192 7.47261 0.196
NP_442183.1_1 Reverse -182 -196 11.5043 0.0702
NP_442183.1_1 Forward -191 -177 6.6861 0.164
NP_441574.1_1 Forward -111 -92 5.11266 0.127
NP_441549.1_9 Forward -384 -366 -10.2073 0.273
NP_441549.1_9 Reverse -92 -110 -10.7973 0.288
NP_442347.1_2 Forward -190 -181 12.4878 0.056
NP_442347.1_2 Reverse -183 -192 12.4878 0.056
NP_442645.1_2 Reverse -174 -193 -3.73712 0.0505
NP_442645.1_2 Forward -199 -180 -12.9802 0.144
NP_442888.1_6 Reverse -190 -209 1.86774 0.275
NP_442888.1_9 Reverse -90 -109 13.8641 0.235
NP_441037.1_4 Forward -193 -183 7.9999 0.237
NP_441037.1_4 Reverse -180 -190 7.9999 0.237
NP_442047.1_2 Forward -396 -382 11.7993 0.297
NP_441633.1_3 Forward -193 -180 1.19926 0.109
NP_441633.1_3 Reverse -180 -193 1.19926 0.109
NP_440136.1_2 Forward -190 -183 15.9687 0.0123
NP_440136.1_2 Reverse -183 -190 15.9687 0.0123
NP_442998.1_10 Forward -189 -182 15.5754 0.0102
NP_442998.1_10 Reverse -184 -191 15.5754 0.0102
NP_440299.1_1 Forward -195 -182 12.9984 0.0319
NP_440299.1_1 Reverse -98 -111 12.7034 0.0356
NP_440299.1_1 Reverse -178 -191 12.605 0.0362
NP_440299.1_1 Forward -103 -90 7.2952 0.116
NP_440299.1_1 Forward -214 -201 6.41022 0.143
NP_441799.1_1 Reverse -178 -192 17.6985 0.0109
NP_441799.1_1 Forward -195 -181 15.8302 0.0163
NP_441799.1_4 Forward -215 -196 3.73603 0.119
NP_440640.1_6 Reverse -189 -208 15.6341 0.11
NP_441007.1_10 Reverse -196 -209 11.0324 0.0646
NP_441007.1_10 Reverse -177 -190 10.8357 0.0646
NP_441007.1_10 Forward -196 -183 8.27909 0.115
NP_441007.1_10 Reverse -225 -238 0.412608 0.23
NP_441007.1_10 Forward -110 -97 -0.275709 0.273
NP_442334.1_2 Forward -118 -101 -4.68105 0.2
NP_440256.1_1 Reverse -179 -198 -2.45882 0.118
NP_440256.1_1 Reverse -210 -229 -8.94866 0.27
NP_441957.1_1 Reverse -259 -278 7.27595 0.206
NP_440915.1_1 Forward -347 -329 17.8171 0.199
NP_442785.1_8 Forward -313 -295 17.4237 0.269
NP_441704.1_8 Reverse -171 -190 7.07848 0.249
NP_440695.1_5 Forward -191 -172 -0.787193 0.284
NP_440695.1_5 Forward -111 -92 -2.16383 0.296
NP_441199.1_6 Reverse -95 -114 -0.885524 0.283
NP_442993.1_1 Reverse -102 -118 -9.28291 0.181
NP_442993.1_1 Reverse -230 -246 -13.4128 0.291
NP_442386.1_9 Reverse -181 -190 13.8639 0.0289
NP_442386.1_9 Forward -192 -183 13.8639 0.0289
NP_441340.1_5 Forward -190 -183 15.6737 0.0124
NP_441340.1_5 Reverse -183 -190 15.6737 0.0124
NP_441340.1_5 Forward -209 -202 3.97235 0.274
NP_442484.1_2 Forward -202 -183 3.34271 0.21
NP_440059.1_3 Reverse -48 -67 6.58682 0.266
NP_440586.1_8 Forward -190 -183 13.2151 0.026
NP_440586.1_8 Reverse -183 -190 13.2151 0.026
NP_440586.1_8 Forward -98 -91 7.51192 0.239
NP_442251.1_6 Forward -190 -183 15.2804 0.0124
NP_442251.1_6 Reverse -183 -190 15.2804 0.0124
NP_440192.1_5 Reverse -200 -219 3.6377 0.271
NP_442959.1_1 Reverse -210 -229 6.88262 0.274
NP_440684.1_9 Forward -197 -183 12.6843 0.168
NP_440684.1_9 Reverse -176 -190 7.07942 0.28
NP_441262.1_3 Reverse -182 -189 14.7888 0.0223
NP_441262.1_3 Forward -191 -184 14.7888 0.0223
NP_440027.1_3 Reverse -207 -225 10.2448 0.175
NP_440027.1_3 Reverse -96 -114 6.01657 0.23
NP_443051.1_1 Reverse -181 -190 10.4228 0.00754
NP_443051.1_1 Forward -192 -183 10.4228 0.00754
NP_439996.1_1 Forward -191 -172 10.5209 0.234
NP_439984.1_3 Forward -198 -184 13.8636 0.216
NP_439937.1_8 Forward -119 -100 3.34271 0.204
