Your browser is old and dusty. Try Google Chrome!

Details for slr1461

ORF slr1461
Accession NP_442848.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -208 -222 3.93283 0.158
NP_441061.1_2 Reverse -273 -287 0.589577 0.205
NP_440557.1_1 Forward -215 -196 -1.27885 0.271
NP_440795.1_7 Forward -215 -208 14.6904 0.0123
NP_440795.1_7 Reverse -208 -215 14.6904 0.0123
NP_440795.1_7 Forward -335 -328 11.3472 0.0978
NP_440795.1_7 Forward -221 -214 8.00392 0.218
NP_440795.1_7 Reverse -291 -298 6.43063 0.265
NP_441418.1_6 Forward -216 -197 -28.7132 0.208
NP_441418.1_6 Reverse -272 -291 -29.9915 0.249
NP_441418.1_6 Reverse -207 -226 -30.6798 0.291
NP_442291.1_5 Reverse -206 -222 14.3165 0.0249
NP_442291.1_5 Forward -217 -201 2.61514 0.121
NP_441453.1_4 Reverse -207 -215 16.539 0.00633
NP_441453.1_4 Forward -216 -208 16.539 0.00633
NP_441453.1_4 Reverse -327 -335 13.6874 0.0221
NP_441453.1_4 Forward -336 -328 7.19758 0.0757
NP_441453.1_4 Reverse -64 -72 5.32929 0.147
NP_441453.1_4 Forward -23 -15 4.24765 0.259
NP_442151.1_6 Forward -216 -202 20.4524 0.0045
NP_442151.1_6 Reverse -1 -15 6.98109 0.214
NP_442151.1_6 Reverse -207 -221 6.09611 0.248
NP_442151.1_6 Reverse -374 -388 5.30946 0.284
NP_441818.1_1 Reverse -208 -219 18.446 0.0046
NP_441818.1_1 Reverse -328 -339 15.6928 0.0257
NP_441818.1_1 Forward -215 -204 10.1862 0.232
NP_441818.1_1 Forward -22 -11 8.80962 0.277
NP_441818.1_6 Reverse -382 -396 18.2892 0.19
NP_440226.1_1 Forward -216 -197 10.6192 0.061
NP_440226.1_1 Reverse -207 -226 9.93088 0.0679
NP_440120.1_4 Forward -272 -258 14.3559 0.273
NP_442173.1_1 Forward -215 -207 15.4574 0.00633
NP_442173.1_1 Reverse -208 -216 15.4574 0.00633
NP_442173.1_1 Forward -72 -64 11.3275 0.0463
NP_442173.1_1 Forward -335 -327 7.8859 0.134
NP_442173.1_1 Reverse -328 -336 5.62429 0.206
NP_442752.1_4 Forward -216 -209 13.8055 0.0199
NP_442752.1_4 Reverse -207 -214 13.8055 0.0199
NP_442752.1_4 Forward -336 -329 10.8555 0.0846
NP_443027.1_4 Forward -218 -208 14.0414 0.0452
NP_443027.1_4 Forward -224 -214 12.0747 0.0872
NP_443027.1_4 Reverse -325 -335 9.61647 0.159
NP_443027.1_4 Forward -338 -328 7.35486 0.24
NP_441812.1_3 Reverse -379 -393 8.25939 0.254
NP_442975.1_10 Reverse -203 -217 11.2087 0.0508
NP_442975.1_10 Forward -220 -206 4.03056 0.249
NP_440784.1_7 Forward -215 -208 15.9687 0.0123
NP_440784.1_7 Reverse -208 -215 15.9687 0.0123
NP_440784.1_7 Reverse -328 -335 12.4288 0.0475
NP_440784.1_7 Forward -335 -328 6.23397 0.241
NP_442909.1_7 Reverse -208 -222 24.09 0.00968
NP_440061.1_9 Reverse -325 -339 14.9452 0.0555
NP_440061.1_9 Forward -283 -269 12.9786 0.0878
NP_440061.1_9 Reverse -205 -219 12.9786 0.0878
NP_440061.1_9 Forward -338 -324 7.07881 0.219
NP_440110.1_8 Forward -91 -72 -2.45882 0.269
NP_441476.1_5 Reverse -285 -304 -1.08219 0.2
NP_441476.1_5 Reverse -202 -221 -5.40875 0.262
NP_442062.1_8 Forward -216 -206 17.3846 0.00193
NP_442062.1_8 Reverse -207 -217 17.3846 0.00193
NP_442062.1_8 Reverse -327 -337 11.5831 0.0447
NP_442062.1_8 Forward -336 -326 9.91146 0.0554
NP_442062.1_8 Reverse -380 -390 4.10993 0.232
NP_441859.1_3 Forward -337 -318 2.55527 0.258
NP_440304.1_4 Forward -218 -208 10.8948 0.051
NP_440304.1_4 Forward -75 -65 7.35486 0.118
NP_440304.1_4 Reverse -12 -22 4.60159 0.258
NP_440304.1_4 Forward -270 -260 2.24165 0.299
NP_440304.1_4 Reverse -205 -215 1.84832 0.299
NP_442242.1_4 Forward -215 -208 14.3954 0.0124
NP_442242.1_4 Reverse -208 -215 14.3954 0.0124
NP_440044.1_8 Forward -215 -196 4.22769 0.119
NP_440044.1_8 Reverse -208 -227 3.73603 0.125
NP_441781.1_7 Reverse -207 -226 4.42435 0.186
NP_441781.1_7 Forward -239 -220 -2.95047 0.29
NP_442762.1_10 Reverse -362 -381 -11.7019 0.275
NP_440011.1_1 Forward -295 -276 11.0125 0.286
NP_441620.1_3 Forward -223 -204 18.584 0.132
NP_441200.1_4 Forward -172 -153 7.07928 0.272
NP_441200.1_4 Forward -285 -266 5.30933 0.295
NP_440370.1_10 Forward -225 -206 8.94757 0.239
NP_440370.1_10 Forward -231 -212 8.55425 0.241
NP_442110.1_7 Forward -216 -202 9.93102 0.0684
NP_442110.1_7 Reverse -207 -221 8.55439 0.0877
NP_441082.1_10 Reverse -19 -32 9.65572 0.242
NP_440856.1_4 Forward -199 -180 -4.91709 0.27
NP_441083.1_5 Forward -216 -206 20.3345 0.00053
NP_441083.1_5 Reverse -207 -217 20.3345 0.00053
NP_441083.1_5 Forward -294 -284 2.14332 0.195
NP_441083.1_5 Reverse -327 -337 1.25834 0.213
NP_441083.1_5 Reverse -64 -74 -0.904945 0.283
NP_442827.1_8 Forward -310 -291 -0.39464 0.226
NP_441149.1_6 Forward -361 -342 6.78429 0.291
NP_441738.1_2 Forward -214 -207 15.28 0.0102
NP_441738.1_2 Reverse -209 -216 15.28 0.0102
NP_441738.1_2 Reverse -66 -73 13.8051 0.0221
NP_441558.1_5 Forward -218 -199 22.1239 0.00216
NP_441558.1_5 Reverse -205 -224 5.50599 0.247
NP_441955.1_8 Forward -342 -325 7.512 0.274
NP_441955.1_8 Reverse -374 -391 6.72535 0.281
NP_440209.1_1 Reverse -207 -215 18.1123 0.00295
NP_440209.1_1 Forward -216 -208 18.1123 0.00295
NP_440209.1_1 Forward -336 -328 8.37755 0.0576
NP_442889.1_8 Reverse -204 -218 10.9137 0.077
NP_442889.1_8 Forward -219 -205 4.22722 0.27
NP_441713.1_1 Reverse -201 -220 -14.8485 0.259
NP_441713.1_1 Forward -79 -60 -16.0285 0.275
NP_440178.1_7 Reverse -206 -225 5.70265 0.0174
NP_440178.1_7 Forward -217 -198 -14.1602 0.149
NP_442570.1_3 Reverse -221 -240 -5.9004 0.25
NP_442570.1_3 Reverse -179 -198 -8.35868 0.285
NP_442445.1_1 Forward -336 -317 11.0125 0.278
NP_441716.1_1 Reverse -207 -221 16.0275 0.0436
NP_441716.1_1 Forward -44 -30 12.0943 0.0849
NP_440644.1_3 Reverse -285 -304 6.39097 0.17
NP_442111.1_4 Reverse -206 -220 8.06273 0.081
NP_442111.1_4 Reverse -63 -77 4.52282 0.203
NP_442111.1_4 Forward -217 -203 3.14618 0.253
NP_441624.1_7 Reverse -348 -362 9.63603 0.218
NP_441163.1_1 Reverse -271 -288 5.54465 0.273
