Your browser is old and dusty. Try Google Chrome!

Details for slr1464

ORF slr1464
Accession NP_442852.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440897.1_6 Reverse -101 -120 6.78348 0.0893
NP_441453.1_4 Reverse -77 -85 9.85252 0.0466
NP_441453.1_8 Reverse -40 -57 10.2653 0.239
NP_441623.1_1 Reverse -362 -380 7.4923 0.139
NP_441818.1_9 Reverse -235 -254 -6.09707 0.259
NP_440226.1_1 Forward -110 -91 1.76941 0.29
NP_440259.1_4 Forward -131 -117 8.9251 0.286
NP_443027.1_4 Forward -112 -102 8.23984 0.215
NP_442975.1_10 Forward -380 -366 2.16228 0.283
NP_441054.1_3 Forward -243 -225 18.15 0.138
NP_441900.1_2 Forward -254 -236 -2.63651 0.279
NP_441859.1_3 Reverse -309 -328 7.27514 0.162
NP_440370.1_10 Reverse -92 -111 11.2092 0.191
NP_442726.1_1 Reverse -193 -212 13.3725 0.154
NP_441925.1_4 Forward -254 -235 -7.6711 0.196
NP_441083.1_5 Reverse -303 -313 3.91327 0.162
NP_441149.1_9 Forward -123 -104 -2.16459 0.291
NP_442889.1_1 Reverse -375 -394 -15.3402 0.289
NP_441327.1_5 Reverse -115 -124 14.651 0.192
NP_440644.1_3 Forward -231 -212 3.6377 0.205
NP_442330.1_4 Reverse -149 -168 13.287 0.286
NP_440842.1_10 Reverse -329 -343 2.5562 0.274
NP_440057.1_8 Forward -213 -194 15.9291 0.232
NP_440057.1_8 Reverse -180 -199 11.5042 0.298
NP_442848.1_5 Reverse -330 -348 -3.22577 0.29
NP_443018.1_3 Forward -49 -42 5.34899 0.212
NP_443018.1_3 Reverse -102 -109 4.26735 0.267
NP_443018.1_3 Forward -109 -102 4.07068 0.299
NP_441857.1_2 Reverse -201 -220 20.0548 0.21
NP_441077.1_6 Reverse -2 -18 9.64675 0.167
NP_441846.1_10 Reverse -241 -260 -13.0786 0.197
NP_441846.1_10 Forward -364 -345 -13.5702 0.206
NP_441950.1_5 Reverse -381 -400 16.4832 0.222
NP_441950.1_7 Reverse -235 -254 5.99764 0.133
NP_442658.1_1 Reverse -354 -364 6.86274 0.214
NP_442658.1_1 Reverse -99 -109 6.66608 0.219
NP_442937.1_5 Forward -317 -298 9.0459 0.204
NP_442321.1_4 Forward -148 -129 -8.45701 0.289
NP_441127.1_1 Reverse -107 -121 13.4709 0.191
NP_439905.1_1 Reverse -293 -306 11.1307 0.204
NP_439990.1_5 Forward -273 -260 5.32916 0.298
NP_441591.1_10 Reverse -253 -272 6.29264 0.286
NP_440602.1_2 Reverse -192 -211 8.65258 0.195
NP_440475.1_1 Reverse -347 -366 12.4324 0.23
NP_441041.1_4 Reverse -370 -389 -12.8819 0.276
NP_442996.1_7 Reverse -16 -35 12.6081 0.296
NP_439966.1_7 Reverse -354 -364 8.82935 0.13
NP_442500.1_8 Reverse -119 -133 11.1424 0.267
NP_441164.1_1 Forward -332 -313 -0.590531 0.207
NP_441196.1_9 Reverse -214 -233 15.6341 0.202
