Your browser is old and dusty. Try Google Chrome!

Details for slr1467

ORF slr1467
Accession NP_441559.1
Symbol
Category Cobalamin, heme, phycobilin and porphyrin
Definition precorrin isomerase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -178 -171 14.6904 0.0123
NP_440795.1_7 Reverse -171 -178 14.6904 0.0123
NP_441418.1_6 Reverse -170 -189 -9.53865 0.0288
NP_442291.1_5 Forward -180 -164 3.89344 0.103
NP_440897.1_6 Reverse -170 -189 -1.96793 0.2
NP_440897.1_6 Forward -95 -76 -3.83621 0.257
NP_441453.1_1 Forward -186 -168 4.34495 0.26
NP_441453.1_4 Reverse -170 -178 16.539 0.00633
NP_441453.1_4 Forward -179 -171 16.539 0.00633
NP_441960.1_3 Forward -224 -205 14.0828 0.243
NP_442151.1_6 Forward -179 -165 14.3559 0.0362
NP_442151.1_6 Forward -95 -81 5.01447 0.298
NP_441818.1_1 Forward -178 -167 10.1862 0.232
NP_440226.1_1 Forward -179 -160 9.83255 0.0687
NP_440226.1_1 Reverse -170 -189 6.39097 0.129
NP_441630.1_3 Reverse -162 -181 -1.18052 0.293
NP_442623.1_3 Forward -94 -75 -10.522 0.186
NP_440150.1_2 Forward -106 -87 5.11187 0.276
NP_440996.1_3 Forward -192 -174 8.86894 0.291
NP_442173.1_1 Forward -178 -170 15.4574 0.00633
NP_442173.1_1 Reverse -171 -179 15.4574 0.00633
NP_442752.1_4 Forward -179 -172 13.8055 0.0199
NP_442752.1_4 Reverse -170 -177 13.8055 0.0199
NP_443027.1_4 Forward -181 -171 11.8781 0.0872
NP_443027.1_4 Forward -143 -133 7.94484 0.223
NP_441812.1_3 Forward -288 -274 13.3726 0.167
NP_442975.1_10 Forward -183 -169 5.21053 0.228
NP_442975.1_10 Reverse -166 -180 2.45727 0.274
NP_440784.1_7 Forward -178 -171 15.9687 0.0123
NP_440784.1_7 Reverse -171 -178 15.9687 0.0123
NP_442909.1_7 Forward -178 -164 11.7003 0.131
NP_440061.1_9 Reverse -168 -182 11.602 0.107
NP_441054.1_2 Reverse -30 -49 14.8474 0.156
NP_441054.1_4 Forward -189 -171 0.412472 0.174
NP_442062.1_8 Reverse -170 -180 19.4496 0.000558
NP_442062.1_8 Forward -179 -169 17.3846 0.00193
NP_441859.1_3 Forward -173 -154 2.06362 0.267
NP_441043.1_1 Reverse -339 -358 13.8633 0.286
NP_441802.1_1 Forward -85 -66 6.09597 0.269
NP_441802.1_1 Forward -110 -91 4.22769 0.296
NP_440304.1_4 Forward -331 -321 2.7333 0.299
NP_440304.1_4 Forward -181 -171 1.84832 0.299
NP_440304.1_4 Reverse -168 -178 1.84832 0.299
NP_442242.1_4 Forward -178 -171 14.3954 0.0124
NP_442242.1_4 Reverse -171 -178 14.3954 0.0124
NP_440044.1_8 Forward -178 -159 7.57094 0.0817
NP_441619.1_8 Reverse -164 -178 10.2254 0.187
NP_441208.1_9 Reverse -167 -181 11.7993 0.145
NP_441208.1_9 Reverse -180 -194 4.81781 0.285
NP_440370.1_10 Reverse -161 -180 6.98095 0.271
NP_442110.1_7 Forward -179 -165 -0.197071 0.276
NP_441925.1_4 Forward -43 -24 -15.1442 0.263
NP_441925.1_4 Forward -41 -22 -17.1108 0.288
NP_441925.1_4 Forward -46 -27 -17.4058 0.294
NP_441083.1_5 Forward -179 -169 20.3345 0.00053
NP_441083.1_5 Reverse -170 -180 11.3864 0.0159
NP_441083.1_5 Forward -396 -386 5.68323 0.11
NP_441083.1_5 Reverse -387 -397 4.50326 0.141
NP_441434.1_7 Forward -177 -163 4.81781 0.225
NP_441738.1_2 Forward -177 -170 15.28 0.0102
NP_441738.1_2 Reverse -172 -179 15.28 0.0102
NP_441738.1_2 Forward -45 -38 8.29857 0.176
NP_441738.1_2 Reverse -16 -23 6.52862 0.261
NP_441738.1_4 Reverse -160 -179 6.19431 0.203
NP_441558.1_5 Reverse -168 -187 10.1275 0.105
NP_441558.1_5 Forward -181 -162 4.42435 0.281
NP_441645.1_6 Forward -41 -27 11.7987 0.241
NP_440209.1_1 Reverse -170 -178 18.1123 0.00295
NP_440209.1_1 Forward -179 -171 18.1123 0.00295
NP_442889.1_8 Forward -182 -168 14.8469 0.0473
NP_440447.1_1 Forward -246 -228 6.70565 0.194
NP_441713.1_1 Forward -185 -166 -6.68705 0.121
NP_440178.1_7 Forward -180 -161 4.52268 0.0199
NP_441716.1_1 Reverse -170 -184 10.7177 0.0936
NP_442111.1_4 Reverse -169 -183 21.9274 0.0011
NP_441624.1_1 Reverse -230 -249 15.7324 0.284
NP_440906.1_5 Forward -178 -171 15.8704 0.0124
NP_440906.1_5 Reverse -171 -178 15.8704 0.0124
NP_440747.1_10 Forward -182 -170 17.0502 0.000794
NP_440747.1_10 Reverse -167 -179 14.9853 0.00221
NP_440747.1_10 Reverse -83 -95 -4.68091 0.115
NP_440747.1_10 Forward -244 -232 -11.7607 0.142
NP_441130.1_10 Forward -181 -167 8.84938 0.131
NP_441486.1_1 Reverse -167 -181 13.3726 0.00871
NP_441486.1_1 Forward -182 -168 5.40779 0.037
NP_441486.1_1 Forward -98 -84 1.86788 0.0969
NP_442850.1_8 Forward -183 -164 16.4067 0.243
NP_441265.1_3 Forward -185 -171 3.04785 0.181
NP_441014.1_8 Forward -43 -24 -6.88371 0.276
NP_441014.1_10 Forward -180 -161 3.04693 0.215
NP_442848.1_1 Reverse -164 -178 6.48943 0.0791
NP_441012.1_4 Forward -239 -226 9.16406 0.272
NP_441012.1_4 Reverse -82 -95 5.82081 0.29
NP_443018.1_3 Forward -178 -171 14.8871 0.0123
NP_443018.1_3 Reverse -171 -178 14.8871 0.0123
NP_441634.1_8 Forward -243 -229 -2.55701 0.295
NP_441634.1_8 Reverse -168 -182 -3.04867 0.295
NP_441634.1_8 Forward -181 -167 -4.4253 0.295