NP_441163.1_1 Reverse -361 -378 5.44632 0.274
NP_441163.1_7 Forward -270 -251 17.699 0.195
NP_441495.1_1 Reverse -199 -218 9.14423 0.226
NP_440906.1_5 Forward -215 -208 15.8704 0.0124
NP_440906.1_5 Reverse -208 -215 15.8704 0.0124
NP_440906.1_5 Forward -335 -328 6.23397 0.234
NP_440906.1_5 Reverse -328 -335 6.0373 0.262
NP_440747.1_10 Reverse -204 -216 14.9853 0.00221
NP_440747.1_10 Forward -219 -207 7.51213 0.00286
NP_440747.1_10 Reverse -324 -336 -2.51763 0.0509
NP_440747.1_10 Reverse -269 -281 -2.61596 0.0556
NP_440747.1_10 Forward -339 -327 -2.71429 0.0639
NP_440747.1_10 Forward -284 -272 -4.18925 0.0817
NP_441130.1_10 Forward -218 -204 7.86607 0.146
NP_441486.1_1 Forward -219 -205 23.4024 0.00162
NP_441486.1_1 Reverse -204 -218 21.3374 0.00239
NP_441486.1_1 Forward -26 -12 -0.393733 0.154
NP_441486.1_1 Forward -339 -325 -4.22864 0.192
NP_441486.1_1 Reverse -11 -25 -6.29359 0.288
NP_442634.1_4 Forward -338 -324 -2.16369 0.149
NP_440403.1_4 Reverse -171 -190 -9.83364 0.287
NP_441014.1_5 Forward -286 -268 13.6872 0.204
NP_441014.1_5 Reverse -202 -220 11.1305 0.261
NP_441014.1_10 Forward -217 -198 2.6536 0.216
NP_441014.1_10 Reverse -206 -225 0.392004 0.243
NP_442848.1_1 Forward -222 -208 24.2873 0.00172
NP_442848.1_1 Reverse -201 -215 7.57108 0.0791
NP_441012.1_4 Forward -27 -14 11.229 0.252
NP_441012.1_4 Reverse -209 -222 7.49244 0.272
NP_441012.1_4 Forward -387 -374 6.70579 0.276
NP_443018.1_3 Forward -215 -208 14.8871 0.0123
NP_443018.1_3 Reverse -208 -215 14.8871 0.0123
NP_443018.1_3 Forward -335 -328 13.8055 0.024
NP_443018.1_3 Reverse -328 -335 13.6088 0.0352
NP_443018.1_3 Reverse -381 -388 10.2655 0.107
NP_443018.1_3 Reverse -15 -22 4.26735 0.267
NP_443018.1_3 Forward -22 -15 4.16902 0.278
NP_443018.1_3 Forward -221 -214 4.07068 0.299
NP_441634.1_8 Forward -218 -204 2.2612 0.169
NP_441634.1_8 Forward -338 -324 -1.08205 0.278
NP_441634.1_8 Reverse -205 -219 -3.93365 0.295
NP_440376.1_1 Forward -216 -207 19.4693 0.000692
NP_440376.1_1 Reverse -207 -216 19.4693 0.000692
NP_440376.1_1 Forward -336 -327 6.39124 0.1
NP_440376.1_1 Forward -281 -272 4.42462 0.159
NP_440376.1_1 Forward -73 -64 2.458 0.221
NP_440376.1_1 Reverse -181 -190 1.08137 0.258
NP_440376.1_1 Reverse -327 -336 -0.0986038 0.285
NP_441588.1_4 Forward -214 -204 18.1713 0.0143
NP_440580.1_4 Forward -282 -263 11.8975 0.0833
NP_442687.1_7 Forward -217 -207 8.92815 0.0994
NP_442687.1_7 Reverse -206 -216 8.92815 0.0994
NP_442687.1_7 Forward -74 -64 5.68323 0.189
NP_442687.1_7 Reverse -142 -152 4.79825 0.234
NP_442687.1_7 Reverse -326 -336 4.69992 0.238
NP_442687.1_7 Reverse -182 -192 3.61828 0.299
NP_442530.1_2 Reverse -337 -347 15.123 0.203
NP_441013.1_2 Forward -394 -376 -4.99573 0.299
NP_441422.1_7 Reverse -205 -222 -4.18939 0.238
NP_441029.1_3 Reverse -136 -155 2.55606 0.277
NP_440533.1_9 Forward -336 -317 9.43923 0.147
NP_442296.1_5 Forward -231 -212 7.7676 0.206
NP_442658.1_1 Forward -338 -328 7.0594 0.214
NP_442658.1_1 Reverse -325 -335 6.86274 0.214
NP_442658.1_1 Reverse -205 -215 6.76441 0.214
NP_442658.1_1 Forward -218 -208 6.76441 0.214
NP_442198.1_3 Reverse -260 -279 5.80098 0.259
NP_442198.1_3 Forward -348 -329 3.53937 0.285
NP_440141.1_8 Reverse -135 -154 4.916 0.278
NP_442782.1_2 Forward -336 -322 9.63603 0.198
NP_442205.1_9 Forward -222 -206 12.8416 0.0597
NP_442544.1_2 Forward -288 -274 -0.983719 0.254
NP_441414.1_9 Reverse -207 -226 5.80098 0.0439
NP_441414.1_9 Forward -216 -197 -2.95047 0.126
NP_442937.1_5 Reverse -202 -221 11.3075 0.141
NP_441958.1_5 Forward -217 -207 12.2714 0.00183
NP_441958.1_5 Reverse -206 -216 12.2714 0.00183
NP_441958.1_5 Forward -74 -64 7.15819 0.0362
NP_441958.1_5 Forward -337 -327 1.25834 0.108
NP_440318.1_1 Forward -159 -140 5.60432 0.218
NP_442836.1_5 Reverse -201 -220 3.73603 0.225
NP_440203.1_5 Reverse -210 -220 11.1893 0.202
NP_442260.1_8 Forward -273 -254 3.44104 0.256
NP_439905.1_1 Reverse -328 -341 19.4888 0.0174
NP_439905.1_2 Reverse -245 -259 7.86607 0.289
NP_440984.1_7 Forward -341 -327 9.14437 0.131
NP_440984.1_7 Reverse -202 -216 9.04604 0.131
NP_439990.1_5 Reverse -202 -215 9.95071 0.128
NP_441338.2_9 Forward -350 -331 4.916 0.261
NP_442911.1_2 Forward -226 -207 22.1239 0.00418
NP_442911.1_2 Reverse -197 -216 -5.01543 0.148
NP_442911.1_2 Reverse -317 -336 -7.86702 0.221
NP_440153.1_5 Reverse -208 -222 9.2427 0.127
NP_440153.1_5 Forward -215 -201 2.75286 0.219
NP_440153.1_8 Forward -389 -376 13.1956 0.16
NP_440153.1_8 Reverse -327 -340 5.42749 0.18
NP_442571.1_1 Reverse -124 -143 11.5042 0.155
NP_440369.1_5 Reverse -367 -386 13.7658 0.189
NP_442536.1_4 Forward -222 -204 5.91901 0.3
NP_443055.1_6 Forward -268 -250 -1.84987 0.284
NP_440993.1_4 Reverse -272 -289 13.3135 0.171
NP_440602.1_8 Forward -23 -9 10.1277 0.295
NP_443044.1_1 Reverse -338 -357 6.68596 0.261
NP_441129.1_3 Reverse -323 -342 -8.16202 0.184
NP_441099.1_5 Forward -83 -64 -11.5053 0.283
NP_442002.1_1 Forward -82 -64 -9.61729 0.283
NP_442002.1_9 Forward -74 -67 13.0188 0.185
NP_442002.1_9 Forward -269 -262 11.1505 0.185
NP_441294.1_7 Reverse -203 -217 17.8896 0.00674
NP_441294.1_7 Forward -220 -206 16.9297 0.011
NP_441294.1_7 Reverse -60 -74 9.53859 0.241
NP_441646.1_1 Reverse -200 -219 3.34271 0.207
NP_441646.1_1 Forward -223 -204 2.0644 0.221
NP_442438.1_10 Forward -221 -207 20.2558 0.0124
NP_442438.1_10 Reverse -202 -216 6.48943 0.114
NP_441000.1_6 Forward -337 -323 -4.03198 0.225
NP_441000.1_6 Reverse -206 -220 -5.11362 0.261
NP_442771.1_1 Reverse -291 -309 -11.1906 0.299
NP_441674.1_6 Forward -304 -285 1.96607 0.291
NP_440147.1_4 Reverse -325 -338 13.294 0.0326
NP_440147.1_4 Reverse -205 -218 11.3273 0.0326
NP_440147.1_4 Forward -338 -325 3.26421 0.191
NP_440147.1_4 Forward -218 -205 2.18257 0.209
NP_441175.1_7 Forward -216 -197 9.83255 0.175