NP_439937.1_8 Reverse -199 -218 3.04771 0.207
NP_440408.1_7 Reverse -201 -220 10.2259 0.251
NP_439943.1_4 Reverse -353 -372 4.52268 0.287
NP_440372.1_2 Forward -190 -183 16.3621 0.0124
NP_440372.1_2 Reverse -183 -190 16.3621 0.0124
NP_441803.1_2 Forward -104 -85 10.8159 0.0809
NP_441803.1_2 Forward -215 -196 4.03102 0.182
NP_441803.1_2 Reverse -97 -116 3.53937 0.191
NP_441803.1_2 Reverse -78 -97 3.04771 0.197
NP_442384.1_10 Reverse -182 -195 15.8506 0.00946
NP_442384.1_10 Forward -191 -178 15.5556 0.00986
NP_442384.1_10 Reverse -207 -220 7.09911 0.0875
NP_442384.1_10 Reverse -90 -103 5.52582 0.127
NP_441877.1_9 Reverse -147 -164 1.90713 0.292
NP_441018.1_7 Reverse -203 -222 11.9958 0.173
NP_441018.1_7 Reverse -197 -216 9.73422 0.218
NP_442790.1_4 Forward -200 -181 -2.75381 0.119
NP_442262.1_10 Forward -190 -183 14.1988 0.0123
NP_442262.1_10 Reverse -183 -190 14.1988 0.0123
NP_441689.1_5 Forward -193 -183 5.78111 0.197
NP_441689.1_5 Reverse -180 -190 5.78111 0.197
NP_440344.1_10 Forward -198 -181 -9.40093 0.146
NP_440344.1_10 Reverse -175 -192 -9.89259 0.16
NP_440282.1_10 Forward -220 -201 -7.08038 0.251
NP_440531.1_6 Reverse -174 -193 4.916 0.119
NP_440531.1_6 Forward -199 -180 1.57275 0.173
NP_442917.1_6 Reverse -361 -380 11.4058 0.108
NP_442910.1_1 Forward -74 -55 3.6377 0.118
NP_440189.1_10 Forward -294 -275 4.12936 0.279
NP_441965.1_10 Forward -194 -178 15.2998 0.0656
NP_441965.1_10 Forward -108 -92 3.59845 0.259
NP_442693.1_7 Reverse -200 -219 8.25926 0.273
NP_440297.1_9 Reverse -202 -212 -0.118297 0.282
NP_440297.1_9 Forward -190 -180 -0.118297 0.282
NP_440297.1_9 Reverse -183 -193 -0.118297 0.282
NP_440297.1_9 Forward -104 -94 -0.118297 0.282
NP_442280.1_10 Reverse -116 -134 4.96742 0.291
NP_441592.1_4 Forward -191 -172 -3.14714 0.275
NP_440999.1_9 Reverse -178 -192 0.196253 0.191
NP_440999.1_9 Forward -220 -206 -0.688726 0.214
NP_440999.1_9 Forward -214 -200 -2.95034 0.281
NP_440888.1_2 Forward -216 -202 14.6503 0.0162
NP_440888.1_2 Reverse -182 -196 7.07881 0.208
NP_440888.1_2 Reverse -102 -116 6.39049 0.236
NP_440888.1_2 Forward -191 -177 5.30886 0.284
NP_440792.1_1 Forward -62 -43 4.52268 0.23
NP_440600.1_4 Forward -199 -181 17.7187 0.0557
NP_440179.1_6 Forward -190 -171 5.70265 0.231
NP_441345.1_8 Forward -226 -207 11.6025 0.266
NP_440575.1_8 Reverse -191 -210 -6.88371 0.297
NP_441543.1_2 Forward -190 -181 16.9127 0.00359
NP_441543.1_2 Reverse -183 -192 16.9127 0.00359
NP_441543.1_2 Forward -209 -200 5.11294 0.209
NP_442845.1_2 Reverse -176 -190 8.84938 0.185
NP_442845.1_2 Forward -197 -183 5.99778 0.219
NP_442845.1_2 Reverse -53 -67 3.24451 0.298
NP_442710.1_4 Forward -374 -355 19.5484 0.149
NP_441469.1_4 Reverse -204 -223 6.88262 0.282
NP_441469.1_8 Forward -192 -183 6.48957 0.227
NP_441469.1_8 Reverse -181 -190 6.48957 0.227
NP_443064.1_6 Forward -191 -181 12.5669 0.0796
NP_443064.1_6 Reverse -182 -192 12.5669 0.0796
NP_442578.1_7 Forward -190 -183 14.5921 0.026
NP_442578.1_7 Reverse -183 -190 14.5921 0.026
NP_440148.1_3 Forward -109 -95 17.4042 0.274
NP_441462.1_2 Forward -191 -181 11.5831 0.00406
NP_441462.1_2 Reverse -182 -192 11.5831 0.00406
NP_443062.1_1 Forward -191 -173 12.2512 0.0831
NP_441560.1_8 Forward -215 -196 13.85 0.196
NP_440504.1_7 Reverse -90 -109 -4.81876 0.295
NP_440544.1_5 Reverse -120 -127 13.8024 0.28