NP_440376.1_1 Forward -179 -170 19.4693 0.000692
NP_440376.1_1 Reverse -170 -179 19.4693 0.000692
NP_440376.1_1 Reverse -232 -241 4.32629 0.163
NP_441588.1_4 Forward -177 -167 18.1713 0.0143
NP_442687.1_7 Forward -180 -170 15.8113 0.0125
NP_442687.1_7 Reverse -169 -179 8.92815 0.0994
NP_442191.1_4 Reverse -171 -185 11.3809 0.262
NP_442485.1_3 Forward -325 -306 -3.54046 0.276
NP_441846.1_10 Forward -340 -321 -20.2567 0.256
NP_441846.1_10 Reverse -171 -190 -21.83 0.256
NP_440642.1_10 Reverse -67 -81 16.6169 0.119
NP_440642.1_10 Reverse -378 -392 3.04726 0.277
NP_441422.1_7 Forward -181 -164 7.90532 0.0992
NP_440533.1_9 Reverse -170 -189 7.7676 0.181
NP_441763.1_10 Forward -190 -171 12.1917 0.132
NP_441763.1_10 Forward -334 -315 6.29183 0.269
NP_440360.1_5 Forward -323 -304 -0.590531 0.297
NP_442658.1_1 Forward -181 -171 17.0891 0.00615
NP_442658.1_1 Forward -243 -233 9.51767 0.151
NP_442658.1_1 Reverse -168 -178 6.76441 0.214
NP_442658.1_1 Reverse -12 -22 4.89613 0.292
NP_440141.1_8 Forward -338 -319 8.25926 0.23
NP_442782.1_2 Reverse -170 -184 0.88457 0.282
NP_441414.1_9 Reverse -170 -189 -5.01543 0.166
NP_441414.1_9 Forward -179 -160 -9.44032 0.259
NP_441487.1_9 Forward -180 -161 9.0459 0.0988
NP_441487.1_9 Forward -330 -311 4.03102 0.153
NP_442937.1_5 Reverse -165 -184 15.6341 0.0562
NP_442937.1_5 Reverse -315 -334 7.66927 0.244
NP_441958.1_5 Forward -180 -170 12.2714 0.00183
NP_441958.1_5 Reverse -169 -179 12.2714 0.00183
NP_439905.1_1 Forward -338 -325 6.50913 0.285
NP_439905.1_2 Reverse -75 -89 9.5377 0.233
NP_440984.1_7 Reverse -165 -179 5.30946 0.259
NP_440984.1_7 Reverse -316 -330 4.71948 0.292
NP_439990.1_5 Forward -184 -171 13.884 0.0889
NP_442911.1_2 Forward -189 -170 6.88262 0.0277
NP_442911.1_2 Reverse -222 -241 -3.44213 0.112
NP_441580.1_6 Forward -190 -171 -6.29373 0.235
NP_440153.1_8 Forward -44 -31 -3.71729 0.299
NP_443055.1_6 Forward -103 -85 -0.0799167 0.252
NP_443055.1_6 Reverse -162 -180 -1.06322 0.271
NP_440993.1_4 Forward -95 -78 2.69378 0.298
NP_443044.1_1 Forward -51 -32 4.12936 0.279
NP_441348.1_3 Reverse -165 -184 6.29264 0.282
NP_441099.1_5 Forward -189 -170 19.9606 0.00956
NP_442002.1_9 Forward -180 -173 10.7572 0.185
NP_441294.1_7 Forward -183 -169 9.4426 0.244
NP_441294.1_7 Reverse -166 -180 9.25063 0.256
NP_441646.1_1 Reverse -175 -194 -0.197208 0.259
NP_442438.1_10 Forward -184 -170 2.85119 0.168
NP_442438.1_10 Reverse -165 -179 0.88457 0.213
NP_441000.1_6 Forward -180 -166 3.63784 0.108
NP_441000.1_6 Reverse -169 -183 -2.45868 0.216
NP_440147.1_4 Reverse -168 -181 17.7189 0.00602
NP_440147.1_4 Forward -181 -168 10.049 0.0355
NP_441550.1_8 Reverse -168 -178 14.6309 0.0132
NP_441550.1_8 Forward -181 -171 8.82935 0.112
NP_441916.1_7 Reverse -170 -180 18.4663 0.00144
NP_441916.1_7 Forward -179 -169 10.3048 0.0261
NP_441041.1_4 Reverse -170 -189 18.7807 0.00759
NP_441041.1_4 Forward -179 -160 -0.295539 0.0941
NP_441041.1_7 Forward -182 -170 14.6087 0.0342
NP_441041.1_7 Reverse -167 -179 11.8878 0.0689
NP_441725.1_4 Forward -246 -232 10.422 0.125
NP_441725.1_4 Forward -184 -170 4.42388 0.278
NP_441725.1_5 Forward -178 -168 2.04498 0.115
NP_441725.1_5 Reverse -171 -181 2.04498 0.115
NP_439966.1_7 Forward -181 -171 17.9741 0.00631
NP_439966.1_7 Reverse -168 -178 7.25606 0.15
NP_439966.1_9 Reverse -230 -239 6.5879 0.253
NP_439966.1_9 Forward -25 -16 3.7363 0.253
NP_439966.1_9 Forward -181 -172 0.884706 0.253
NP_442941.1_3 Forward -178 -168 11.0914 0.0116
NP_442941.1_3 Reverse -171 -181 10.7964 0.0116
NP_442941.1_3 Forward -140 -130 2.7333 0.14
NP_442941.1_3 Reverse -233 -243 -0.118297 0.249
NP_440289.1_2 Forward -182 -169 11.1307 0.0212
NP_440289.1_2 Reverse -167 -180 -2.144 0.251
NP_440983.1_5 Forward -95 -76 -5.50708 0.266
NP_441514.1_6 Forward -84 -77 14.2971 0.248
NP_441514.1_6 Forward -8 -1 14.2971 0.248
NP_442281.1_1 Reverse -165 -179 16.6169 0.00772
NP_442281.1_1 Forward -184 -170 11.307 0.0487
NP_442281.1_1 Forward -100 -86 3.73557 0.221
NP_442281.1_1 Forward -246 -232 2.94893 0.249
NP_442281.1_1 Reverse -81 -95 2.35894 0.269
NP_442575.1_8 Forward -94 -75 -2.85214 0.245
NP_440177.1_9 Reverse -312 -331 12.1925 0.238
NP_001035871.2_7 Forward -312 -302 12.9597 0.237
NP_440437.1_1 Forward -185 -166 2.0644 0.139
NP_440437.1_1 Forward -104 -85 -2.36049 0.218
NP_441556.1_10 Forward -184 -170 11.4872 0.225
NP_440375.1_8 Reverse -100 -119 1.76941 0.24
NP_442068.1_1 Reverse -211 -230 1.47442 0.299
NP_441644.1_6 Forward -179 -169 17.3841 0.00127
NP_441644.1_6 Reverse -170 -180 10.1076 0.0628
NP_441644.1_6 Reverse -86 -96 9.616 0.0728
NP_441644.1_6 Forward -95 -85 5.09279 0.21
NP_440867.1_6 Forward -332 -313 13.175 0.253
NP_442215.1_2 Forward -97 -81 6.54838 0.0702
NP_442215.1_2 Reverse -168 -184 -0.531451 0.168
NP_442215.1_2 Forward -181 -165 -2.00642 0.191
NP_442029.1_6 Reverse -165 -184 15.7324 0.0999