NP_441550.1_8 Reverse -205 -215 14.6309 0.0132
NP_441550.1_8 Forward -218 -208 12.3692 0.0336
NP_441550.1_8 Forward -338 -328 5.38779 0.252
NP_441916.1_7 Forward -336 -326 13.648 0.0187
NP_441916.1_7 Reverse -14 -24 12.8614 0.0231
NP_441916.1_7 Forward -216 -206 10.3048 0.0261
NP_441916.1_7 Reverse -207 -217 10.3048 0.0261
NP_441916.1_7 Reverse -327 -337 1.16001 0.293
NP_441916.1_10 Forward -224 -205 6.78429 0.201
NP_440465.1_10 Reverse -32 -51 3.04771 0.253
NP_441041.1_4 Reverse -374 -393 4.03102 0.0602
NP_441041.1_4 Forward -216 -197 1.96607 0.0769
NP_441041.1_4 Reverse -207 -226 -0.590531 0.0958
NP_441041.1_4 Reverse -64 -83 -3.73712 0.125
NP_441041.1_4 Reverse -14 -33 -11.6036 0.25
NP_441041.1_7 Reverse -204 -216 11.8878 0.0689
NP_442396.1_5 Forward -220 -207 8.18076 0.16
NP_442004.1_6 Reverse -207 -221 20.8458 0.0534
NP_442004.1_6 Forward -222 -208 11.996 0.115
NP_441725.1_5 Reverse -208 -218 11.2881 0.0247
NP_441725.1_5 Forward -215 -205 2.04498 0.115
NP_441725.1_5 Reverse -65 -75 1.65166 0.13
NP_441725.1_5 Forward -22 -12 -0.0199663 0.223
NP_441725.1_5 Reverse -328 -338 -0.511621 0.26
NP_439966.1_7 Forward -218 -208 15.8108 0.0124
NP_439966.1_7 Reverse -211 -221 10.3043 0.0928
NP_439966.1_7 Reverse -205 -215 7.25606 0.15
NP_439966.1_7 Reverse -325 -335 6.0761 0.195
NP_439966.1_7 Forward -338 -328 5.58445 0.216
NP_440736.1_3 Reverse -198 -217 -0.4922 0.282
NP_442941.1_3 Reverse -208 -218 19.9412 0.00262
NP_442941.1_3 Forward -215 -205 11.0914 0.0116
NP_442941.1_3 Reverse -328 -338 9.41981 0.0319
NP_440289.1_2 Reverse -204 -217 4.54251 0.066
NP_440289.1_2 Forward -219 -206 3.85419 0.0735
NP_440289.1_2 Forward -379 -366 -1.06236 0.221
NP_440983.1_5 Reverse -272 -291 -5.70374 0.27
NP_440260.1_8 Reverse -235 -253 -0.7675 0.221
NP_440260.1_8 Reverse -257 -275 -4.8974 0.273
NP_440260.1_8 Reverse -236 -254 -5.09406 0.273
NP_441514.1_6 Forward -352 -345 12.8221 0.252
NP_441514.1_6 Reverse -365 -372 12.7238 0.29
NP_442281.1_1 Reverse -202 -216 17.5018 0.00555
NP_442281.1_1 Reverse -322 -336 9.6354 0.0684
NP_442281.1_1 Forward -28 -14 5.80051 0.146
NP_442281.1_1 Reverse -9 -23 5.01387 0.172
NP_442281.1_1 Reverse -59 -73 4.22722 0.203
NP_442901.1_4 Forward -348 -329 2.55606 0.278
NP_440177.1_1 Forward -143 -125 3.65739 0.291
NP_442256.1_2 Forward -218 -200 -7.94566 0.216
NP_440437.1_1 Reverse -201 -220 -1.67217 0.205
NP_440437.1_1 Forward -125 -106 -1.96717 0.207
NP_440437.1_1 Forward -228 -209 -3.83545 0.246
NP_442012.1_2 Forward -338 -319 11.0125 0.134
NP_440723.1_4 Forward -219 -200 -10.7186 0.284
NP_441556.1_5 Forward -166 -147 17.404 0.0887
NP_440498.1_1 Forward -225 -207 7.68896 0.0827
NP_441644.1_6 Forward -216 -206 17.3841 0.00127
NP_441644.1_6 Reverse -207 -217 17.3841 0.00127
NP_441644.1_6 Reverse -327 -337 13.2542 0.0212
NP_441644.1_6 Reverse -266 -276 5.97777 0.172
NP_441644.1_6 Reverse -64 -74 3.71617 0.267
NP_441644.1_6 Reverse -374 -384 3.42118 0.282
NP_440867.1_10 Forward -24 -5 2.75272 0.283
NP_442215.1_2 Forward -218 -202 17.1681 0.0142
NP_442215.1_2 Reverse -205 -221 2.61514 0.112
NP_442215.1_2 Forward -283 -267 -3.38305 0.214
NP_442215.1_2 Reverse -263 -279 -6.23465 0.266
NP_442215.1_2 Reverse -105 -121 -6.92296 0.281
NP_442029.1_1 Reverse -2 -21 -20.3551 0.297
NP_442029.1_6 Forward -286 -267 11.1109 0.166
NP_442029.1_6 Reverse -208 -227 3.14605 0.283
NP_440929.1_8 Forward -216 -207 19.2726 0.000701
NP_440929.1_8 Reverse -207 -216 19.2726 0.000701
NP_442933.1_10 Forward -216 -207 17.601 0.00325
NP_442933.1_10 Reverse -207 -216 17.601 0.00325
NP_442933.1_10 Forward -336 -327 14.2577 0.0126
NP_442933.1_10 Reverse -327 -336 7.76787 0.11
NP_442933.1_10 Reverse -14 -23 4.71961 0.22
NP_440430.1_6 Forward -337 -319 17.3071 0.209
NP_441751.2_8 Reverse -208 -222 6.3911 0.0354
NP_442554.1_8 Reverse -208 -218 15.9097 0.00747
NP_442554.1_8 Forward -215 -205 15.3197 0.00882
NP_442554.1_8 Reverse -328 -338 15.123 0.00944
NP_442554.1_8 Forward -388 -378 6.07655 0.126
NP_442554.1_8 Forward -335 -325 3.42162 0.226
NP_442554.1_8 Forward -109 -99 3.22496 0.235
NP_442554.1_8 Forward -382 -372 2.83163 0.253
NP_441762.1_7 Forward -217 -205 0.432302 0.0747
NP_441762.1_7 Reverse -326 -338 -5.66422 0.228
NP_441762.1_7 Reverse -13 -25 -6.2542 0.284
NP_441762.1_7 Reverse -206 -218 -6.84419 0.284
NP_442142.1_4 Reverse -204 -217 10.9334 0.0646
NP_442142.1_4 Reverse -324 -337 8.08184 0.124
NP_442142.1_4 Forward -219 -206 6.31189 0.169
NP_442142.1_4 Forward -339 -326 4.05029 0.234
NP_442292.1_1 Forward -215 -206 18.486 0.00229
NP_442292.1_1 Reverse -208 -217 18.486 0.00229
NP_442292.1_1 Reverse -328 -337 15.536 0.0107
NP_442292.1_5 Reverse -255 -274 7.27595 0.154
NP_442476.1_6 Reverse -208 -222 8.45605 0.101
NP_442476.1_6 Reverse -328 -342 3.93283 0.153
NP_443009.1_5 Reverse -206 -217 8.90795 0.0965
NP_443009.1_5 Forward -217 -206 8.90795 0.0965
NP_443009.1_5 Forward -337 -326 7.62965 0.124
NP_443009.1_10 Reverse -50 -68 8.96727 0.224
NP_442408.2_1 Forward -293 -274 -7.57203 0.3
NP_441715.1_4 Reverse -208 -218 14.828 0.0268
NP_441715.1_4 Forward -335 -325 8.1415 0.107
NP_441715.1_4 Forward -215 -205 7.94484 0.107
NP_441715.1_4 Reverse -328 -338 7.55152 0.108
NP_440015.1_9 Reverse -207 -225 10.6389 0.099
NP_440015.1_9 Reverse -64 -82 -0.570838 0.264
NP_440730.1_4 Reverse -127 -146 0.196116 0.248
NP_441198.1_5 Forward -214 -201 13.9817 0.206
NP_441198.1_8 Forward -224 -214 10.7322 0.247
NP_440464.1_10 Forward -215 -205 13.0082 0.169
NP_441468.1_1 Forward -215 -208 15.8704 0.0124
NP_441468.1_1 Reverse -208 -215 15.8704 0.0124
NP_441468.1_1 Forward -335 -328 13.8055 0.0242
NP_441468.1_1 Forward -221 -214 10.2655 0.0906
NP_441468.1_1 Reverse -328 -335 6.0373 0.223
NP_441468.1_1 Reverse -15 -22 4.26735 0.246