NP_440516.1_8 Forward -191 -182 16.9127 0.00442
NP_440516.1_8 Reverse -182 -191 16.9127 0.00442
NP_442428.1_5 Forward -190 -183 15.8704 0.0124
NP_442428.1_5 Reverse -183 -190 15.8704 0.0124
NP_442428.1_5 Reverse -202 -209 4.759 0.223
NP_441443.1_7 Forward -117 -98 2.45773 0.218
NP_442120.1_7 Reverse -202 -221 -0.4922 0.195
NP_442120.1_10 Reverse -201 -220 1.57275 0.156
NP_442120.1_10 Reverse -84 -103 -12.6852 0.275
NP_440673.1_2 Forward -115 -96 14.9745 0.0961
NP_440673.1_3 Forward -189 -182 12.4288 0.0426
NP_440673.1_3 Reverse -184 -191 12.4288 0.0426
NP_440673.1_3 Forward -214 -207 6.72562 0.277
NP_441714.1_3 Reverse -175 -193 17.5212 0.0935
NP_441052.1_2 Forward -191 -181 19.9412 0.00106
NP_441052.1_2 Reverse -182 -192 19.9412 0.00106
NP_441052.1_2 Forward -216 -206 4.99491 0.135
NP_441052.1_2 Reverse -207 -217 4.3066 0.161
NP_441052.1_2 Forward -105 -95 4.3066 0.161
NP_441052.1_2 Reverse -96 -106 4.20827 0.163
NP_441052.1_2 Forward -284 -274 0.0783647 0.263
NP_442219.1_8 Reverse -43 -62 10.1964 0.21
NP_442219.1_8 Reverse -203 -222 6.52434 0.294
NP_442219.1_9 Forward -190 -181 17.7976 0.00718
NP_442219.1_9 Reverse -183 -192 17.7976 0.00718
NP_440436.1_4 Forward -190 -181 17.2072 0.00233
NP_440436.1_4 Reverse -183 -192 17.2072 0.00233
NP_440436.1_4 Forward -209 -200 4.7192 0.244
NP_441884.1_2 Forward -162 -148 16.4362 0.239
NP_442864.1_2 Forward -215 -196 15.9291 0.214
NP_440314.1_9 Reverse -183 -202 -8.752 0.253
NP_440314.1_9 Reverse -100 -119 -9.83364 0.278
NP_440648.1_1 Forward -191 -172 14.7491 0.0772
NP_442907.1_2 Reverse -97 -115 13.4905 0.169
NP_441086.1_3 Reverse -149 -168 6.32874 0.278
NP_441086.1_6 Forward -67 -57 16.1058 0.198
NP_441719.1_4 Forward -190 -183 16.3621 0.0124
NP_441719.1_4 Reverse -183 -190 16.3621 0.0124
NP_441004.1_1 Reverse -201 -220 -0.688862 0.124
NP_441004.1_1 Reverse -84 -103 -12.3902 0.247
NP_441004.1_4 Forward -261 -251 10.1081 0.254
NP_442366.1_3 Forward -223 -205 -5.29072 0.286
NP_442366.1_5 Forward -194 -184 15.4175 0.0374
NP_442366.1_5 Reverse -179 -189 14.0409 0.0497
NP_442873.1_3 Reverse -98 -117 4.03023 0.274
NP_442206.1_1 Forward -216 -197 -10.1286 0.219
NP_442206.1_10 Forward -191 -176 6.07642 0.178
NP_442206.1_10 Reverse -182 -197 3.32315 0.186
NP_442854.1_6 Reverse -219 -238 3.6377 0.253
NP_442312.1_1 Forward -203 -184 9.73422 0.282
NP_442430.1_10 Reverse -172 -191 14.3549 0.155
NP_441966.1_7 Reverse -239 -258 -1.96793 0.297
NP_441851.1_10 Forward -192 -182 15.8113 0.00552
NP_441851.1_10 Reverse -181 -191 15.8113 0.00552
NP_441851.1_10 Reverse -200 -210 4.69992 0.254
NP_442700.1_4 Forward -224 -205 -2.85214 0.299
NP_442856.1_7 Forward -225 -206 7.17762 0.113
NP_441668.1_4 Forward -201 -182 7.66927 0.151
NP_441668.1_4 Forward -172 -153 -0.787193 0.262
NP_442515.1_1 Reverse -181 -195 13.3726 0.0278
NP_442515.1_1 Forward -192 -178 4.12949 0.108
NP_442515.1_1 Reverse -95 -109 0.392915 0.193
NP_440593.1_3 Reverse -202 -221 10.6192 0.107
NP_440593.1_3 Reverse -85 -104 8.16093 0.109
NP_440593.1_3 Forward -196 -177 -3.44213 0.235
NP_440593.1_3 Forward -104 -85 -7.57203 0.297
NP_440463.1_8 Forward -223 -204 6.72539 0.269
NP_441046.1_2 Forward -116 -97 12.0942 0.182
NP_441046.1_2 Reverse -190 -209 2.65439 0.24
NP_441349.1_10 Forward -201 -182 -6.09707 0.221
NP_441349.1_10 Reverse -172 -191 -7.37537 0.248