NP_442247.1_8 Reverse -104 -118 8.45605 0.272
NP_440253.1_2 Reverse -170 -188 1.19912 0.166
NP_440929.1_8 Forward -179 -170 19.2726 0.000701
NP_440929.1_8 Reverse -170 -179 19.2726 0.000701
NP_440929.1_8 Forward -241 -232 4.91628 0.162
NP_442933.1_10 Forward -179 -170 17.601 0.00325
NP_442933.1_10 Reverse -170 -179 17.601 0.00325
NP_441751.2_8 Reverse -171 -185 -3.147 0.134
NP_441751.2_8 Forward -178 -164 -4.62196 0.176
NP_442554.1_8 Forward -178 -168 15.3197 0.00882
NP_442554.1_8 Reverse -171 -181 14.1397 0.0144
NP_442554.1_8 Reverse -87 -97 3.61828 0.218
NP_442554.1_8 Forward -94 -84 3.42162 0.226
NP_441762.1_7 Forward -180 -168 9.57708 0.0142
NP_441762.1_7 Reverse -169 -181 2.98891 0.0676
NP_442142.1_4 Forward -182 -169 15.1616 0.0289
NP_442142.1_4 Reverse -167 -180 13.49 0.0348
NP_442142.1_4 Forward -98 -85 9.75346 0.0873
NP_442142.1_4 Reverse -252 -265 4.05029 0.234
NP_442292.1_1 Forward -178 -169 18.486 0.00229
NP_442292.1_1 Reverse -171 -180 9.63616 0.0183
NP_442476.1_6 Reverse -171 -185 3.8345 0.154
NP_442476.1_6 Forward -240 -226 0.589577 0.252
NP_440895.1_6 Forward -185 -172 9.06573 0.229
NP_441523.1_6 Forward -87 -68 7.86593 0.19
NP_443009.1_5 Reverse -169 -180 18.3477 0.00265
NP_443009.1_5 Forward -242 -231 8.12131 0.117
NP_442741.1_8 Forward -127 -109 16.1454 0.276
NP_441715.1_4 Reverse -171 -181 18.8596 0.00741
NP_441715.1_4 Forward -178 -168 7.94484 0.107
NP_441715.1_4 Reverse -233 -243 4.69992 0.254
NP_442305.1_6 Forward -247 -237 16.5975 0.202
NP_441448.1_6 Forward -175 -156 15.5349 0.21
NP_440158.1_8 Reverse -230 -249 9.24257 0.285
NP_440183.1_9 Reverse -307 -326 -20.945 0.294
NP_440464.1_10 Forward -178 -168 13.0082 0.169
NP_441468.1_1 Forward -178 -171 15.8704 0.0124
NP_441468.1_1 Reverse -171 -178 15.8704 0.0124
NP_439939.1_3 Reverse -54 -73 -2.75381 0.214
NP_441015.1_10 Reverse -165 -184 -2.16383 0.178
NP_441015.1_10 Reverse -22 -41 -9.93197 0.282
NP_441015.1_10 Forward -100 -81 -11.4069 0.296
NP_441015.1_10 Forward -94 -75 -11.4069 0.296
NP_441673.1_1 Forward -179 -170 20.8459 0.000698
NP_441673.1_1 Reverse -170 -179 20.8459 0.000698
NP_441673.1_1 Forward -241 -232 -8.06341 0.254
NP_441826.1_2 Reverse -164 -178 -4.22864 0.293
NP_441826.1_2 Forward -185 -171 -4.62196 0.298
NP_442868.1_6 Forward -181 -171 10.3048 0.038
NP_442868.1_6 Reverse -168 -178 9.81313 0.038
NP_442719.1_2 Reverse -314 -332 -5.09477 0.218
NP_442719.1_2 Forward -198 -180 -11.4863 0.292
NP_441251.1_2 Reverse -237 -255 9.55725 0.262
NP_441056.1_1 Forward -179 -160 -8.55534 0.282
NP_441612.1_2 Forward -179 -169 8.54929 0.21
NP_443058.1_7 Reverse -169 -188 4.62101 0.257
NP_442808.1_1 Forward -180 -170 18.4657 0.00201
NP_442808.1_1 Reverse -169 -179 8.63269 0.0481
NP_442692.1_1 Forward -189 -170 4.22769 0.143
NP_440145.1_3 Reverse -160 -179 16.7157 0.00972
NP_440145.1_3 Forward -251 -232 -2.45882 0.17
NP_442542.1_2 Forward -181 -168 8.47575 0.154
NP_442542.1_9 Reverse -323 -337 6.88214 0.219
NP_442050.1_1 Forward -89 -70 11.2092 0.233
NP_442050.1_1 Forward -90 -71 7.17762 0.275
NP_442050.1_5 Forward -243 -233 9.41933 0.193
NP_442050.1_5 Reverse -168 -178 7.64939 0.243
NP_442050.1_5 Forward -181 -171 6.96107 0.27
NP_440558.1_2 Reverse -292 -311 -6.1954 0.272
NP_440558.1_2 Forward -250 -231 -6.39206 0.274
NP_440558.1_2 Forward -308 -289 -6.58872 0.277
NP_441878.1_6 Forward -180 -170 10.4031 0.0176
NP_441878.1_6 Reverse -169 -179 10.4031 0.0176
NP_441878.1_6 Reverse -320 -330 0.865012 0.132
NP_441878.1_6 Forward -96 -86 0.668351 0.139
NP_441878.1_6 Reverse -85 -95 0.57002 0.14
NP_441878.1_6 Forward -330 -320 -6.31315 0.191
NP_441036.1_8 Forward -180 -170 17.7779 0.000554
NP_441036.1_8 Reverse -169 -179 8.33817 0.174
NP_441557.1_5 Forward -179 -170 19.9609 0.000699
NP_441557.1_5 Reverse -170 -179 19.9609 0.000699
NP_441557.1_8 Forward -41 -31 12.4676 0.236
NP_441445.1_1 Reverse -161 -180 17.404 0.0326
NP_441445.1_1 Forward -338 -319 1.27776 0.259
NP_442777.1_1 Forward -41 -22 9.43841 0.194
NP_441458.1_10 Reverse -161 -180 4.42435 0.23
NP_442192.1_7 Reverse -179 -197 16.4404 0.209
NP_442183.1_1 Forward -117 -103 9.43936 0.098
NP_442183.1_1 Forward -179 -165 5.50613 0.215
NP_442166.1_7 Reverse -171 -185 9.63603 0.19
NP_442347.1_2 Forward -178 -169 12.4878 0.056
NP_442347.1_2 Reverse -171 -180 11.1111 0.056
NP_442645.1_2 Reverse -162 -181 6.68596 0.0177
NP_442645.1_2 Reverse -312 -331 -16.5201 0.235
NP_442645.1_2 Forward -187 -168 -22.715 0.293
NP_442965.1_2 Forward -88 -69 -7.37537 0.268
NP_441037.1_4 Reverse -168 -178 7.9999 0.237
NP_441037.1_4 Forward -181 -171 6.92787 0.237
NP_442508.1_8 Reverse -25 -42 9.08529 0.292
NP_442317.1_2 Reverse -181 -200 9.24257 0.204
NP_441633.1_3 Reverse -168 -181 8.57408 0.0377
NP_441633.1_3 Forward -181 -168 5.72248 0.0481
NP_441633.1_3 Forward -243 -230 -6.66722 0.265