NP_441644.1_6 Reverse -91 -101 3.12618 0.297
NP_442215.1_2 Reverse -68 -84 8.515 0.0643
NP_442215.1_2 Reverse -256 -272 -5.64466 0.254
NP_442029.1_1 Reverse -89 -108 -12.4886 0.247
NP_442029.1_10 Forward -157 -138 15.7324 0.145
NP_440566.1_2 Reverse -225 -244 7.7676 0.216
NP_442142.1_4 Reverse -262 -275 7.78685 0.13
NP_442476.1_6 Forward -254 -240 1.08123 0.231
NP_441468.1_1 Reverse -102 -109 4.07068 0.263
NP_441244.1_8 Forward -367 -348 4.12936 0.144
NP_441876.1_9 Reverse -277 -287 13.2542 0.267
NP_441826.1_5 Forward -358 -339 5.99764 0.225
NP_441764.1_8 Reverse -152 -162 11.4064 0.284
NP_441764.1_8 Reverse -114 -124 10.8322 0.297
NP_441251.1_7 Forward -144 -131 14.0806 0.266
NP_442361.1_3 Forward -369 -356 8.27909 0.285
NP_441518.1_3 Reverse -318 -337 -14.7502 0.28
NP_441557.1_8 Forward -249 -239 13.2542 0.224
NP_441590.1_4 Forward -259 -240 3.63691 0.29
NP_441433.1_8 Forward -369 -350 -0.688862 0.249
NP_442777.1_3 Reverse -354 -372 0.313405 0.297
NP_442777.1_10 Forward -202 -183 13.3725 0.272
NP_442830.1_5 Forward -202 -188 5.89884 0.225
NP_442397.1_9 Forward -207 -188 7.17762 0.246
NP_440299.1_1 Forward -114 -101 5.42692 0.176
NP_442333.2_2 Reverse -148 -167 11.7992 0.0806
NP_442961.1_4 Forward -159 -140 3.34271 0.288
NP_442852.1_1 Forward -75 -57 20.3728 0.106
NP_442852.1_2 Forward -320 -301 22.9106 0.0367
NP_441559.1_8 Forward -384 -370 -7.76856 0.299
NP_442158.1_4 Forward -147 -137 14.9263 0.176
NP_441866.1_4 Forward -17 -4 16.26 0.245
NP_441866.1_4 Forward -124 -111 12.9531 0.28
NP_441464.1_10 Forward -314 -300 9.5377 0.262
NP_440306.1_3 Forward -26 -7 10.5209 0.295
NP_441494.1_6 Forward -287 -274 7.29578 0.267
NP_442993.1_1 Forward -86 -70 -9.5779 0.188
NP_442993.1_1 Reverse -339 -355 -12.3312 0.27
NP_442993.1_1 Forward -63 -47 -12.8228 0.281
NP_442993.1_1 Reverse -340 -356 -13.2161 0.288
NP_441750.1_1 Reverse -136 -155 10.0292 0.0978
NP_441340.1_5 Forward -109 -102 3.97235 0.274
NP_441340.1_9 Reverse -115 -125 8.54444 0.256
NP_441952.1_9 Reverse -106 -125 12.9187 0.29
NP_440161.1_3 Reverse -117 -136 15.1424 0.117
NP_440586.1_8 Forward -109 -102 9.57686 0.146
NP_440586.1_8 Reverse -92 -99 5.8403 0.283
NP_440027.1_3 Reverse -91 -109 10.3431 0.175
NP_440027.1_3 Forward -206 -188 3.65664 0.267
NP_439937.1_8 Reverse -244 -263 -2.26216 0.256
NP_439937.1_9 Reverse -271 -288 -11.4665 0.256
NP_440439.1_1 Reverse -188 -201 -0.275709 0.211
NP_440439.1_1 Reverse -248 -261 -1.45568 0.269