NP_441015.1_10 Forward -286 -267 -1.08219 0.169
NP_441015.1_10 Forward -221 -202 -1.96717 0.176
NP_441015.1_10 Reverse -375 -394 -9.14533 0.28
NP_441015.1_10 Forward -341 -322 -9.53865 0.282
NP_441015.1_10 Reverse -24 -43 -10.9153 0.289
NP_441015.1_10 Reverse -2 -21 -11.6036 0.298
NP_441673.1_1 Forward -216 -207 20.8459 0.000698
NP_441673.1_1 Reverse -207 -216 20.8459 0.000698
NP_441673.1_1 Forward -336 -327 1.27803 0.155
NP_441673.1_1 Reverse -327 -336 1.27803 0.155
NP_441673.1_1 Forward -281 -272 -8.06341 0.254
NP_442253.1_5 Forward -242 -225 -4.18939 0.292
NP_441826.1_2 Reverse -201 -215 14.6509 0.0196
NP_441826.1_2 Forward -222 -208 10.4227 0.0475
NP_441826.1_2 Reverse -207 -221 2.45787 0.127
NP_441826.1_2 Reverse -266 -280 -2.95034 0.28
NP_441330.1_1 Reverse -267 -286 -15.2418 0.27
NP_441637.1_9 Forward -160 -142 16.1454 0.0952
NP_442868.1_6 Forward -218 -208 9.91146 0.038
NP_442868.1_6 Reverse -205 -215 9.81313 0.038
NP_442868.1_6 Forward -338 -328 9.51814 0.0447
NP_442719.1_2 Reverse -250 -268 -10.4046 0.273
NP_441612.1_2 Forward -281 -271 11.1632 0.21
NP_441612.1_2 Reverse -207 -217 8.54929 0.21
NP_441612.1_2 Forward -216 -206 8.54929 0.21
NP_442227.1_2 Reverse -268 -287 1.57275 0.245
NP_442361.1_3 Reverse -201 -214 14.5723 0.115
NP_441911.1_10 Reverse -76 -95 7.98055 0.274
NP_442808.1_1 Reverse -206 -216 8.63269 0.0481
NP_442808.1_1 Forward -217 -207 8.63269 0.0481
NP_442808.1_1 Reverse -326 -336 7.35439 0.0814
NP_442808.1_1 Forward -120 -110 3.22451 0.247
NP_442775.1_6 Reverse -285 -304 10.7175 0.277
NP_440145.1_3 Reverse -197 -216 9.24257 0.0446
NP_440145.1_3 Reverse -54 -73 3.14605 0.109
NP_441906.1_5 Reverse -339 -358 10.3234 0.246
NP_442050.1_1 Forward -326 -307 14.8474 0.187
NP_442050.1_1 Reverse -283 -302 6.78429 0.281
NP_442050.1_5 Forward -218 -208 16.4991 0.00812
NP_442050.1_5 Reverse -205 -215 7.64939 0.243
NP_442342.1_9 Reverse -251 -267 3.50012 0.26
NP_440558.1_2 Forward -225 -206 0.196116 0.194
NP_440558.1_2 Reverse -263 -282 -1.18052 0.211
NP_440558.1_2 Forward -47 -28 -2.65548 0.229
NP_440558.1_2 Reverse -376 -395 -3.73712 0.238
NP_440558.1_2 Forward -392 -373 -6.1954 0.272
NP_440558.1_2 Reverse -324 -343 -7.57203 0.296
NP_440093.1_10 Forward -125 -107 22.1436 0.113
NP_441878.1_6 Forward -217 -207 10.4031 0.0176
NP_441878.1_6 Reverse -206 -216 10.4031 0.0176
NP_441878.1_6 Forward -45 -35 9.7148 0.0237
NP_441878.1_6 Forward -337 -327 1.55333 0.0937
NP_441878.1_6 Reverse -34 -44 1.06167 0.116
NP_441878.1_6 Reverse -265 -275 -0.118297 0.167
NP_441878.1_6 Reverse -326 -336 -0.314959 0.174
NP_441878.1_6 Forward -74 -64 -7.59145 0.245
NP_441878.1_6 Forward -282 -272 -7.78811 0.266
NP_441878.1_6 Reverse -13 -23 -7.88644 0.278
NP_441036.1_3 Forward -281 -262 0.392778 0.177
NP_441036.1_8 Reverse -9 -19 11.6814 0.111
NP_441036.1_8 Forward -217 -207 8.33817 0.174
NP_441036.1_8 Reverse -206 -216 8.33817 0.174
NP_441036.1_8 Reverse -326 -336 7.64985 0.191
NP_442650.1_2 Reverse -207 -221 4.52282 0.169
NP_441557.1_5 Forward -216 -207 19.9609 0.000699
NP_441557.1_5 Reverse -207 -216 19.9609 0.000699
NP_441557.1_5 Forward -336 -327 8.94785 0.0289
NP_441557.1_5 Reverse -327 -336 0.688044 0.128
NP_441557.1_5 Forward -73 -64 -0.885252 0.26
NP_441445.1_1 Forward -225 -206 11.0125 0.0895
NP_441445.1_1 Reverse -198 -217 1.96607 0.245
NP_440738.1_5 Reverse -331 -350 7.96426 0.241
NP_440101.1_3 Forward -221 -202 4.12936 0.224
NP_440101.1_10 Reverse -207 -226 3.24438 0.243
NP_441458.1_10 Forward -290 -271 3.34271 0.251
NP_441564.1_3 Reverse -284 -303 14.5524 0.14
NP_442469.1_2 Forward -283 -265 18.407 0.216
NP_442183.1_1 Reverse -207 -221 6.48943 0.171
NP_441459.1_8 Forward -80 -67 13.1956 0.286
NP_441549.1_9 Reverse -203 -221 -4.99573 0.198
NP_441549.1_9 Reverse -209 -227 -9.32229 0.245
NP_442347.1_2 Forward -215 -206 12.4878 0.056
NP_442347.1_2 Reverse -208 -217 12.4878 0.056
NP_442645.1_2 Forward -224 -205 14.9458 0.00537
NP_442645.1_2 Reverse -199 -218 -12.9802 0.144
NP_442645.1_2 Forward -137 -118 -14.6519 0.177
NP_442965.1_2 Forward -286 -267 -2.16383 0.255
NP_442888.1_6 Reverse -196 -215 3.44104 0.244
NP_442888.1_6 Reverse -90 -109 2.65439 0.249
NP_441037.1_4 Reverse -205 -215 7.9999 0.237
NP_441037.1_4 Reverse -99 -109 5.95329 0.289
NP_442594.1_7 Forward -227 -208 6.98015 0.196
NP_441633.1_3 Reverse -205 -218 1.10092 0.109
NP_441633.1_3 Forward -218 -205 -5.97891 0.236
NP_440136.1_1 Reverse -179 -195 10.8742 0.238
NP_440136.1_2 Forward -215 -208 15.9687 0.0123
NP_440136.1_2 Reverse -208 -215 15.9687 0.0123
NP_440136.1_2 Forward -335 -328 6.52896 0.116
NP_440136.1_2 Reverse -328 -335 6.13563 0.193
NP_440136.1_2 Forward -221 -214 4.26735 0.218
NP_442590.1_10 Forward -222 -203 5.80098 0.258
NP_442590.1_10 Forward -216 -197 4.62101 0.273
NP_442998.1_5 Forward -270 -260 16.4996 0.149
NP_442998.1_5 Reverse -366 -376 10.9931 0.199
NP_442998.1_5 Forward -327 -317 10.0098 0.231
NP_442998.1_10 Forward -214 -207 15.5754 0.0102
NP_442998.1_10 Reverse -209 -216 15.5754 0.0102
NP_442998.1_10 Reverse -66 -73 6.23397 0.157
NP_442998.1_10 Reverse -329 -336 6.13563 0.181
NP_440299.1_1 Forward -220 -207 16.2433 0.0109
NP_440299.1_1 Reverse -203 -216 14.08 0.0259
NP_440299.1_1 Forward -27 -14 6.11523 0.152
NP_440299.1_1 Reverse -376 -389 4.93527 0.193
NP_440299.1_1 Reverse -323 -336 3.7553 0.232
NP_440299.1_10 Forward -41 -31 16.6958 0.285
NP_441799.1_1 Forward -220 -206 15.0436 0.0206
NP_441799.1_1 Reverse -323 -337 11.2087 0.0606
NP_441799.1_1 Forward -340 -326 9.34041 0.0942
NP_441799.1_1 Reverse -203 -217 6.98048 0.155
NP_441799.1_1 Reverse -60 -74 3.44058 0.298
NP_441007.1_5 Forward -335 -316 14.5524 0.173
NP_441007.1_10 Forward -221 -208 1.49425 0.203
NP_441007.1_10 Reverse -202 -215 0.60927 0.221