NP_442764.1_8 Forward -294 -275 8.16093 0.175
NP_440136.1_2 Forward -178 -171 15.9687 0.0123
NP_440136.1_2 Reverse -171 -178 15.9687 0.0123
NP_442590.1_10 Reverse -226 -245 4.03102 0.282
NP_442998.1_5 Forward -50 -40 14.0414 0.151
NP_442998.1_5 Forward -51 -41 13.1564 0.158
NP_442998.1_10 Forward -177 -170 15.5754 0.0102
NP_442998.1_10 Reverse -172 -179 15.5754 0.0102
NP_440299.1_1 Forward -183 -170 18.1116 0.00453
NP_440299.1_1 Reverse -82 -95 7.68852 0.107
NP_440299.1_1 Reverse -166 -179 4.44361 0.207
NP_441799.1_1 Reverse -166 -180 16.1252 0.0153
NP_441799.1_1 Forward -183 -169 5.30886 0.214
NP_441007.1_10 Reverse -165 -178 2.67422 0.183
NP_442334.1_1 Forward -127 -108 -5.80207 0.268
NP_442201.1_10 Reverse -159 -178 -12.5869 0.268
NP_440256.1_1 Reverse -167 -186 -0.787193 0.0961
NP_440256.1_1 Forward -182 -163 -7.96535 0.248
NP_441559.1_3 Forward -45 -26 15.5349 0.274
NP_441559.1_4 Forward -273 -254 22.1239 0.00985
NP_441559.1_5 Forward -217 -198 24.1889 0.00565
NP_441559.1_8 Forward -184 -170 21.7307 0.033
NP_441559.1_8 Reverse -104 -118 -4.03198 0.215
NP_441559.1_8 Forward -246 -232 -7.47356 0.294
NP_441559.1_9 Forward -79 -60 18.6823 0.0902
NP_442860.1_9 Forward -39 -26 13.8833 0.214
NP_440915.1_6 Forward -183 -169 12.4876 0.0208
NP_440717.1_3 Reverse -76 -90 7.86545 0.279
NP_442866.1_1 Reverse -227 -246 4.32602 0.151
NP_441464.1_8 Forward -179 -165 7.47274 0.206
NP_441199.1_6 Reverse -102 -121 -0.688862 0.277
NP_442993.1_1 Forward -179 -163 -9.38124 0.185
NP_440677.1_8 Reverse -25 -44 15.5357 0.281
NP_442386.1_9 Forward -180 -171 15.7322 0.0144
NP_442386.1_9 Reverse -169 -178 13.8639 0.0289
NP_442386.1_9 Reverse -359 -368 6.19416 0.23
NP_442386.1_10 Reverse -24 -37 5.32916 0.262
NP_440570.1_5 Reverse -76 -95 -0.688862 0.263
NP_440570.1_5 Forward -32 -13 -4.03212 0.299
NP_441750.1_7 Reverse -24 -34 14.828 0.254
NP_441340.1_5 Forward -178 -171 15.6737 0.0124
NP_441340.1_5 Reverse -171 -178 15.6737 0.0124
NP_442484.1_2 Reverse -75 -94 8.06259 0.144
NP_442484.1_2 Forward -190 -171 1.0811 0.238
NP_442791.1_5 Reverse -162 -181 -1.86883 0.217
NP_440168.1_8 Reverse -226 -245 13.0775 0.153
NP_441160.1_5 Forward -340 -321 -6.39206 0.288
NP_440586.1_8 Forward -178 -171 13.2151 0.026
NP_440586.1_8 Reverse -171 -178 13.2151 0.026
NP_440586.1_8 Reverse -87 -94 5.8403 0.283
NP_442251.1_6 Forward -178 -171 15.2804 0.0124
NP_442251.1_6 Reverse -171 -178 15.2804 0.0124
NP_440192.1_4 Reverse -293 -312 9.10654 0.284
NP_440684.1_9 Reverse -164 -178 9.2427 0.221
NP_441262.1_3 Reverse -170 -177 14.7888 0.0223
NP_441262.1_3 Forward -179 -172 14.7888 0.0223
NP_440027.1_3 Forward -247 -229 5.72158 0.237
NP_443051.1_1 Reverse -169 -178 10.4228 0.00754
NP_443051.1_1 Forward -180 -171 10.4228 0.00754
NP_443051.1_1 Forward -242 -233 0.393051 0.169
NP_439937.1_9 Reverse -169 -186 -8.61494 0.176
NP_439937.1_9 Reverse -37 -54 -12.6465 0.274
NP_439937.1_9 Forward -192 -175 -13.0398 0.279
NP_442294.1_3 Reverse -36 -50 14.1586 0.248
NP_440408.1_7 Forward -95 -76 16.0274 0.138
NP_440439.1_1 Forward -182 -169 10.2457 0.0372
NP_440439.1_1 Forward -333 -320 0.412608 0.192
NP_440372.1_2 Forward -178 -171 16.3621 0.0124
NP_440372.1_2 Reverse -171 -178 16.3621 0.0124
NP_441946.1_9 Forward -251 -234 15.7489 0.241
NP_440819.1_5 Forward -51 -43 7.68924 0.266
NP_441803.1_2 Reverse -103 -122 -0.4922 0.279
NP_439977.1_5 Forward -185 -166 2.65439 0.17
NP_440210.1_10 Reverse -59 -78 5.50519 0.296
NP_441572.1_7 Forward -185 -166 -3.24547 0.208
NP_442549.1_1 Forward -102 -83 18.879 0.0739
NP_442384.1_10 Reverse -170 -183 19.1938 0.00338
NP_442384.1_10 Forward -95 -82 3.36254 0.193
NP_442384.1_10 Forward -179 -166 1.10092 0.268
NP_442114.1_4 Reverse -170 -181 9.20345 0.17
NP_440364.1_1 Reverse -20 -39 17.7974 0.251
NP_441877.1_5 Forward -172 -153 5.70265 0.195
NP_441877.1_7 Forward -184 -165 2.85027 0.218
NP_441877.1_7 Forward -246 -227 1.86696 0.241
NP_442262.1_10 Forward -178 -171 14.1988 0.0123
NP_442262.1_10 Reverse -171 -178 14.1988 0.0123
NP_441689.1_5 Reverse -385 -395 7.94438 0.18
NP_441689.1_5 Reverse -168 -178 5.78111 0.197
NP_440344.1_10 Forward -186 -169 3.67709 0.0263
NP_440344.1_10 Reverse -163 -180 -9.40093 0.146
NP_440344.1_10 Reverse -101 -118 -11.5642 0.219
NP_440531.1_6 Reverse -71 -90 -4.22878 0.278
NP_441640.1_1 Reverse -165 -184 0.982764 0.287
NP_441640.1_8 Reverse -171 -190 -0.197208 0.197
NP_442065.1_7 Reverse -161 -179 1.98577 0.222
NP_440297.1_9 Forward -178 -168 -0.118297 0.282
NP_440297.1_9 Reverse -171 -181 -0.118297 0.282
NP_442187.1_3 Reverse -386 -396 12.9597 0.289
NP_442280.1_10 Reverse -76 -94 12.3699 0.182
NP_442280.1_10 Reverse -70 -88 10.3244 0.223
NP_441896.1_5 Forward -216 -209 12.2322 0.273
NP_440894.1_10 Forward -184 -165 8.35759 0.178
NP_440999.1_1 Forward -38 -19 4.52188 0.232
NP_440999.1_9 Forward -183 -169 19.9608 0.0114