NP_442843.1_1 Reverse -183 -202 5.50599 0.144
NP_442843.1_1 Reverse -208 -227 -9.83364 0.271
NP_439960.1_3 Forward -105 -86 4.22769 0.25
NP_439960.1_10 Forward -223 -205 4.54237 0.161
NP_442450.1_5 Reverse -180 -190 7.55152 0.13
NP_442450.1_5 Forward -193 -183 7.55152 0.13
NP_440195.1_4 Reverse -189 -208 14.1591 0.127
NP_440195.1_4 Forward -203 -184 4.71934 0.294
NP_441570.1_1 Forward -191 -173 0.904127 0.0353
NP_441570.1_1 Reverse -182 -200 -14.2388 0.225
NP_441570.1_1 Reverse -201 -219 -16.8938 0.257
NP_440078.1_10 Forward -191 -172 11.5042 0.162
NP_440078.1_10 Forward -111 -92 2.65439 0.269
NP_441078.1_4 Forward -191 -182 19.6659 0.0007
NP_441078.1_4 Reverse -182 -191 19.6659 0.0007
NP_441078.1_4 Reverse -207 -216 -1.37691 0.254
NP_441078.1_4 Forward -105 -96 -1.37691 0.254
NP_441078.1_4 Reverse -96 -105 -1.47524 0.266
NP_441078.1_4 Reverse -201 -210 -1.77023 0.266
NP_442729.1_8 Forward -195 -182 10.639 0.125
NP_440526.1_3 Forward -209 -198 10.4812 0.0646
NP_440526.1_3 Forward -190 -179 8.02298 0.126
NP_440526.1_3 Reverse -183 -194 1.04151 0.267
NP_440526.1_3 Forward -98 -87 0.156538 0.297
NP_441432.1_8 Reverse -181 -190 16.8143 0.00595
NP_441432.1_8 Forward -192 -183 16.8143 0.00595
NP_441432.1_8 Reverse -206 -215 11.9961 0.0519
NP_441432.1_8 Reverse -200 -209 4.81794 0.196
NP_442320.1_8 Forward -197 -183 -4.81863 0.188
NP_442344.1_7 Forward -190 -171 0.491109 0.0936
NP_441732.1_2 Reverse -178 -194 -7.80794 0.0935
NP_441732.1_2 Forward -220 -204 -14.5928 0.145
NP_441732.1_2 Reverse -92 -108 -16.4611 0.167
NP_441732.1_2 Forward -195 -179 -16.6577 0.186
NP_442815.1_2 Reverse -202 -220 2.37909 0.296
NP_440760.1_1 Forward -191 -172 -2.65548 0.0332
NP_440760.1_1 Reverse -182 -201 -13.2752 0.1
NP_440760.1_1 Forward -285 -266 -16.0285 0.163
NP_442353.1_4 Forward -197 -178 0.0970122 0.281
NP_441072.1_2 Forward -115 -96 6.78429 0.269
NP_441072.1_2 Reverse -171 -190 6.29264 0.283
NP_440713.1_4 Reverse -298 -317 11.8975 0.113
NP_442489.1_2 Forward -391 -372 8.06259 0.172
NP_442489.1_7 Forward -191 -182 20.1576 0.000695
NP_442489.1_7 Reverse -182 -191 20.1576 0.000695
NP_442489.1_7 Reverse -201 -210 -1.27858 0.185
NP_442489.1_7 Forward -105 -96 -1.37691 0.195
NP_442489.1_7 Reverse -96 -105 -1.47524 0.203
NP_442489.1_7 Reverse -207 -216 -1.57357 0.213
NP_442489.1_7 Forward -216 -207 -2.06522 0.288
NP_440559.1_1 Forward -190 -181 17.4043 0.00658
NP_440559.1_1 Reverse -183 -192 17.4043 0.00658
NP_441659.2_8 Forward -191 -181 18.1713 0.00133
NP_441659.2_8 Reverse -182 -192 18.1713 0.00133
NP_441659.2_8 Forward -210 -200 3.61828 0.154
NP_441659.2_8 Reverse -96 -106 3.42162 0.161
NP_441659.2_8 Forward -239 -229 3.02829 0.177
NP_442913.1_10 Reverse -173 -192 -0.197208 0.157
NP_442346.1_2 Reverse -171 -190 3.6377 0.293
NP_442346.1_5 Forward -192 -182 16.6963 0.00248
NP_442346.1_5 Reverse -181 -191 16.6963 0.00248
NP_442346.1_5 Reverse -95 -105 10.8948 0.0813
NP_442346.1_5 Forward -100 -90 10.3048 0.101
NP_442346.1_5 Reverse -206 -216 9.81313 0.117
NP_442346.1_5 Forward -106 -96 5.28991 0.253
NP_442346.1_5 Reverse -200 -210 5.19158 0.256
NP_440545.1_3 Forward -109 -92 -0.846137 0.159
NP_440545.1_3 Reverse -203 -220 -5.66436 0.256
NP_440545.1_3 Forward -243 -226 -6.05768 0.268
NP_440010.1_4 Forward -109 -90 4.81688 0.216
NP_440010.1_4 Reverse -197 -216 -1.67294 0.267