NP_441007.1_10 Forward -341 -328 0.60927 0.221
NP_441007.1_10 Reverse -96 -109 0.412608 0.23
NP_441007.1_10 Reverse -369 -382 0.117615 0.25
NP_442334.1_2 Reverse -292 -309 -13.6292 0.297
NP_442201.1_10 Reverse -196 -215 -14.1602 0.28
NP_442333.2_1 Reverse -314 -333 -0.688862 0.113
NP_442333.2_5 Reverse -274 -293 -15.1435 0.289
NP_440256.1_1 Reverse -204 -223 6.4893 0.0296
NP_440256.1_1 Forward -219 -200 -7.57203 0.24
NP_441559.1_8 Forward -184 -170 1.17956 0.156
NP_441559.1_8 Reverse -115 -129 0.196253 0.169
NP_441559.1_8 Reverse -267 -281 -2.06536 0.188
NP_441559.1_8 Forward -157 -143 -4.81863 0.238
NP_441559.1_8 Reverse -322 -336 -5.70361 0.27
NP_440915.1_6 Reverse -203 -217 4.42448 0.0953
NP_440915.1_6 Forward -184 -170 3.04785 0.109
NP_440915.1_6 Reverse -281 -295 0.589577 0.159
NP_441199.1_6 Forward -306 -287 -1.47551 0.292
NP_441494.1_4 Forward -322 -304 14.1788 0.289
NP_442993.1_1 Forward -336 -320 -8.2996 0.161
NP_442993.1_1 Forward -383 -367 -10.5612 0.222
NP_442993.1_1 Forward -308 -292 -11.1512 0.235
NP_442386.1_5 Reverse -336 -355 8.06178 0.183
NP_442386.1_9 Reverse -326 -335 15.2406 0.0215
NP_442386.1_9 Reverse -206 -215 13.8639 0.0289
NP_442386.1_9 Forward -217 -208 13.8639 0.0289
NP_442386.1_9 Forward -337 -328 11.799 0.0835
NP_442386.1_9 Reverse -212 -221 11.6023 0.0885
NP_442386.1_9 Forward -282 -273 8.16077 0.209
NP_442386.1_9 Reverse -277 -286 6.39082 0.219
NP_442386.1_9 Forward -24 -15 5.80084 0.237
NP_442386.1_9 Reverse -125 -134 4.7192 0.289
NP_440570.1_5 Reverse -350 -369 -1.7705 0.276
NP_440570.1_5 Forward -291 -272 -2.36049 0.278
NP_441750.1_1 Reverse -287 -306 -4.52377 0.204
NP_441340.1_5 Forward -215 -208 15.6737 0.0124
NP_441340.1_5 Reverse -208 -215 15.6737 0.0124
NP_441340.1_5 Reverse -328 -335 13.5105 0.0314
NP_441340.1_5 Forward -109 -102 8.8889 0.084
NP_441340.1_5 Forward -335 -328 6.23397 0.132
NP_441340.1_5 Forward -22 -15 4.07068 0.239
NP_441340.1_5 Forward -72 -65 3.97235 0.274
NP_442484.1_2 Reverse -196 -215 5.89931 0.159
NP_442484.1_2 Forward -292 -273 1.57275 0.229
NP_442484.1_2 Forward -155 -136 1.47442 0.233
NP_440168.1_2 Forward -289 -270 -4.13045 0.276
NP_442240.1_2 Forward -215 -196 -19.4701 0.295
NP_440586.1_8 Forward -215 -208 13.2151 0.026
NP_440586.1_8 Reverse -208 -215 13.2151 0.026
NP_440586.1_8 Reverse -328 -335 11.3468 0.0736
NP_440586.1_8 Forward -335 -328 9.47853 0.146
NP_440586.1_8 Reverse -381 -388 9.08521 0.178
NP_440586.1_9 Reverse -136 -155 4.81767 0.288
NP_442251.1_6 Forward -215 -208 15.2804 0.0124
NP_442251.1_6 Reverse -208 -215 15.2804 0.0124
NP_440192.1_5 Reverse -212 -231 6.78429 0.224
NP_442959.1_4 Reverse -261 -280 4.42435 0.277
NP_441262.1_3 Reverse -207 -214 14.7888 0.0223
NP_441262.1_3 Forward -216 -209 14.7888 0.0223
NP_441262.1_3 Forward -73 -66 11.5438 0.0584
NP_441262.1_3 Forward -336 -329 5.25066 0.215
NP_440027.1_3 Forward -389 -371 1.88669 0.295
NP_443051.1_1 Reverse -206 -215 10.4228 0.00754
NP_443051.1_1 Forward -217 -208 10.4228 0.00754
NP_443051.1_1 Forward -74 -65 5.3096 0.0964
NP_443051.1_1 Forward -337 -328 0.688044 0.134
NP_439937.1_8 Reverse -139 -158 1.0811 0.231
NP_439937.1_9 Forward -183 -166 -2.71511 0.153
NP_439937.1_9 Reverse -326 -343 -7.92662 0.171
NP_439937.1_9 Forward -45 -28 -15.6947 0.287
NP_442294.1_3 Forward -155 -141 13.6669 0.26
NP_442374.1_3 Reverse -375 -392 13.7068 0.228
NP_440408.1_7 Forward -222 -203 14.4541 0.165
NP_440408.1_7 Forward -281 -262 8.55425 0.276
NP_440439.1_1 Forward -339 -326 2.37923 0.135
NP_440439.1_1 Forward -219 -206 2.37923 0.135
NP_439943.1_1 Reverse -260 -279 -4.03212 0.207
NP_439943.1_2 Forward -358 -339 8.75091 0.293
NP_439943.1_4 Forward -151 -132 9.0459 0.254
NP_439943.1_7 Reverse -208 -227 5.211 0.265
NP_440372.1_2 Forward -215 -208 16.3621 0.0124
NP_440372.1_2 Reverse -208 -215 16.3621 0.0124
NP_440372.1_2 Forward -335 -328 6.62729 0.151
NP_440372.1_2 Reverse -328 -335 6.52896 0.188
NP_440171.1_3 Reverse -290 -309 2.16274 0.288
NP_441789.1_7 Forward -303 -284 -2.55791 0.257
NP_440819.1_5 Reverse -140 -148 7.98423 0.228
NP_441803.1_2 Forward -221 -202 8.16093 0.12
NP_441803.1_2 Reverse -136 -155 2.65439 0.206
NP_439977.1_5 Forward -395 -376 3.14605 0.161
NP_440139.1_1 Forward -222 -203 3.63691 0.201
NP_441572.1_7 Reverse -201 -220 -1.18052 0.186
NP_442384.1_10 Reverse -207 -220 18.0139 0.00545
NP_442384.1_10 Reverse -327 -340 10.2457 0.0465
NP_442384.1_10 Forward -216 -203 10.049 0.047
NP_442384.1_10 Forward -281 -268 7.6891 0.0764
NP_442384.1_10 Reverse -64 -77 4.93583 0.142
NP_440364.1_2 Reverse -239 -258 14.3239 0.278
NP_441018.1_7 Reverse -203 -222 14.6508 0.118
NP_442262.1_10 Forward -215 -208 14.1988 0.0123
NP_442262.1_10 Reverse -208 -215 14.1988 0.0123
NP_442262.1_10 Forward -335 -328 13.0188 0.0314
NP_442262.1_10 Reverse -328 -335 11.6422 0.092
NP_442262.1_10 Reverse -381 -388 9.18389 0.211
NP_441689.1_5 Forward -218 -208 15.3192 0.0403
NP_441689.1_5 Forward -224 -214 8.14104 0.151
NP_441689.1_5 Reverse -205 -215 5.78111 0.197
NP_441689.1_5 Reverse -62 -72 5.48612 0.251
NP_440163.1_10 Forward -386 -376 11.7798 0.169
NP_440344.1_10 Reverse -200 -217 -6.451 0.113
NP_440344.1_10 Forward -157 -140 -11.5642 0.219
NP_440344.1_10 Forward -288 -271 -13.9242 0.298
NP_440282.1_10 Forward -285 -266 0.982764 0.182
NP_440531.1_6 Forward -344 -325 5.211 0.116
NP_440531.1_8 Forward -351 -332 2.0644 0.298
NP_441335.1_7 Reverse -377 -396 14.6508 0.294
NP_440562.1_1 Reverse -331 -350 13.0766 0.235
NP_441965.1_3 Forward -226 -207 17.109 0.0461
NP_441965.1_10 Reverse -324 -340 5.76173 0.197
NP_441965.1_10 Forward -339 -323 4.87675 0.228
NP_441965.1_10 Reverse -210 -226 4.3851 0.242
NP_441965.1_10 Reverse -377 -393 3.99177 0.252
NP_441965.1_10 Forward -219 -203 2.12349 0.289