NP_440999.1_9 Reverse -104 -118 -0.688726 0.214
NP_440888.1_2 Reverse -170 -184 15.2402 0.0118
NP_440888.1_2 Forward -179 -165 8.55376 0.156
NP_442892.1_9 Reverse -373 -387 14.0603 0.293
NP_440822.1_8 Forward -362 -343 8.65258 0.258
NP_442033.1_10 Forward -191 -172 -12.5869 0.273
NP_441543.1_2 Reverse -171 -180 18.486 0.00236
NP_441543.1_2 Forward -178 -169 16.9127 0.00359
NP_442845.1_2 Reverse -164 -178 5.40779 0.233
NP_442845.1_2 Forward -95 -81 4.42448 0.259
NP_441551.1_5 Reverse -228 -244 9.30094 0.21
NP_441469.1_8 Forward -180 -171 16.126 0.00797
NP_441469.1_8 Reverse -169 -178 6.48957 0.227
NP_443064.1_6 Forward -179 -169 12.5669 0.0796
NP_441306.1_10 Forward -171 -157 12.9786 0.25
NP_442578.1_7 Forward -178 -171 14.5921 0.026
NP_442578.1_7 Reverse -171 -178 14.5921 0.026
NP_441462.1_2 Forward -179 -169 11.5831 0.00406
NP_441462.1_2 Reverse -170 -180 11.5831 0.00406
NP_441621.1_7 Reverse -168 -182 -3.34366 0.188
NP_441621.1_7 Reverse -230 -244 -4.22864 0.214
NP_443062.1_1 Reverse -170 -188 17.2241 0.026
NP_443062.1_1 Forward -179 -161 12.4462 0.0796
NP_442204.1_1 Forward -183 -172 11.5634 0.0565
NP_442204.1_1 Forward -245 -234 2.12362 0.266
NP_442204.1_1 Forward -87 -76 1.82863 0.266
NP_442204.1_1 Reverse -82 -93 -0.137991 0.286
NP_440516.1_2 Forward -185 -167 12.0155 0.0708
NP_440516.1_6 Reverse -80 -94 11.1104 0.217
NP_440516.1_8 Forward -179 -170 16.9127 0.00442
NP_440516.1_8 Reverse -170 -179 16.9127 0.00442
NP_440516.1_8 Reverse -387 -396 7.07956 0.0867
NP_442428.1_5 Forward -178 -171 15.8704 0.0124
NP_442428.1_5 Reverse -171 -178 15.8704 0.0124
NP_440673.1_2 Reverse -160 -179 12.3406 0.149
NP_440673.1_2 Reverse -228 -247 8.82876 0.263
NP_440673.1_2 Reverse -310 -329 8.63366 0.264
NP_440673.1_2 Forward -324 -305 8.04834 0.284
NP_440673.1_3 Forward -177 -170 12.4288 0.0426
NP_440673.1_3 Reverse -172 -179 12.4288 0.0426
NP_440673.1_3 Reverse -101 -108 6.62729 0.281
NP_440865.1_9 Reverse -164 -183 3.14605 0.105
NP_441052.1_2 Forward -179 -169 19.9412 0.00106
NP_441052.1_2 Reverse -170 -180 10.5014 0.0285
NP_441052.1_2 Reverse -86 -96 4.10993 0.166
NP_441052.1_2 Forward -95 -85 4.0116 0.168
NP_442219.1_8 Forward -333 -314 6.52434 0.294
NP_442219.1_9 Forward -178 -169 17.7976 0.00718
NP_442219.1_9 Reverse -171 -180 8.35786 0.0681
NP_442219.1_9 Reverse -133 -142 2.55633 0.252
NP_440436.1_4 Reverse -171 -180 18.1905 0.00233
NP_440436.1_4 Forward -178 -169 17.2072 0.00233
NP_441884.1_9 Forward -326 -307 -12.1936 0.138
NP_441884.1_9 Reverse -105 -124 -12.7836 0.138
NP_440314.1_9 Reverse -171 -190 -10.0303 0.282
NP_442907.1_2 Forward -178 -160 8.96727 0.257
NP_441719.1_4 Forward -178 -171 16.3621 0.0124
NP_441719.1_4 Reverse -171 -178 16.3621 0.0124
NP_441733.1_10 Reverse -167 -180 9.85238 0.106
NP_441004.1_1 Reverse -164 -183 -15.6352 0.276
NP_441004.1_5 Reverse -219 -233 10.3243 0.248
NP_442366.1_3 Forward -180 -162 2.0841 0.135
NP_442366.1_5 Reverse -167 -177 14.8275 0.0375
NP_439949.1_7 Forward -141 -127 10.3243 0.293
NP_440129.1_10 Forward -248 -234 3.24451 0.22
NP_442873.1_5 Forward -40 -21 8.65176 0.259
NP_440296.1_10 Reverse -179 -198 -12.8819 0.269
NP_440296.1_10 Reverse -22 -41 -15.3402 0.294
NP_441729.1_4 Reverse -30 -49 10.0292 0.293
NP_442206.1_10 Reverse -170 -185 1.15987 0.236
NP_442854.1_6 Forward -179 -160 2.3594 0.272
NP_443054.1_2 Forward -181 -167 9.34103 0.0995
NP_442430.1_10 Forward -189 -170 11.6017 0.245
NP_441851.1_7 Reverse -227 -246 9.43923 0.286
NP_441851.1_10 Forward -180 -170 16.008 0.00552
NP_441851.1_10 Reverse -169 -179 15.8113 0.00552
NP_441851.1_10 Reverse -359 -369 8.33817 0.118
NP_441668.1_4 Reverse -311 -330 3.83436 0.183
NP_441668.1_4 Forward -139 -120 -1.67217 0.278
NP_442515.1_1 Reverse -169 -183 -4.52363 0.298
NP_441683.1_7 Forward -89 -70 -12.9802 0.3
NP_440593.1_3 Reverse -165 -184 -5.50708 0.261
NP_440593.1_3 Forward -100 -81 -6.78538 0.28
NP_441982.1_6 Forward -52 -43 12.4854 0.275
NP_440463.1_6 Forward -182 -163 6.39097 0.295
NP_442709.1_3 Reverse -163 -182 9.14423 0.121
NP_441046.1_2 Forward -340 -321 5.211 0.227
NP_441349.1_10 Reverse -160 -179 15.7324 0.0122
NP_441409.1_6 Forward -185 -166 2.45773 0.0584
NP_440432.1_9 Forward -178 -163 -2.77337 0.175
NP_442843.1_1 Reverse -306 -325 0.687771 0.17
NP_442843.1_1 Reverse -87 -106 -5.31042 0.244
NP_442843.1_1 Forward -363 -344 -9.93197 0.272
NP_442843.1_1 Reverse -224 -243 -11.9969 0.296
NP_440474.1_8 Forward -325 -311 4.03056 0.294
NP_442450.1_5 Reverse -168 -178 7.55152 0.13
NP_440588.1_2 Forward -188 -169 -4.42544 0.216
NP_440195.1_5 Reverse -289 -308 2.45773 0.276
NP_442006.1_2 Forward -89 -72 -17.4641 0.276
NP_442006.1_3 Reverse -306 -324 -5.29072 0.298
NP_441003.1_9 Reverse -77 -96 13.5691 0.213
NP_441003.1_9 Forward -98 -79 6.68596 0.242
NP_442243.1_1 Forward -185 -167 3.8533 0.2