NP_440010.1_4 Forward -226 -207 -1.8696 0.273
NP_442027.1_5 Reverse -222 -241 11.7992 0.23
NP_442551.1_4 Forward -107 -92 13.9429 0.0946
NP_442311.1_5 Reverse -302 -321 4.32602 0.245
NP_442603.1_7 Reverse -182 -196 7.17714 0.211
NP_441888.1_10 Forward -190 -171 17.5109 0.16
NP_441047.1_2 Forward -190 -171 -1.18052 0.267
NP_441833.1_4 Forward -190 -183 15.9687 0.0124
NP_441833.1_4 Reverse -183 -190 15.9687 0.0124
NP_441329.1_6 Forward -139 -120 -2.14899 0.293
NP_441895.1_2 Forward -134 -115 -26.8449 0.256
NP_442699.1_8 Forward -107 -88 -11.3086 0.238
NP_442162.1_9 Forward -190 -183 16.2637 0.0124
NP_442162.1_9 Reverse -183 -190 16.2637 0.0124
NP_441915.1_4 Reverse -212 -231 5.2102 0.3
NP_442140.1_3 Forward -190 -180 12.2714 0.0632
NP_442140.1_3 Reverse -183 -193 12.2714 0.0632
NP_442914.1_8 Forward -116 -97 7.27595 0.237
NP_440951.1_5 Reverse -268 -286 12.9005 0.274
NP_440875.1_9 Reverse -215 -225 9.15072 0.233
NP_441813.1_5 Reverse -180 -190 8.63316 0.0367
NP_441813.1_5 Forward -193 -183 8.63316 0.0367
NP_442254.1_1 Forward -329 -310 0.58944 0.249
NP_440590.1_4 Forward -190 -177 1.19926 0.13
NP_440590.1_4 Reverse -183 -196 0.805932 0.143
NP_440590.1_4 Forward -209 -196 -6.07724 0.299
NP_440567.1_1 Forward -190 -176 13.8643 0.0196
NP_440567.1_1 Reverse -183 -197 2.35953 0.176
NP_442497.1_10 Forward -190 -181 10.4228 0.0087
NP_442497.1_10 Reverse -183 -192 10.4228 0.0087
NP_440821.1_4 Reverse -180 -190 9.41981 0.0286
NP_440821.1_4 Forward -193 -183 9.41981 0.0286
NP_441239.1_9 Forward -224 -212 3.48056 0.285
NP_441239.1_9 Forward -193 -181 3.38223 0.285
NP_441239.1_9 Reverse -180 -192 3.38223 0.285
NP_441009.1_4 Forward -191 -172 15.8307 0.158
NP_441009.1_7 Reverse -200 -219 14.3558 0.186
NP_441727.1_3 Forward -112 -93 6.78429 0.24
NP_441727.1_3 Forward -198 -179 4.81767 0.262
NP_441727.1_3 Reverse -175 -194 2.55606 0.299
NP_441892.1_1 Reverse -173 -190 -4.18939 0.256
NP_441892.1_1 Forward -114 -97 -5.76269 0.288
NP_441892.1_1 Forward -200 -183 -5.86102 0.29
NP_440604.1_6 Forward -191 -172 6.68596 0.107
NP_440989.1_2 Forward -292 -274 22.4378 0.0476
NP_440863.1_1 Forward -127 -113 13.1279 0.263
NP_441526.1_6 Forward -122 -103 2.55606 0.283
NP_442138.1_1 Reverse -100 -119 6.39016 0.24
NP_442809.1_6 Forward -216 -197 0.294447 0.295
NP_440546.1_4 Forward -191 -181 10.046 0.109
NP_440546.1_4 Reverse -182 -192 10.046 0.109
NP_440546.1_6 Forward -121 -102 7.57094 0.268
NP_440462.1_6 Reverse -180 -190 1.35667 0.294
NP_440462.1_6 Forward -193 -183 1.35667 0.294
NP_440868.1_4 Reverse -178 -190 15.1819 0.0164
NP_440868.1_4 Forward -195 -183 8.10212 0.0602
NP_441474.1_1 Reverse -98 -117 -3.24622 0.296
NP_441848.1_7 Reverse -115 -134 -0.0996487 0.235
NP_440696.1_3 Forward -115 -97 -0.0791831 0.238
NP_440696.1_3 Reverse -361 -379 -2.3408 0.274
NP_440843.1_8 Reverse -360 -379 14.1591 0.297
NP_442923.1_4 Reverse -201 -220 -6.09707 0.295
NP_442023.1_2 Forward -363 -344 7.66927 0.255
NP_442039.1_4 Forward -190 -183 15.1821 0.0124
NP_442039.1_4 Reverse -183 -190 15.1821 0.0124
NP_441811.1_8 Reverse -84 -98 8.16106 0.238
NP_442679.1_1 Forward -358 -339 -3.24547 0.25
NP_442679.1_1 Forward -132 -113 -3.73712 0.262
NP_440825.1_7 Reverse -183 -193 12.9096 0.152
NP_440825.1_7 Forward -190 -180 12.9096 0.152
NP_442837.1_3 Forward -190 -183 15.7721 0.0124