NP_442693.1_7 Forward -282 -263 7.47261 0.282
NP_440297.1_9 Reverse -208 -218 9.32148 0.0917
NP_440297.1_9 Forward -22 -12 1.35667 0.282
NP_440297.1_9 Reverse -65 -75 0.766681 0.282
NP_440297.1_9 Reverse -328 -338 0.176696 0.282
NP_440297.1_9 Forward -215 -205 -0.118297 0.282
NP_440297.1_9 Forward -43 -33 -0.314959 0.282
NP_442280.1_10 Reverse -214 -232 9.83744 0.231
NP_442280.1_10 Reverse -183 -201 5.25962 0.289
NP_441103.1_2 Reverse -196 -214 6.31156 0.298
NP_440894.1_10 Forward -121 -102 4.71934 0.244
NP_443036.1_3 Forward -121 -104 14.1985 0.295
NP_440999.1_9 Reverse -323 -337 8.45605 0.075
NP_440999.1_9 Reverse -203 -217 4.22782 0.116
NP_440999.1_9 Forward -183 -169 -1.5737 0.242
NP_440999.1_9 Forward -393 -379 -1.8687 0.252
NP_440888.1_2 Reverse -207 -221 17.8952 0.00302
NP_440888.1_2 Forward -216 -202 12.9786 0.0354
NP_440888.1_2 Reverse -327 -341 12.0937 0.0516
NP_440888.1_2 Reverse -213 -227 7.27547 0.202
NP_440888.1_2 Forward -162 -148 6.78381 0.22
NP_440888.1_2 Forward -90 -76 5.60385 0.272
NP_440888.1_2 Reverse -272 -286 5.60385 0.272
NP_440491.1_1 Forward -219 -200 17.0526 0.0567
NP_441345.1_8 Forward -23 -4 9.63589 0.286
NP_442033.1_10 Reverse -325 -344 -8.55534 0.201
NP_441543.1_2 Forward -215 -206 16.9127 0.00359
NP_441543.1_2 Reverse -208 -217 16.9127 0.00359
NP_441543.1_2 Reverse -328 -337 14.651 0.0119
NP_441543.1_2 Forward -335 -326 5.89959 0.169
NP_442845.1_2 Reverse -207 -221 13.8643 0.0893
NP_442845.1_2 Forward -222 -208 10.3243 0.154
NP_442845.1_2 Forward -281 -267 8.06273 0.195
NP_442845.1_2 Forward -228 -214 7.17775 0.198
NP_442845.1_2 Forward -342 -328 5.89945 0.22
NP_442845.1_2 Reverse -201 -215 5.01447 0.247
NP_442845.1_2 Reverse -374 -388 3.93283 0.272
NP_442845.1_2 Forward -116 -102 3.63784 0.282
NP_441304.1_10 Forward -352 -343 13.0777 0.255
NP_441551.1_5 Forward -340 -324 6.54769 0.264
NP_441918.1_7 Forward -217 -198 -2.45882 0.297
NP_440982.1_1 Forward -35 -16 4.03023 0.294
NP_441469.1_8 Reverse -326 -335 6.78456 0.227
NP_441469.1_8 Forward -217 -208 6.48957 0.227
NP_441469.1_8 Reverse -206 -215 6.48957 0.227
NP_441469.1_8 Forward -337 -328 5.3096 0.277
NP_441469.1_8 Forward -24 -15 5.01461 0.297
NP_443064.1_6 Forward -216 -206 12.5669 0.0796
NP_443064.1_6 Reverse -207 -217 12.5669 0.0796
NP_442337.1_8 Reverse -218 -237 1.17943 0.241
NP_442337.1_8 Forward -347 -328 -0.000545616 0.26
NP_442578.1_7 Forward -215 -208 14.5921 0.026
NP_442578.1_7 Reverse -208 -215 14.5921 0.026
NP_440710.1_1 Forward -224 -206 -5.09406 0.212
NP_441462.1_2 Forward -216 -206 11.5831 0.00406
NP_441462.1_2 Reverse -207 -217 11.5831 0.00406
NP_441462.1_2 Forward -73 -63 7.64985 0.0543
NP_441462.1_2 Forward -336 -326 0.865012 0.117
NP_443062.1_1 Reverse -213 -231 15.1764 0.041
NP_443062.1_1 Forward -336 -318 14.4939 0.0465
NP_443062.1_1 Forward -216 -198 11.9587 0.0887
NP_443062.1_1 Reverse -14 -32 6.8883 0.19
NP_443062.1_1 Reverse -207 -225 3.57305 0.293
NP_443062.1_6 Forward -344 -325 18.4857 0.0448
NP_443062.1_6 Reverse -199 -218 0.884433 0.286
NP_443062.1_6 Forward -322 -303 0.786102 0.288
NP_442204.1_1 Forward -340 -329 0.94365 0.281
NP_442204.1_6 Reverse -371 -390 14.6508 0.1
NP_440516.1_2 Forward -342 -324 1.59244 0.194
NP_440516.1_2 Reverse -321 -339 -2.0458 0.297
NP_440516.1_6 Forward -44 -30 8.25877 0.247
NP_440516.1_8 Forward -216 -207 16.9127 0.00442
NP_440516.1_8 Reverse -207 -216 16.9127 0.00442
NP_440516.1_8 Forward -336 -327 -0.295266 0.232
NP_440516.1_8 Forward -73 -64 -0.393597 0.255
NP_442428.1_4 Reverse -259 -278 2.55606 0.252
NP_442428.1_4 Reverse -206 -225 2.0644 0.271
NP_442428.1_5 Forward -215 -208 15.8704 0.0124
NP_442428.1_5 Reverse -208 -215 15.8704 0.0124
NP_442428.1_5 Forward -335 -328 14.1988 0.0242
NP_442428.1_5 Reverse -328 -335 6.0373 0.212
NP_442428.1_5 Forward -221 -214 4.66067 0.244
NP_442428.1_5 Reverse -15 -22 4.66067 0.244
NP_441353.1_2 Reverse -102 -121 11.7992 0.113
NP_441790.1_4 Forward -273 -254 13.0775 0.268
NP_442859.1_2 Reverse -208 -227 6.88262 0.199
NP_440603.1_9 Reverse -273 -292 8.65258 0.217
NP_440673.1_3 Forward -214 -207 12.4288 0.0426
NP_440673.1_3 Reverse -209 -216 12.4288 0.0426
NP_440673.1_3 Reverse -329 -336 11.6422 0.0724
NP_440673.1_3 Forward -21 -14 10.4622 0.139
NP_441052.1_2 Forward -216 -206 19.9412 0.00106
NP_441052.1_2 Reverse -207 -217 19.9412 0.00106
NP_441052.1_2 Reverse -327 -337 8.4365 0.0449
NP_441052.1_2 Reverse -272 -282 5.48657 0.116
NP_442219.1_8 Forward -220 -201 7.87721 0.26
NP_442219.1_9 Forward -215 -206 17.7976 0.00718
NP_442219.1_9 Reverse -208 -217 17.7976 0.00718
NP_442219.1_9 Reverse -328 -337 7.96454 0.0696
NP_442219.1_9 Reverse -273 -282 2.06468 0.289
NP_440436.1_4 Forward -215 -206 17.2072 0.00233
NP_440436.1_4 Reverse -208 -217 17.2072 0.00233
NP_440436.1_4 Reverse -328 -337 14.2573 0.0147
NP_440436.1_4 Forward -335 -326 7.37413 0.132
NP_441884.1_8 Reverse -13 -32 3.73603 0.0952
NP_441884.1_8 Forward -74 -55 -8.752 0.262
NP_441884.1_8 Reverse -152 -171 -10.227 0.268
NP_441884.1_9 Forward -271 -252 -4.22878 0.0594
NP_441719.1_4 Forward -215 -208 16.3621 0.0124
NP_441719.1_4 Reverse -208 -215 16.3621 0.0124
NP_441719.1_4 Forward -335 -328 6.62729 0.151
NP_441719.1_4 Reverse -328 -335 6.52896 0.188
NP_441004.1_1 Reverse -287 -306 0.491109 0.116
NP_441004.1_1 Forward -286 -267 -0.295539 0.123
NP_441004.1_1 Forward -253 -234 -17.2085 0.29
NP_441004.1_1 Forward -287 -268 -17.3068 0.29
NP_441004.1_2 Forward -335 -316 10.8159 0.145
NP_441004.1_5 Reverse -167 -181 6.6861 0.298
NP_442366.1_3 Forward -217 -199 -4.60241 0.274
NP_442366.1_5 Reverse -204 -214 14.8275 0.0375
NP_441115.1_4 Forward -217 -199 7.78652 0.272
NP_441115.1_4 Reverse -326 -344 7.19654 0.295
NP_442206.1_10 Forward -336 -321 0.0782283 0.274