NP_442243.1_1 Reverse -80 -98 -3.02983 0.298
NP_441570.1_1 Forward -179 -161 7.78729 0.0159
NP_440078.1_8 Reverse -153 -172 1.67108 0.272
NP_440078.1_10 Reverse -170 -189 7.17762 0.218
NP_441078.1_4 Forward -179 -170 19.6659 0.0007
NP_441078.1_4 Reverse -170 -179 19.6659 0.0007
NP_441078.1_4 Forward -95 -86 -1.6719 0.266
NP_441078.1_4 Reverse -86 -95 -1.77023 0.266
NP_442729.1_5 Forward -90 -80 14.6313 0.214
NP_442729.1_5 Reverse -85 -95 7.84651 0.261
NP_442348.1_2 Reverse -38 -47 17.011 0.055
NP_442443.1_1 Reverse -306 -325 6.19431 0.155
NP_442443.1_1 Reverse -33 -52 -5.11376 0.281
NP_442443.1_1 Reverse -174 -193 -6.39206 0.294
NP_440526.1_3 Forward -178 -167 10.2846 0.0646
NP_441432.1_8 Reverse -169 -178 16.8143 0.00595
NP_441432.1_8 Forward -242 -233 8.35786 0.0755
NP_441432.1_8 Forward -180 -171 8.25953 0.0755
NP_442320.1_8 Reverse -164 -178 5.99778 0.0309
NP_442320.1_8 Forward -185 -171 -0.787057 0.0817
NP_442344.1_7 Forward -178 -159 -6.68705 0.172
NP_441732.1_2 Forward -183 -167 -6.62797 0.0495
NP_441732.1_2 Forward -245 -229 -15.8711 0.163
NP_440760.1_1 Forward -179 -160 -12.7836 0.0947
NP_440760.1_1 Reverse -170 -189 -19.6667 0.219
NP_440760.1_1 Reverse -106 -125 -21.24 0.233
NP_440131.1_4 Forward -96 -77 7.27595 0.243
NP_440199.1_10 Reverse -167 -177 7.25653 0.231
NP_441072.1_2 Reverse -159 -178 15.1424 0.143
NP_440713.1_4 Forward -189 -170 2.65439 0.26
NP_442489.1_7 Forward -179 -170 20.1576 0.000695
NP_442489.1_7 Reverse -170 -179 20.1576 0.000695
NP_442489.1_7 Forward -95 -86 -1.47524 0.203
NP_442489.1_7 Reverse -232 -241 -1.77023 0.247
NP_442489.1_7 Reverse -86 -95 -1.77023 0.247
NP_441452.1_1 Forward -233 -214 12.4875 0.292
NP_442079.1_7 Reverse -171 -190 2.75272 0.223
NP_440559.1_1 Forward -178 -169 17.4043 0.00658
NP_440559.1_1 Reverse -171 -180 8.75118 0.0586
NP_441659.2_8 Forward -179 -169 18.1713 0.00133
NP_441659.2_8 Reverse -170 -180 11.9764 0.0147
NP_441659.2_8 Reverse -86 -96 3.02829 0.177
NP_442913.1_10 Reverse -77 -96 -2.65548 0.19
NP_442913.1_10 Reverse -161 -180 -2.95047 0.195
NP_439956.1_7 Reverse -226 -245 1.17943 0.292
NP_440708.1_6 Reverse -76 -95 -8.06369 0.255
NP_441800.1_3 Reverse -75 -93 3.46073 0.293
NP_442776.1_8 Forward -186 -167 17.5015 0.18
NP_442346.1_5 Reverse -169 -179 16.6963 0.00248
NP_442346.1_5 Reverse -85 -95 13.353 0.0261
NP_442346.1_5 Forward -180 -170 9.02648 0.118
NP_442346.1_5 Forward -96 -86 4.99491 0.267
NP_440545.1_3 Reverse -166 -183 9.77361 0.0374
NP_440545.1_3 Forward -245 -228 -3.69774 0.21
NP_441856.1_3 Reverse -167 -186 -0.295539 0.217
NP_440486.1_6 Forward -271 -252 5.30933 0.298
NP_440459.1_2 Forward -398 -381 11.8386 0.166
NP_441653.1_2 Forward -252 -233 3.04645 0.277
NP_442551.1_4 Reverse -318 -333 5.97809 0.214
NP_442900.1_1 Reverse -23 -42 -6.29373 0.238
NP_442603.1_7 Reverse -170 -184 9.6354 0.144
NP_442603.1_7 Forward -396 -382 7.17714 0.211
NP_442603.1_7 Reverse -278 -292 6.78381 0.23
NP_441888.1_7 Forward -184 -170 13.5693 0.0743
NP_441888.1_8 Reverse -308 -327 11.7992 0.28
NP_441948.1_4 Reverse -163 -181 -1.25915 0.145
NP_441833.1_4 Forward -178 -171 15.9687 0.0124
NP_441833.1_4 Reverse -171 -178 15.9687 0.0124
NP_441895.1_10 Reverse -277 -296 -27.7299 0.29
NP_441895.1_10 Forward -20 -1 -27.8282 0.299
NP_442162.1_9 Forward -178 -171 16.2637 0.0124
NP_442162.1_9 Reverse -171 -178 16.2637 0.0124
NP_442162.1_10 Reverse -17 -36 16.6125 0.216
NP_440671.1_4 Forward -185 -171 9.93102 0.168
NP_440671.1_4 Reverse -164 -178 5.80112 0.271
NP_442199.1_5 Forward -187 -168 -3.54046 0.208
NP_442140.1_3 Reverse -171 -181 14.238 0.0486
NP_442140.1_3 Forward -178 -168 12.2714 0.0632
NP_442140.1_3 Reverse -87 -97 5.97822 0.189
NP_442723.1_1 Reverse -70 -89 4.52188 0.276
NP_441692.1_2 Forward -20 -1 4.62101 0.169
NP_440875.1_9 Reverse -172 -182 17.327 0.0126
NP_440875.1_9 Forward -333 -323 11.1948 0.179
NP_441813.1_5 Forward -181 -171 19.4496 0.00647
NP_441813.1_5 Reverse -168 -178 8.63316 0.0367
NP_442254.1_1 Reverse -74 -93 -5.40875 0.282
NP_440590.1_4 Reverse -171 -184 15.4572 0.0106
NP_440590.1_4 Forward -178 -165 9.36073 0.0365
NP_440590.1_4 Forward -395 -382 -0.472371 0.189
NP_440567.1_1 Reverse -171 -185 1.67122 0.196
NP_440567.1_1 Forward -178 -164 -0.0987402 0.264
NP_442497.1_10 Forward -178 -169 10.4228 0.0087
NP_442497.1_10 Reverse -171 -180 10.4228 0.0087
NP_440821.1_4 Forward -181 -171 10.2065 0.0163
NP_440821.1_4 Reverse -168 -178 9.41981 0.0286
NP_441239.1_9 Forward -181 -169 14.1986 0.0288
NP_441239.1_9 Reverse -168 -180 5.93884 0.202
NP_441951.1_7 Forward -24 -10 15.9379 0.278
NP_441009.1_4 Reverse -170 -189 10.1275 0.278
NP_441892.1_1 Reverse -161 -178 6.23369 0.0995
NP_442082.1_10 Reverse -117 -136 14.2574 0.233
NP_440604.1_6 Forward -117 -98 -5.50708 0.278
NP_442643.1_3 Reverse -15 -34 3.24438 0.149
NP_440833.1_6 Forward -104 -90 10.0287 0.255