NP_440574.1_7 Forward -147 -128 17.8957 0.0733
NP_441789.1_7 Reverse -345 -364 -5.60616 0.299
NP_440819.1_5 Forward -357 -349 7.8859 0.266
NP_442663.1_1 Reverse -118 -137 8.84842 0.193
NP_441616.1_2 Forward -204 -185 -1.57384 0.27
NP_442262.1_10 Forward -49 -42 7.6106 0.274
NP_440531.1_6 Forward -259 -240 -4.72043 0.286
NP_442065.1_7 Forward -300 -282 1.10079 0.251
NP_440297.1_9 Reverse -92 -102 0.0783647 0.282
NP_440297.1_9 Reverse -102 -112 -0.41329 0.283
NP_441771.1_4 Reverse -114 -133 -4.91709 0.295
NP_440575.1_1 Forward -126 -107 -0.591301 0.29
NP_442077.1_9 Forward -171 -152 -3.63879 0.22
NP_441178.1_6 Forward -254 -235 6.09517 0.268
NP_441469.1_8 Forward -111 -102 5.40793 0.272
NP_440519.1_8 Forward -324 -308 0.845183 0.298
NP_441351.1_8 Forward -290 -271 4.22769 0.225
NP_440104.1_2 Reverse -165 -184 19.764 0.0996
NP_442428.1_5 Reverse -102 -109 4.46401 0.267
NP_442428.1_7 Reverse -154 -173 7.7676 0.24
NP_441867.1_2 Reverse -231 -250 -12.7836 0.27
NP_440673.1_2 Forward -120 -101 15.7549 0.0871
NP_440673.1_2 Forward -110 -91 8.73121 0.263
NP_442219.1_8 Forward -322 -303 9.42334 0.23
NP_440436.1_4 Forward -254 -245 8.06244 0.118
NP_442412.1_7 Reverse -259 -278 18.0924 0.154
NP_441363.1_4 Reverse -271 -290 8.06259 0.277
NP_441004.1_4 Forward -373 -363 7.84651 0.286
NP_442366.1_3 Reverse -245 -263 1.10079 0.158
NP_442694.1_4 Forward -139 -130 14.8477 0.164
NP_442312.1_1 Forward -150 -131 9.93088 0.282
NP_441396.1_5 Reverse -236 -245 8.25953 0.224
NP_441046.1_2 Forward -228 -209 -1.27885 0.288
NP_442689.1_8 Forward -124 -107 -6.94266 0.292
NP_441394.1_6 Reverse -244 -263 15.5947 0.298
NP_442843.1_1 Reverse -92 -111 -11.9969 0.296
NP_441477.1_10 Reverse -285 -303 -0.472507 0.291
NP_442006.1_2 Forward -241 -224 -16.1858 0.243
NP_441450.1_3 Reverse -193 -212 11.5033 0.126
NP_441570.1_1 Forward -110 -92 -16.1071 0.238
NP_442348.1_2 Forward -140 -131 14.5527 0.147
NP_442348.1_2 Forward -80 -71 12.2911 0.218
NP_442348.1_2 Forward -139 -130 6.68623 0.299
NP_440707.1_9 Forward -234 -215 1.17943 0.292
NP_442443.1_4 Reverse -113 -123 13.0576 0.264
NP_441328.2_7 Reverse -367 -386 15.6341 0.234
NP_442727.1_1 Forward -151 -137 14.9459 0.221
NP_442407.1_5 Forward -366 -347 17.109 0.265
NP_442400.1_10 Reverse -120 -133 8.36957 0.278
NP_442400.1_10 Reverse -121 -134 8.0831 0.279
NP_442346.1_5 Reverse -90 -100 9.91146 0.114
NP_442346.1_5 Reverse -291 -301 6.37155 0.205
NP_441923.1_6 Forward -369 -355 11.111 0.25