NP_442837.1_3 Reverse -183 -190 15.7721 0.0124
NP_442053.1_1 Forward -191 -182 18.3876 0.0007
NP_442053.1_1 Reverse -182 -191 18.3876 0.0007
NP_440505.1_3 Forward -193 -183 9.22315 0.122
NP_440505.1_3 Reverse -180 -190 9.22315 0.122
NP_440505.1_3 Reverse -199 -209 4.50326 0.284
NP_442659.1_9 Forward -263 -244 19.0757 0.225
NP_440351.1_1 Reverse -183 -202 1.96607 0.156
NP_440914.1_1 Forward -191 -181 17.5935 0.000537
NP_440914.1_1 Reverse -182 -192 17.5935 0.000537
NP_440914.1_1 Reverse -207 -217 12.6163 0.0518
NP_441011.1_8 Forward -190 -181 8.25953 0.144
NP_441011.1_8 Reverse -183 -192 8.25953 0.144
NP_442533.1_6 Forward -191 -182 17.2076 0.00137
NP_442533.1_6 Reverse -182 -191 17.2076 0.00137
NP_442533.1_6 Forward -105 -96 13.8644 0.0178
NP_442533.1_6 Reverse -96 -105 7.17789 0.0948
NP_442533.1_6 Reverse -207 -216 5.11294 0.155
NP_442533.1_6 Reverse -213 -222 4.32629 0.184
NP_442533.1_6 Reverse -201 -210 4.22796 0.186
NP_442533.1_6 Forward -99 -90 3.04799 0.228
NP_442533.1_6 Reverse -275 -284 1.57302 0.294
NP_442541.1_10 Reverse -96 -110 12.6836 0.182
NP_442541.1_10 Reverse -213 -227 8.75042 0.218
NP_442541.1_10 Forward -216 -202 3.34225 0.254
NP_440263.1_3 Reverse -262 -281 1.0811 0.296
NP_442322.1_4 Reverse -99 -116 -9.49991 0.295
NP_442229.1_1 Forward -193 -179 7.57046 0.196
NP_443016.1_1 Forward -197 -178 -2.75381 0.225
NP_441482.1_7 Forward -197 -183 -3.147 0.11
NP_441482.1_7 Reverse -176 -190 -8.94853 0.193
NP_439944.1_9 Forward -190 -180 10.5014 0.0887
NP_439944.1_9 Reverse -183 -193 10.5014 0.0887
NP_439944.1_9 Reverse -202 -212 5.09324 0.277
NP_442269.1_10 Reverse -85 -104 3.14605 0.255
NP_441028.1_6 Reverse -110 -120 5.97777 0.234
NP_440116.1_5 Reverse -179 -196 6.23369 0.169
NP_440116.1_8 Reverse -183 -202 -8.06369 0.245
NP_441527.1_4 Forward -358 -339 -6.7326 0.224
NP_440115.1_6 Reverse -179 -189 9.32148 0.115
NP_440115.1_6 Forward -102 -92 6.66654 0.172
NP_441059.1_2 Reverse -304 -323 -4.81876 0.242
NP_441602.1_3 Forward -221 -202 -3.93378 0.256
NP_441972.1_5 Reverse -208 -227 -5.70374 0.224
NP_441972.1_5 Reverse -97 -116 -8.85033 0.272
NP_441106.1_1 Forward -192 -183 9.63616 0.0311
NP_441106.1_1 Reverse -181 -190 9.63616 0.0311
NP_439903.1_6 Reverse -173 -192 3.14526 0.213
NP_439903.1_6 Forward -219 -200 0.785326 0.256
NP_001035870.1_3 Forward -202 -183 0.982764 0.163
NP_441286.1_1 Forward -192 -180 12.9203 0.00815
NP_441286.1_1 Reverse -181 -193 12.9203 0.00815
NP_441286.1_1 Forward -211 -199 1.02229 0.0996
NP_441286.1_1 Reverse -200 -212 -6.94252 0.288
NP_442674.1_3 Reverse -174 -193 11.5033 0.174
NP_442674.1_3 Forward -199 -180 10.7167 0.174
NP_440670.1_8 Forward -191 -182 18.3876 0.000699
NP_440670.1_8 Reverse -182 -191 18.3876 0.000699
NP_440886.1_7 Forward -192 -182 7.94438 0.0805
NP_440886.1_7 Reverse -181 -191 7.94438 0.0805
NP_440886.1_7 Reverse -101 -111 5.28945 0.188
NP_440886.1_7 Forward -277 -267 3.22451 0.291
NP_440828.1_1 Reverse -98 -117 -0.197979 0.269
NP_442614.1_2 Forward -191 -177 16.3225 0.0675
NP_442614.1_2 Reverse -201 -215 15.5359 0.0773
NP_442382.1_9 Forward -220 -201 10.815 0.281
NP_440513.1_4 Reverse -207 -226 7.57094 0.295
NP_442022.1_4 Reverse -84 -103 13.7658 0.166
NP_440907.2_8 Forward -190 -180 7.64939 0.117
NP_440907.2_8 Reverse -183 -193 7.64939 0.117
NP_442264.1_2 Reverse -197 -214 11.2486 0.185