NP_442854.1_6 Reverse -207 -226 6.39097 0.238
NP_443054.1_2 Forward -218 -204 11.0127 0.0761
NP_443054.1_2 Reverse -365 -379 2.65453 0.242
NP_441851.1_9 Reverse -281 -300 7.96426 0.279
NP_441851.1_10 Forward -217 -207 15.8113 0.00552
NP_441851.1_10 Reverse -206 -216 15.8113 0.00552
NP_441851.1_10 Forward -337 -327 15.5163 0.00871
NP_441851.1_10 Forward -282 -272 10.5014 0.0908
NP_441851.1_10 Forward -74 -64 7.35486 0.142
NP_441668.1_4 Reverse -197 -216 6.58763 0.162
NP_442515.1_1 Reverse -206 -220 8.75105 0.0715
NP_442515.1_1 Forward -217 -203 -4.91696 0.298
NP_440593.1_3 Reverse -202 -221 7.07928 0.109
NP_440593.1_3 Reverse -267 -286 1.0811 0.19
NP_440593.1_3 Reverse -285 -304 -2.0655 0.221
NP_440593.1_3 Forward -292 -273 -5.01543 0.256
NP_440593.1_3 Reverse -375 -394 -5.9004 0.268
NP_440463.1_8 Forward -45 -26 7.88715 0.264
NP_440463.1_8 Forward -312 -293 7.01583 0.267
NP_441046.1_2 Forward -227 -208 12.2908 0.182
NP_441046.1_2 Reverse -196 -215 3.73603 0.231
NP_441046.1_2 Forward -351 -332 -0.983855 0.287
NP_440940.1_7 Forward -226 -208 6.50823 0.224
NP_441349.1_10 Forward -226 -207 10.9142 0.0232
NP_441349.1_10 Forward -346 -327 -9.14533 0.284
NP_441349.1_10 Reverse -317 -336 -9.73531 0.297
NP_441409.1_6 Forward -342 -323 -8.26035 0.165
NP_441409.1_6 Forward -389 -370 -12.1936 0.225
NP_440432.1_2 Reverse -266 -285 -1.37718 0.249
NP_440432.1_9 Forward -215 -200 -3.95334 0.194
NP_442843.1_1 Reverse -15 -34 -4.22878 0.235
NP_442843.1_1 Forward -286 -267 -8.752 0.261
NP_442843.1_1 Reverse -251 -270 -9.24366 0.264
NP_442843.1_1 Forward -170 -151 -9.83364 0.271
NP_439960.1_10 Forward -288 -270 1.10079 0.203
NP_440431.1_3 Reverse -326 -345 -11.2103 0.284
NP_442450.1_5 Forward -218 -208 9.32148 0.115
NP_442450.1_5 Reverse -205 -215 7.55152 0.13
NP_442450.1_5 Reverse -211 -221 4.89658 0.278
NP_440588.1_2 Forward -345 -326 2.75272 0.114
NP_440588.1_2 Reverse -263 -282 -5.60541 0.256
NP_440195.1_4 Reverse -195 -214 13.3725 0.127
NP_440954.1_1 Reverse -374 -393 -4.52377 0.289
NP_442006.1_2 Reverse -278 -295 -7.43431 0.173
NP_442006.1_2 Forward -275 -258 -18.7424 0.295
NP_441003.1_9 Forward -296 -277 4.12936 0.288
NP_441570.1_1 Reverse -207 -225 11.5239 0.00743
NP_441570.1_1 Forward -216 -198 -1.75081 0.0591
NP_441570.1_1 Forward -342 -324 -10.6006 0.174
NP_441570.1_1 Reverse -153 -171 -16.0088 0.237
NP_441570.1_1 Reverse -213 -231 -16.9921 0.26
NP_440078.1_10 Forward -216 -197 3.53937 0.262
NP_441078.1_4 Forward -216 -207 19.6659 0.0007
NP_441078.1_4 Reverse -207 -216 19.6659 0.0007
NP_441078.1_4 Forward -336 -327 7.57121 0.0591
NP_441078.1_4 Reverse -327 -336 0.589713 0.174
NP_441078.1_4 Reverse -272 -281 -1.77023 0.266
NP_441078.1_4 Forward -281 -272 -1.77023 0.266
NP_441528.1_2 Reverse -268 -287 9.83173 0.255
NP_441663.1_8 Forward -186 -167 -3.04881 0.276
NP_442348.1_2 Forward -350 -341 14.7494 0.146
NP_442348.1_2 Forward -351 -342 7.57121 0.28
NP_440707.1_6 Reverse -333 -352 14.4533 0.172
NP_440526.1_3 Forward -215 -204 10.2846 0.0646
NP_440526.1_3 Reverse -328 -339 0.943182 0.267
NP_440526.1_3 Reverse -208 -219 0.844851 0.267
NP_441432.1_8 Reverse -206 -215 16.8143 0.00595
NP_441432.1_8 Forward -217 -208 16.8143 0.00595
NP_441432.1_8 Forward -337 -328 14.0611 0.0258
NP_442320.1_8 Reverse -201 -215 4.32615 0.0511
NP_442320.1_8 Forward -222 -208 -2.95034 0.1
NP_442344.1_7 Forward -215 -196 -7.37537 0.182
NP_441732.1_2 Reverse -203 -219 2.91013 0.0145
NP_441732.1_2 Forward -220 -204 -7.80794 0.0935
NP_440685.1_6 Reverse -324 -343 18.7798 0.0953
NP_440760.1_1 Forward -216 -197 -4.52377 0.0447
NP_440760.1_1 Reverse -207 -226 -11.3086 0.0851
NP_440199.1_10 Forward -219 -209 15.5163 0.0861
NP_440199.1_10 Reverse -204 -214 7.25653 0.231
NP_441945.1_10 Reverse -271 -290 10.6192 0.247
NP_442353.1_4 Reverse -201 -220 18.6815 0.0597
NP_441072.1_2 Forward -200 -181 6.78429 0.269
NP_440713.1_4 Forward -226 -207 8.45592 0.17
NP_440713.1_4 Forward -285 -266 6.88262 0.184
NP_442489.1_2 Reverse -316 -335 9.73422 0.168
NP_442489.1_7 Forward -216 -207 20.1576 0.000695
NP_442489.1_7 Reverse -207 -216 20.1576 0.000695
NP_442489.1_7 Forward -336 -327 8.06287 0.0371
NP_442489.1_7 Reverse -327 -336 0.589713 0.17
NP_442489.1_7 Forward -281 -272 -1.27858 0.185
NP_442489.1_7 Forward -73 -64 -1.96689 0.28
NP_440565.1_1 Reverse -221 -240 18.1907 0.198
NP_442079.1_7 Forward -335 -316 2.94938 0.22
NP_440559.1_1 Forward -215 -206 17.4043 0.00658
NP_440559.1_1 Reverse -208 -217 17.4043 0.00658
NP_440559.1_1 Reverse -328 -337 7.76787 0.0918
NP_440559.1_1 Reverse -65 -74 4.42462 0.277
NP_441659.2_8 Forward -216 -206 18.1713 0.00133
NP_441659.2_8 Reverse -207 -217 18.1713 0.00133
NP_441659.2_8 Reverse -327 -337 13.8447 0.0108
NP_441659.2_8 Reverse -64 -74 4.50326 0.132
NP_441659.2_8 Forward -383 -373 3.02829 0.177
NP_442749.1_5 Forward -358 -341 10.1518 0.192
NP_441092.1_6 Reverse -18 -37 8.65258 0.233
NP_442913.1_10 Reverse -198 -217 17.404 0.0136
NP_442913.1_10 Forward -225 -206 1.27776 0.144
NP_441040.1_5 Forward -227 -208 4.71934 0.245
NP_441040.1_5 Forward -285 -266 1.96607 0.295
NP_442008.1_2 Forward -284 -265 6.78429 0.217
NP_440442.1_3 Forward -223 -209 17.0108 0.22
NP_440779.1_5 Forward -23 -6 -13.9242 0.234
NP_442346.1_5 Forward -217 -207 16.6963 0.00248
NP_442346.1_5 Reverse -206 -216 16.6963 0.00248
NP_442346.1_5 Forward -337 -327 15.418 0.00627
NP_442346.1_5 Reverse -13 -23 10.6981 0.0888
NP_442346.1_5 Reverse -326 -336 5.68323 0.234
NP_442346.1_5 Reverse -379 -389 5.09324 0.262
NP_440545.1_3 Reverse -203 -220 2.20212 0.106
NP_440545.1_3 Reverse -376 -393 0.235503 0.143
NP_440831.1_3 Reverse -134 -153 11.9205 0.155
NP_440831.1_3 Reverse -1 -20 9.68776 0.188
NP_441629.1_3 Forward -36 -17 1.57197 0.231