NP_441943.1_8 Reverse -359 -378 -13.4719 0.274
NP_442900.1_1 Reverse -234 -253 -7.57203 0.263
NP_442603.1_7 Reverse -276 -290 8.94708 0.161
NP_440449.1_6 Reverse -236 -254 4.85163 0.288
NP_442070.1_1 Forward -155 -136 11.8975 0.261
NP_442070.1_1 Reverse -225 -244 11.0125 0.288
NP_443040.1_1 Reverse -1 -15 17.9146 0.249
NP_441329.1_3 Forward -337 -327 11.5325 0.295
NP_441044.1_4 Reverse -127 -145 5.52568 0.227
NP_442045.1_5 Forward -264 -245 7.66927 0.197
NP_442140.1_3 Reverse -92 -102 8.23984 0.122
NP_442028.1_1 Forward -16 -3 6.65072 0.298
NP_442568.1_8 Forward -216 -202 18.5841 0.161
NP_441892.1_1 Forward -109 -92 3.0871 0.131
NP_441892.1_1 Reverse -92 -109 -2.51776 0.223
NP_441017.1_8 Reverse -366 -381 7.35472 0.273
NP_440833.1_6 Reverse -117 -131 10.717 0.242
NP_440546.1_4 Forward -86 -76 9.65817 0.126
NP_440546.1_4 Reverse -77 -87 8.88251 0.166
NP_440868.1_4 Reverse -278 -290 0.137309 0.228
NP_441084.1_6 Forward -88 -74 10.7985 0.228
NP_441084.1_6 Forward -399 -385 9.53803 0.278
NP_440696.1_3 Forward -110 -92 -3.6191 0.287
NP_440753.1_5 Forward -89 -70 12.4875 0.132
NP_442829.1_2 Reverse -119 -135 14.1324 0.287
NP_442829.1_2 Reverse -118 -134 9.20406 0.287
NP_441252.1_6 Forward -131 -124 14.1004 0.25
NP_441408.2_7 Forward -225 -206 -1.47551 0.251
NP_442533.1_1 Reverse -232 -251 -14.3569 0.242
NP_442533.1_6 Forward -301 -292 2.35967 0.259
NP_441089.1_10 Forward -243 -224 1.67108 0.294
NP_440263.1_5 Forward -134 -120 10.1277 0.294
NP_441482.1_9 Forward -127 -114 12.605 0.278
NP_441527.1_4 Reverse -144 -163 -4.24981 0.182
NP_441527.1_4 Reverse -3 -22 -9.50187 0.259
NP_441106.1_1 Reverse -100 -109 2.85133 0.255
NP_440429.1_9 Forward -247 -228 3.73603 0.259
NP_439903.1_6 Forward -331 -312 4.62021 0.193
NP_442908.1_1 Forward -159 -140 1.57275 0.277
NP_441705.1_3 Reverse -135 -154 4.62101 0.21
NP_440886.1_7 Reverse -302 -312 3.61784 0.272
NP_440886.1_7 Forward -111 -101 3.42118 0.282
NP_440907.2_10 Forward -208 -189 22.4189 0.0775
NP_442615.1_4 Forward -117 -103 15.5359 0.187
NP_441431.1_3 Reverse -229 -248 6.78429 0.25
NP_442020.1_1 Reverse -119 -138 6.39016 0.211
NP_442020.1_1 Reverse -121 -140 4.52188 0.25
NP_441425.1_4 Reverse -152 -166 15.7325 0.282
NP_442698.1_10 Reverse -103 -122 19.764 0.0678
NP_442698.1_10 Forward -230 -211 -0.885524 0.297
NP_441500.1_1 Reverse -224 -242 13.5888 0.288
NP_441720.1_2 Reverse -187 -206 7.4718 0.213
NP_439988.1_3 Reverse -357 -371 14.3559 0.185