NP_442264.1_2 Forward -109 -92 8.59364 0.211
NP_442264.1_5 Forward -191 -177 14.8476 0.222
NP_441021.1_1 Forward -98 -79 -1.27885 0.114
NP_441463.1_3 Reverse -172 -191 -3.24547 0.171
NP_441463.1_3 Forward -220 -201 -4.6221 0.209
NP_441463.1_3 Forward -201 -182 -9.53865 0.28
NP_441463.1_6 Reverse -94 -108 11.2476 0.224
NP_441626.1_2 Forward -190 -183 15.7721 0.0124
NP_441626.1_2 Reverse -183 -190 15.7721 0.0124
NP_442365.1_7 Forward -384 -365 -0.983855 0.189
NP_442365.1_7 Reverse -178 -197 -1.57384 0.193
NP_442365.1_7 Reverse -92 -111 -6.09707 0.285
NP_442794.1_1 Reverse -178 -190 12.1337 0.0721
NP_442794.1_1 Forward -195 -183 9.28209 0.0795
NP_442615.1_1 Reverse -173 -191 0.707465 0.0979
NP_442615.1_1 Forward -200 -182 -1.94747 0.136
NP_441962.1_4 Reverse -177 -196 -0.295539 0.117
NP_441962.1_4 Reverse -202 -221 -6.09707 0.175
NP_441962.1_4 Reverse -85 -104 -6.78538 0.181
NP_441962.1_4 Forward -110 -91 -8.45701 0.2
NP_441962.1_4 Forward -215 -196 -10.4236 0.228
NP_441962.1_4 Forward -104 -85 -12.7836 0.265
NP_441962.1_4 Forward -221 -202 -14.5535 0.29
NP_441796.1_8 Reverse -251 -269 12.1139 0.199
NP_440387.1_1 Forward -191 -175 18.7414 0.0042
NP_440387.1_1 Reverse -182 -198 11.8583 0.0149
NP_440855.1_2 Forward -371 -352 11.995 0.299
NP_441431.1_2 Reverse -179 -193 7.57046 0.238
NP_441431.1_7 Forward -342 -323 17.1627 0.176
NP_441836.1_1 Reverse -171 -190 14.1291 0.203
NP_441836.1_2 Reverse -84 -103 0.786102 0.197
NP_441836.1_2 Reverse -302 -321 -1.27885 0.217
NP_441836.1_2 Reverse -201 -220 -3.54046 0.239
NP_441836.1_2 Reverse -176 -195 -4.32711 0.255
NP_441993.1_1 Reverse -207 -226 9.74328 0.135
NP_441993.1_1 Reverse -201 -220 4.96787 0.21
NP_441993.1_1 Reverse -84 -103 3.99329 0.227
NP_442698.1_10 Forward -138 -119 -0.197208 0.297
NP_441510.2_7 Reverse -90 -104 11.012 0.28
NP_442087.1_2 Reverse -182 -201 18.1493 0.117
NP_440293.1_3 Forward -80 -61 1.67108 0.207
NP_440293.1_3 Reverse -205 -224 -2.26216 0.239
NP_440293.1_3 Reverse -268 -287 -4.6221 0.264
NP_440293.1_9 Reverse -270 -284 11.2476 0.259
NP_441237.1_6 Forward -78 -61 2.69378 0.288
NP_441237.1_9 Forward -190 -180 14.828 0.0242
NP_441237.1_9 Reverse -183 -193 14.828 0.0242
NP_441311.1_2 Reverse -176 -190 11.1104 0.257
NP_442867.1_8 Reverse -118 -137 4.81767 0.277
NP_442940.1_2 Forward -191 -172 4.62101 0.242
NP_442680.1_5 Forward -176 -157 0.951443 0.255
NP_441984.1_3 Forward -226 -208 10.8356 0.184
NP_441984.1_3 Forward -233 -215 7.59063 0.245
NP_441436.1_2 Forward -132 -113 -2.55715 0.28
NP_441436.1_2 Forward -121 -102 -4.91709 0.294
NP_442509.1_9 Forward -191 -181 8.14104 0.192
NP_442509.1_9 Reverse -182 -192 8.14104 0.192
NP_441885.1_5 Forward -191 -181 20.9245 0.000538
NP_441885.1_5 Reverse -182 -192 20.9245 0.000538
NP_441428.1_8 Forward -313 -294 5.60432 0.226
NP_441428.1_8 Forward -218 -199 4.52268 0.241
NP_442341.1_7 Reverse -181 -195 13.6676 0.0334
NP_442341.1_7 Forward -192 -178 12.3893 0.0454
NP_442341.1_9 Forward -193 -179 10.717 0.133
NP_441173.1_9 Reverse -157 -165 11.0321 0.228
NP_443000.1_7 Forward -193 -183 10.3048 0.0345
NP_443000.1_7 Reverse -180 -190 10.3048 0.0345
NP_440507.2_3 Forward -108 -89 7.96345 0.263
NP_442513.1_5 Forward -113 -94 8.06178 0.274
NP_440275.1_3 Forward -193 -183 8.04317 0.0602
NP_440275.1_3 Reverse -180 -190 8.04317 0.0602