NP_442216.1_4 Forward -188 -180 8.08217 0.255
NP_443035.1_10 Reverse -307 -324 6.82368 0.273
NP_441617.1_8 Forward -173 -154 10.0284 0.289
NP_442138.1_9 Forward -192 -173 7.96345 0.281
NP_440546.1_4 Reverse -170 -180 11.8882 0.0679
NP_440546.1_4 Forward -179 -169 10.046 0.109
NP_440462.1_6 Forward -181 -171 17.2863 0.00752
NP_440462.1_6 Reverse -168 -178 1.35667 0.294
NP_440868.1_4 Forward -183 -171 10.5604 0.0364
NP_440868.1_4 Reverse -166 -178 5.93884 0.0879
NP_442479.1_9 Forward -171 -152 -8.752 0.266
NP_441868.1_2 Reverse -43 -62 13.2741 0.224
NP_441474.1_1 Reverse -107 -126 0.392004 0.255
NP_442402.1_2 Reverse -39 -53 11.7003 0.272
NP_442402.1_10 Reverse -42 -52 13.0576 0.204
NP_441848.1_7 Forward -48 -29 2.35861 0.224
NP_440696.1_3 Reverse -228 -246 0.805796 0.225
NP_442039.1_4 Forward -178 -171 15.1821 0.0124
NP_442039.1_4 Reverse -171 -178 15.1821 0.0124
NP_442039.1_7 Reverse -357 -367 11.9764 0.257
NP_442679.1_1 Reverse -259 -278 -4.72043 0.283
NP_440825.1_7 Forward -178 -168 12.9096 0.152
NP_442837.1_3 Forward -178 -171 15.7721 0.0124
NP_442837.1_3 Reverse -171 -178 15.7721 0.0124
NP_442053.1_1 Forward -179 -170 18.3876 0.0007
NP_442053.1_1 Reverse -170 -179 18.3876 0.0007
NP_440505.1_3 Forward -181 -171 15.9097 0.00857
NP_440505.1_3 Reverse -168 -178 9.22315 0.122
NP_440505.1_3 Forward -243 -233 6.07655 0.197
NP_442532.1_7 Forward -241 -227 4.12949 0.178
NP_440914.1_1 Forward -179 -169 17.5935 0.000537
NP_440914.1_1 Reverse -387 -397 9.59102 0.183
NP_440914.1_1 Reverse -170 -180 8.6151 0.186
NP_441011.1_8 Reverse -171 -180 16.9127 0.00602
NP_441011.1_8 Forward -178 -169 8.25953 0.144
NP_442533.1_1 Reverse -24 -43 -5.31042 0.155
NP_442533.1_6 Forward -179 -170 17.2076 0.00137
NP_442533.1_6 Reverse -170 -179 17.2076 0.00137
NP_442533.1_6 Forward -95 -86 6.98123 0.0992
NP_442533.1_6 Reverse -86 -95 6.68623 0.105
NP_442533.1_6 Reverse -321 -330 3.24465 0.219
NP_442541.1_10 Reverse -295 -309 2.75226 0.254
NP_442232.1_3 Reverse -162 -181 -13.5702 0.282
NP_442229.1_1 Reverse -168 -182 7.3738 0.196
NP_441482.1_7 Forward -247 -233 4.81781 0.0442
NP_441482.1_7 Forward -185 -171 -0.688726 0.0612
NP_441482.1_7 Reverse -164 -178 -8.65353 0.193
NP_439944.1_9 Forward -178 -168 10.5014 0.0887
NP_441028.1_6 Reverse -43 -53 7.35439 0.229
NP_440116.1_8 Reverse -171 -190 4.03102 0.0747
NP_441527.1_4 Forward -78 -59 -9.31089 0.256
NP_441527.1_4 Forward -76 -57 -9.40638 0.258
NP_441527.1_4 Forward -389 -370 -12.7486 0.293
NP_441527.1_7 Forward -174 -155 7.27514 0.29
NP_440115.1_6 Forward -182 -172 7.64985 0.146
NP_440007.1_9 Reverse -383 -397 6.19444 0.231
NP_440007.1_9 Forward -183 -169 1.96621 0.281
NP_441961.1_4 Reverse -32 -51 2.16274 0.299
NP_441972.1_5 Forward -252 -233 -3.83545 0.201
NP_441972.1_5 Forward -94 -75 -10.227 0.3
NP_441106.1_1 Forward -180 -171 18.191 0.0028
NP_441106.1_1 Reverse -169 -178 9.63616 0.0311
NP_440429.1_4 Forward -307 -288 11.2092 0.296
NP_441869.1_9 Reverse -294 -313 12.9791 0.293
NP_439903.1_6 Forward -182 -163 -1.37794 0.299
NP_442306.1_10 Forward -184 -165 -18.8801 0.197
NP_442306.1_10 Forward -334 -315 -21.4367 0.27
NP_441286.1_1 Reverse -169 -181 6.03717 0.0258
NP_441286.1_1 Forward -180 -168 3.38223 0.0467
NP_440670.1_8 Forward -179 -170 18.3876 0.000699
NP_440670.1_8 Reverse -170 -179 18.3876 0.000699
NP_441930.1_2 Reverse -181 -191 16.2046 0.19
NP_440886.1_7 Forward -180 -170 17.7774 0.0011
NP_440886.1_7 Forward -34 -24 8.43603 0.0805
NP_440886.1_7 Reverse -169 -179 7.94438 0.0805
NP_440886.1_7 Forward -41 -31 3.32285 0.287
NP_442382.1_7 Forward -192 -173 5.211 0.252
NP_442072.1_9 Reverse -169 -187 -13.5505 0.115
NP_442072.1_9 Forward -180 -162 -22.2037 0.225
NP_442213.1_5 Forward -275 -256 8.45592 0.161
NP_440907.2_8 Reverse -171 -181 7.94438 0.117
NP_440907.2_8 Forward -178 -168 7.64939 0.117
NP_441463.1_3 Forward -189 -170 -8.55534 0.271
NP_442842.1_10 Reverse -69 -88 3.66898 0.244
NP_441626.1_2 Forward -178 -171 15.7721 0.0124
NP_441626.1_2 Reverse -171 -178 15.7721 0.0124
NP_442794.1_1 Forward -183 -171 10.4621 0.0721
NP_442794.1_1 Reverse -166 -178 2.69391 0.286
NP_442615.1_1 Reverse -161 -179 6.50899 0.0344
NP_441962.1_4 Reverse -165 -184 -10.3253 0.226
NP_440387.1_1 Forward -179 -163 3.59845 0.0551
NP_440387.1_1 Reverse -170 -186 -1.71142 0.143
NP_440387.1_1 Forward -241 -225 -6.62797 0.298
NP_440855.1_1 Forward -341 -322 1.27776 0.226
NP_441431.1_2 Forward -182 -168 19.8618 0.00685
NP_441431.1_3 Reverse -182 -201 2.65439 0.282
NP_441993.1_1 Reverse -164 -183 13.4467 0.0855
NP_441174.1_1 Reverse -172 -187 10.8946 0.262
NP_440114.1_10 Forward -179 -165 11.701 0.106
NP_442437.1_8 Reverse -306 -325 6.68596 0.242
NP_441510.2_7 Forward -95 -81 13.077 0.28
NP_441272.1_4 Reverse -378 -397 0.58944 0.258
NP_441272.1_10 Reverse -176 -190 15.9292 0.244