NP_442680.1_5 Reverse -112 -131 1.24451 0.248
NP_440801.1_8 Forward -398 -379 -0.39387 0.265
NP_441489.1_3 Forward -46 -32 8.12843 0.244
NP_442582.1_8 Forward -142 -124 7.19731 0.28
YP_003858595.1_2 Forward -160 -143 5.74131 0.248
NP_440554.1_4 Reverse -78 -88 2.53664 0.261
NP_442341.1_7 Reverse -302 -316 6.29277 0.13
NP_442341.1_7 Reverse -258 -272 3.63784 0.217
NP_442395.2_4 Reverse -355 -374 9.14342 0.12
NP_442932.1_9 Reverse -104 -123 6.4893 0.249
NP_441307.1_4 Forward -153 -134 -1.37718 0.283
NP_440679.1_10 Forward -289 -270 -15.0452 0.25
NP_440216.1_9 Reverse -267 -276 6.48957 0.289
NP_440216.1_9 Forward -98 -89 5.89959 0.289
NP_441226.1_7 Forward -290 -283 7.1186 0.218
NP_440416.1_9 Forward -262 -243 -16.7168 0.22
NP_440416.1_9 Reverse -191 -210 -20.3551 0.284
NP_443052.1_9 Forward -254 -235 -4.03212 0.254
NP_442154.1_1 Reverse -233 -251 -13.5505 0.217
NP_440261.1_5 Reverse -293 -306 -8.53551 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCGGGGCATGATCAAATCCCAGGAAACTGGCCCCATGGGAGTGCGGGTAAAAGCGGATGTGCCTTTGAGCGAAATGTTCGGCTACATTGGTGATTTGCGGACCATGACTTCCGGTCGGGGTCAATTCTCCATGGTGTTTGACCACTACGCTCCCTGCCCCACCAACGTTGCGGAGGAAGTAATCAAAGAAGCCAAAGAACGGCAAGCCGCTGCTTAATTCCAAATTTGACTGTCTCAAATGTTTTCTGCCCCCATTTTCGGGGGCTTTTTTGTGCAATTTTTGCTTCTACTGCCATCGTGTACCATGGCTAGAAAGCTATGGGTATTTTCCAAGTAAGTCGACGACTTAATCCCATTGAGTAAAGTACTGTTACTGGTTGCCTAATTTTGACTTTTTTCA

CDS

ATGAACACAACTTTTCCGGCGGTGTACGGCCCCGTTAATTCCTGGCGCTATGGCCGTTCCCTGGGTATTGATCCCATCGGGGCTATTTCCACCTGTTCTTTTAACTGCGTTTATTGTCAACTGGGGGAAATTGAGCACCTCAGCGGCGATCGCCAAATTTTCATTCCCACCGCTGACATTTTGCGAGAATTGGCCCAGTTTGCCCCCTGGGAGGTGGATGTAATTACCCTAAGCGGCAGCGGAGAGCCGACGTTAGCCAAAAATTTAGGGGAAATTCTCGAAGGCATTAAAAAGTTGACTGGGAAATTAACCCTGGTACTCACCAATGCGACTTTGTTAAATGATGCTCAGGTAAGAGAAGAGCTCTCCTTAGCAGACAAGATTTCTGTCAAATTAGACGGATTGTGGCCAGACCAGTTACAAAGAATTAACCGACCGATCGCCGGCATTGAGTTGGAGCAAATTTTGACTGGTATTCAAACCTTTCAGCAGGAGTTTACAGGGGAATTATCAGTGCAAACCATGGTGCTGCAGCCCTGGGACCAGACAACTGAGAACCGTTATTTGGAGCTTTTATCCCTAATTAAGCCCACCGAAGTGCAACTCAACAGGCCCACCAGGCCCAAACCCCTCCAGCGGGAATTGGAAGGCCGGGGTAACCATACCGGCACCCCCTACGGCGATCGCCCTGTGACTCAAATCAAATGCGTCGATGGTCAGACCCTACAAAATTTGGCCAAAAAAATAAGTGGGGCGATCGGCATTCCTGTCCGCTGCGCCCCCGTAAAGGTCTTGTAA

Protein

MNTTFPAVYGPVNSWRYGRSLGIDPIGAISTCSFNCVYCQLGEIEHLSGDRQIFIPTADILRELAQFAPWEVDVITLSGSGEPTLAKNLGEILEGIKKLTGKLTLVLTNATLLNDAQVREELSLADKISVKLDGLWPDQLQRINRPIAGIELEQILTGIQTFQQEFTGELSVQTMVLQPWDQTTENRYLELLSLIKPTEVQLNRPTRPKPLQRELEGRGNHTGTPYGDRPVTQIKCVDGQTLQNLAKKISGAIGIPVRCAPVKVL