NP_442354.1_7 Reverse -179 -198 7.7676 0.216
NP_442275.1_1 Reverse -305 -324 2.0644 0.284
NP_441902.1_3 Reverse -81 -91 13.8563 0.226
NP_441190.1_2 Reverse -74 -93 -1.08219 0.297
NP_440175.1_4 Reverse -205 -224 -9.63698 0.171
NP_440175.1_7 Forward -207 -189 11.9005 0.23
NP_440149.1_8 Reverse -182 -201 -2.16383 0.166
NP_440149.1_8 Forward -191 -172 -3.14714 0.183
NP_442214.1_7 Forward -168 -149 14.728 0.251
NP_441105.1_3 Forward -227 -208 8.35759 0.049
NP_441105.1_3 Reverse -91 -110 -0.000545616 0.131
NP_441105.1_3 Forward -110 -91 -9.14533 0.284
NP_441105.1_3 Forward -202 -183 -10.0303 0.3
NP_440216.1_1 Forward -191 -177 -10.3252 0.145
NP_440216.1_1 Reverse -182 -196 -10.6202 0.145
NP_440216.1_1 Reverse -213 -227 -12.1934 0.247
NP_440172.1_1 Forward -191 -181 15.0247 0.00945
NP_440172.1_1 Reverse -182 -192 15.0247 0.00945
NP_440172.1_1 Reverse -207 -217 6.17489 0.11
NP_442015.1_10 Reverse -178 -191 10.049 0.0415
NP_442015.1_10 Forward -195 -182 1.39592 0.204
NP_442015.1_10 Forward -220 -207 -0.865694 0.285
NP_441226.1_7 Forward -190 -183 14.4934 0.0123
NP_441226.1_7 Reverse -183 -190 14.4934 0.0123
NP_441226.1_7 Forward -238 -231 8.29857 0.205
NP_442446.1_3 Forward -111 -92 22.0256 0.0503
NP_441111.1_7 Forward -190 -182 18.7023 0.00294
NP_441111.1_7 Reverse -183 -191 18.7023 0.00294
NP_441111.1_7 Forward -209 -201 -0.668896 0.274
NP_442379.1_10 Reverse -175 -192 -1.23946 0.223
NP_441766.1_2 Forward -191 -182 17.5026 0.00297
NP_441766.1_2 Reverse -182 -191 17.5026 0.00297
NP_441766.1_9 Reverse -222 -241 3.04771 0.231
NP_440416.1_9 Reverse -95 -114 -8.35868 0.114
NP_440416.1_9 Reverse -175 -194 -14.9469 0.182
NP_440416.1_9 Reverse -206 -225 -18.1918 0.253
NP_443052.1_9 Forward -208 -189 -6.49039 0.283
NP_442403.1_9 Forward -222 -203 3.34271 0.27
NP_442154.1_1 Forward -269 -251 -17.3854 0.254
NP_442154.1_6 Forward -118 -99 7.57094 0.223
NP_440261.1_5 Forward -190 -177 -0.964025 0.0655
NP_440261.1_5 Reverse -183 -196 -10.3055 0.201
NP_440988.1_10 Reverse -94 -108 19.9048 0.0733
NP_440988.1_10 Forward -107 -93 13.5152 0.169
NP_440988.1_10 Reverse -199 -213 8.77134 0.205
NP_440988.1_10 Forward -218 -204 8.19046 0.205
NP_440988.1_10 Forward -193 -179 7.22233 0.219
NP_440988.1_10 Reverse -205 -219 6.73827 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCAACCCTGTTTATTGTGCTACCCAAAGCATTACCAGGCCCCAAAAGGAAAGAACAGAGGAAGCCTGGGGCATATTGAACTTGGCCCACCGTTACCCAGATGGGATTTTCGTAATTGGTCACGCCCAAACCGCCTTAGATGCCCTGATGGAGTTAGTAGAAGCCCAACGCATCCAGCCGGCCCTGGTCATTGCCACCGCCACTAATTTTGGCGATCGCCAAGACGTGGAATTAAATTTGCAAAAAGCTAACATACCCCACATCATAGTCCAGGGAAGAAAAGGGGGGACAGAGGTGGCCGTGGCCATCATTACTGCCCTAGTGGATTTAGCTTGGCAAGCCTATGAACAAAGGGCCCACCTAAATTAGTCACTTCCAACCTTTTCAAACCAGATTTAATT

CDS

ATGGCTTTTTGGCTGATGAAGTCCGAACCCGTCACCTATGGCATTCACCATCTCAAAGCGGAAGGAGAGACCCTCTGGGATGGGGTGAGAAATTATCAAGCCCGCAACTTTTTACAAACCATGGCTGTGGGAGATCAAGCTTTTTTTTACCATTCCAACTGCAAGCCACCGGGCATTGTCGGGCTAATGACCATTACTGCCGAGCAAGTGGTGGACCCCACGCAGTTTGACCCTGCTAGCCCATACTTTGACCCCAAGGCTACTCTGGAGAAGCCCCGTTGGTTCACCGTTAAAGCCAGTTTTACCAGGGAATTTGCCCAGATGATTACTTTGTCCACCCTCAAAGCCCAGTTTAGTCCGGAGGAATTAGGAGTCCTTAAAAAAGGGAACCGCCTGTCGGTGTTACCCGTCTCCCCGGCGATCGCCAATCGAATTTTAGAGTTAGCTTAA

Protein

MAFWLMKSEPVTYGIHHLKAEGETLWDGVRNYQARNFLQTMAVGDQAFFYHSNCKPPGIVGLMTITAEQVVDPTQFDPASPYFDPKATLEKPRWFTVKASFTREFAQMITLSTLKAQFSPEELGVLKKGNRLSVLPVSPAIANRILELA