NP_439988.1_3 Forward -297 -283 5.60446 0.28
NP_441237.1_9 Forward -178 -168 14.828 0.0242
NP_440643.1_6 Forward -94 -75 0.982764 0.276
NP_441531.1_6 Forward -296 -283 11.819 0.254
NP_439910.1_2 Forward -187 -170 -3.00942 0.0318
NP_439910.1_2 Reverse -162 -179 -13.7275 0.162
NP_442867.1_8 Reverse -146 -165 5.99764 0.273
NP_440457.1_1 Forward -183 -171 7.61046 0.101
NP_440457.1_1 Reverse -177 -189 0.333971 0.25
NP_441981.1_3 Forward -51 -37 16.6453 0.268
NP_440142.1_7 Forward -83 -64 7.07928 0.259
NP_441984.1_3 Reverse -310 -328 5.32902 0.287
NP_441436.1_8 Reverse -169 -188 8.35759 0.283
NP_442509.1_9 Reverse -170 -180 16.2041 0.00739
NP_442509.1_9 Forward -241 -231 9.02601 0.192
NP_442509.1_9 Forward -179 -169 8.14104 0.192
NP_442439.1_8 Forward -96 -77 10.5209 0.246
NP_442514.1_5 Reverse -78 -97 -0.492971 0.184
NP_440554.1_4 Reverse -171 -181 16.4996 0.0189
NP_442862.1_3 Reverse -154 -171 17.2468 0.137
NP_442862.1_3 Forward -169 -152 4.75873 0.287
NP_441885.1_5 Forward -179 -169 20.9245 0.000538
NP_441885.1_5 Reverse -170 -180 11.4848 0.00668
NP_440478.1_10 Forward -316 -302 6.98109 0.279
NP_442341.1_7 Reverse -169 -183 10.9143 0.0591
NP_442341.1_7 Forward -180 -166 8.35772 0.0881
NP_442341.1_7 Forward -397 -383 2.5562 0.252
NP_442341.1_9 Forward -181 -167 17.8952 0.0212
NP_441756.1_5 Forward -183 -164 0.982764 0.222
NP_441173.1_9 Reverse -44 -52 13.1954 0.184
NP_440423.1_6 Reverse -162 -181 -13.1769 0.211
NP_443000.1_7 Forward -181 -171 11.5831 0.0344
NP_443000.1_7 Reverse -168 -178 10.3048 0.0345
NP_443000.1_7 Forward -243 -233 1.16001 0.271
NP_440076.1_9 Forward -304 -291 17.4232 0.192
NP_440275.1_3 Forward -181 -171 15.418 0.0178
NP_440275.1_3 Reverse -168 -178 8.04317 0.0602
NP_440091.1_1 Reverse -166 -178 8.88877 0.0567
NP_440679.1_10 Forward -342 -323 -21.7317 0.297
NP_443010.1_10 Reverse -35 -52 8.27892 0.161
NP_442451.1_2 Forward -312 -293 -5.50708 0.224
NP_442686.1_5 Forward -196 -177 17.5024 0.241
NP_441122.1_1 Reverse -82 -97 11.1896 0.216
NP_440175.1_7 Reverse -228 -246 9.75348 0.276
NP_440149.1_8 Reverse -164 -183 -1.7705 0.162
NP_440149.1_8 Forward -179 -160 -7.96535 0.296
NP_441105.1_3 Forward -190 -171 -3.3438 0.177
NP_441105.1_3 Forward -100 -81 -8.26035 0.269
NP_440216.1_1 Reverse -170 -184 7.66941 0.00931
NP_440216.1_1 Forward -179 -165 -1.77037 0.0383
NP_440216.1_9 Forward -245 -236 13.8644 0.184
NP_440216.1_9 Forward -93 -84 7.37455 0.286
NP_440172.1_1 Forward -179 -169 15.0247 0.00945
NP_440172.1_1 Reverse -170 -180 8.73149 0.0586
NP_442015.1_10 Forward -183 -170 21.4554 0.00329
NP_442015.1_10 Reverse -82 -95 4.64084 0.166
NP_442015.1_10 Reverse -166 -179 1.59258 0.204
NP_441226.1_7 Forward -178 -171 14.4934 0.0123
NP_441226.1_7 Reverse -171 -178 14.4934 0.0123
NP_441226.1_7 Reverse -388 -395 6.82361 0.246
NP_440198.1_3 Forward -45 -26 17.5998 0.231
NP_442834.1_9 Forward -165 -146 12.3892 0.121
NP_441111.1_7 Forward -178 -170 18.7023 0.00294
NP_441111.1_7 Reverse -171 -179 18.7023 0.00294
NP_441111.1_7 Reverse -233 -241 -0.668896 0.274
NP_441766.1_2 Forward -179 -170 17.5026 0.00297
NP_441766.1_2 Reverse -170 -179 17.5026 0.00297
NP_442417.1_5 Reverse -170 -184 9.5377 0.13
NP_440416.1_9 Reverse -163 -182 -9.047 0.125
NP_440416.1_9 Reverse -79 -98 -18.4868 0.259
NP_443052.1_8 Reverse -160 -179 -1.27885 0.0786
NP_442154.1_1 Reverse -22 -40 -17.3854 0.254
NP_440261.1_5 Reverse -171 -184 4.93583 0.0478
NP_440988.1_10 Forward -91 -77 4.31795 0.266
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTATCCGGATCGGCATAGGTAAAGGAAAGTATGGGTTCCCAAGGCTTAATTTGTTGCACTGGGACATTGAGGGCAGCGGCCAAATCTTCCAGGGCTAGAAATTGCACCCCCATGGTGCTCAATTCTTTTAGTTGTCGGGCCTGGTGAATAGATAACCCAGGCAAACGCAGCCATTCATCCACTGTGGCTTGGTTAACTTCAATCCTGAGGCCCAATTCCCCGGCGATCGCCAATTCTTGCCAAGATTGAAAACGGTAGTAGGGATCATTTTGCAGACGACGTTGGAGAGCCCGGCGACGAAAATTGACCATGGCCAAGGGGAAGGAAAGGGAACAAATACAATTTTAGTGGGGAAAAATCCCCGCCCCCCAACCATCTGGGATTGTAGAAATAGGGGAAG

CDS

ATGGTATGGAGGCATTTCACCCCCTGCAATGGCACAAGCATAATGAATTGGCATATTAGCGACGCCCAAAACCTAGCCACCATCGACTATGAAATCGGGGACCATGGCCATAGCCCTGCTCAGTATGAGATTCTGCGGCGAGTTATCTACGCCACGGGGGATTTTGAGTACCTCAACCTACTGCATTTTTCCGCCCGGGTACTGACGGTGGGGGCCGCCGCTTTAGCATCCCGCACCACCATTCTTGTGGACGTGCCCATGGTACAGGTAGGCATTGTCCCCACTTTGCAAAAGACCTTTGCCAACCCTGTTTATTGTGCTACCCAAAGCATTACCAGGCCCCAAAAGGAAAGAACAGAGGAAGCCTGGGGCATATTGAACTTGGCCCACCGTTACCCAGATGGGATTTTCGTAATTGGTCACGCCCAAACCGCCTTAGATGCCCTGATGGAGTTAGTAGAAGCCCAACGCATCCAGCCGGCCCTGGTCATTGCCACCGCCACTAATTTTGGCGATCGCCAAGACGTGGAATTAAATTTGCAAAAAGCTAACATACCCCACATCATAGTCCAGGGAAGAAAAGGGGGGACAGAGGTGGCCGTGGCCATCATTACTGCCCTAGTGGATTTAGCTTGGCAAGCCTATGAACAAAGGGCCCACCTAAATTAG

Protein

MVWRHFTPCNGTSIMNWHISDAQNLATIDYEIGDHGHSPAQYEILRRVIYATGDFEYLNLLHFSARVLTVGAAALASRTTILVDVPMVQVGIVPTLQKTFANPVYCATQSITRPQKERTEEAWGILNLAHRYPDGIFVIGHAQTALDALMELVEAQRIQPALVIATATNFGDRQDVELNLQKANIPHIIVQGRKGGTEVAVAIITALVDLAWQAYEQRAHLN