NP_441786.1_10 Forward -225 -206 7.37428 0.268
NP_440486.1_4 Reverse -136 -154 -4.79907 0.286
NP_440459.1_2 Forward -218 -201 12.0352 0.163
NP_440459.1_2 Reverse -198 -215 11.1502 0.181
NP_440459.1_2 Forward -391 -374 8.98696 0.243
NP_440459.1_2 Forward -235 -218 8.00365 0.272
NP_441653.1_2 Reverse -196 -215 7.68487 0.211
NP_440010.1_4 Forward -226 -207 -2.36125 0.281
NP_440010.1_10 Reverse -221 -240 6.19431 0.226
NP_442603.1_7 Reverse -327 -341 10.5204 0.125
NP_441888.1_7 Forward -28 -14 4.52282 0.225
NP_441888.1_7 Reverse -322 -336 3.24451 0.225
NP_440449.1_6 Reverse -162 -180 6.21331 0.255
NP_440449.1_6 Reverse -175 -193 5.72699 0.271
NP_439970.1_2 Reverse -195 -214 17.5024 0.0919
NP_441358.1_2 Reverse -14 -33 4.916 0.296
NP_441833.1_4 Forward -215 -208 15.9687 0.0124
NP_441833.1_4 Reverse -208 -215 15.9687 0.0124
NP_441833.1_4 Forward -335 -328 6.23397 0.163
NP_441833.1_4 Reverse -328 -335 6.13563 0.198
NP_442162.1_9 Forward -215 -208 16.2637 0.0124
NP_442162.1_9 Reverse -208 -215 16.2637 0.0124
NP_442162.1_9 Forward -72 -65 9.28223 0.0694
NP_442162.1_9 Forward -335 -328 6.62729 0.142
NP_442162.1_9 Reverse -328 -335 6.43063 0.208
NP_440671.1_4 Forward -222 -208 8.45605 0.198
NP_440671.1_4 Forward -79 -65 8.16106 0.202
NP_440671.1_4 Reverse -201 -215 6.88276 0.233
NP_440671.1_4 Reverse -8 -22 6.58777 0.243
NP_440671.1_4 Reverse -114 -128 5.80112 0.271
NP_443026.1_5 Forward -356 -337 -5.11376 0.293
NP_441044.1_4 Reverse -338 -356 4.6407 0.227
NP_442199.1_5 Reverse -319 -338 2.94938 0.139
NP_442140.1_1 Forward -398 -379 13.7255 0.242
NP_442140.1_3 Forward -335 -325 12.9597 0.0632
NP_442140.1_3 Forward -215 -205 12.2714 0.0632
NP_442140.1_3 Reverse -328 -338 6.46988 0.168
NP_442140.1_3 Reverse -15 -25 5.38824 0.211
NP_442140.1_3 Reverse -208 -218 4.40493 0.243
NP_442723.1_1 Reverse -203 -222 2.75194 0.283
NP_440875.1_9 Forward -334 -324 13.5309 0.0677
NP_442547.1_7 Reverse -268 -287 11.3903 0.258
NP_442547.1_7 Forward -392 -373 10.3196 0.279
NP_441813.1_5 Forward -218 -208 15.9097 0.01
NP_441813.1_5 Reverse -325 -335 8.82982 0.0367
NP_441813.1_5 Reverse -205 -215 8.63316 0.0367
NP_441813.1_5 Forward -338 -328 8.4365 0.0432
NP_440152.1_5 Forward -166 -147 20.3531 0.116
NP_440590.1_4 Forward -215 -202 19.1938 0.00669
NP_440590.1_4 Reverse -328 -341 3.75586 0.0686
NP_440590.1_4 Reverse -208 -221 2.87088 0.0788
NP_440567.1_1 Reverse -208 -222 11.0127 0.0305
NP_440567.1_1 Forward -215 -201 5.30946 0.104
NP_442497.1_10 Forward -215 -206 10.4228 0.0087
NP_442497.1_10 Reverse -208 -217 10.4228 0.0087
NP_442497.1_10 Reverse -328 -337 0.589713 0.153
NP_442497.1_10 Reverse -65 -74 0.29472 0.199
NP_442497.1_10 Forward -335 -326 -1.18024 0.256
NP_440821.1_4 Forward -218 -208 18.2696 0.00448
NP_440821.1_4 Reverse -205 -215 9.41981 0.0286
NP_440821.1_4 Forward -75 -65 0.275027 0.19
NP_440821.1_4 Forward -338 -328 -0.314959 0.251
NP_441239.1_9 Reverse -325 -337 13.2153 0.0386
NP_441239.1_9 Reverse -62 -74 9.97041 0.0912
NP_441239.1_9 Forward -46 -34 7.80712 0.148
NP_441239.1_9 Forward -391 -379 5.25052 0.223
NP_441239.1_9 Forward -218 -206 4.36554 0.253
NP_441239.1_9 Reverse -372 -384 4.16888 0.26
NP_441239.1_9 Reverse -205 -217 3.38223 0.285
NP_441239.1_9 Forward -338 -326 3.18557 0.292
NP_441951.1_9 Forward -43 -24 -0.39387 0.276
NP_441892.1_1 Forward -32 -15 -2.91109 0.23
NP_441892.1_1 Reverse -198 -215 -3.5994 0.244
NP_440665.1_1 Reverse -272 -291 -10.1286 0.244
NP_440665.1_2 Forward -288 -269 -5.60541 0.247
NP_442193.1_8 Forward -219 -200 14.4533 0.211
NP_442270.1_9 Forward -292 -273 -7.4737 0.213
NP_442270.1_9 Reverse -196 -215 -8.752 0.226
NP_442643.1_1 Forward -222 -203 -11.7019 0.231
NP_440900.1_3 Forward -149 -130 15.5357 0.259
NP_440900.1_4 Forward -83 -64 15.651 0.271
NP_440833.1_6 Reverse -339 -353 14.0603 0.157
NP_442216.1_4 Reverse -343 -351 8.1805 0.255
NP_442138.1_10 Forward -216 -197 -8.06369 0.296
NP_442809.1_6 Forward -239 -220 6.98095 0.256
NP_442809.1_6 Reverse -141 -160 0.884433 0.277
NP_442809.1_6 Forward -222 -203 0.884433 0.277
NP_440546.1_4 Forward -336 -326 12.9547 0.0572
NP_440546.1_4 Forward -216 -206 10.046 0.109
NP_440546.1_4 Reverse -207 -217 10.046 0.109
NP_440546.1_4 Reverse -327 -337 9.17338 0.151
NP_440546.1_4 Reverse -285 -295 9.17338 0.151
NP_440546.1_4 Forward -222 -212 8.10685 0.203
NP_440546.1_4 Forward -73 -63 7.23423 0.252
NP_440462.1_6 Forward -218 -208 7.74818 0.0699
NP_440462.1_6 Reverse -325 -335 6.76487 0.102
NP_440462.1_6 Forward -224 -214 4.69992 0.187
NP_440462.1_6 Reverse -205 -215 1.35667 0.294
NP_440868.1_4 Forward -220 -208 15.7719 0.0164
NP_440868.1_4 Forward -340 -328 9.87208 0.0421
NP_440868.1_4 Reverse -323 -335 -0.452677 0.269
NP_440868.1_4 Reverse -203 -215 -0.846001 0.282
NP_442402.1_4 Reverse -264 -283 1.6703 0.173
NP_442402.1_4 Forward -158 -139 -0.00131823 0.186
NP_442402.1_4 Forward -212 -193 -5.60616 0.245
NP_442402.1_4 Forward -187 -168 -9.04772 0.285
NP_441084.1_6 Forward -277 -263 17.2946 0.0523
NP_441084.1_6 Reverse -198 -212 11.865 0.185
NP_439942.1_7 Forward -349 -330 -2.26216 0.248
NP_442039.1_4 Forward -215 -208 15.1821 0.0124
NP_442039.1_4 Reverse -208 -215 15.1821 0.0124
NP_442039.1_4 Forward -72 -65 10.8555 0.109
NP_442039.1_4 Forward -335 -328 6.3323 0.289
NP_442039.1_7 Reverse -123 -133 12.0747 0.257
NP_441811.1_8 Forward -222 -208 14.9459 0.162
NP_442679.1_2 Forward -283 -264 8.35759 0.247
NP_440825.1_6 Forward -350 -331 8.25926 0.285
NP_440825.1_7 Forward -215 -205 12.9096 0.152
NP_442837.1_3 Forward -215 -208 15.7721 0.0124
NP_442837.1_3 Reverse -208 -215 15.7721 0.0124
NP_442837.1_3 Forward -335 -328 6.0373 0.25
NP_442837.1_3 Reverse -328 -335 5.93897 0.265
NP_441760.1_7 Reverse -220 -238 11.4255 0.233
NP_440160.1_2 Forward -281 -262 0.392778 0.228
NP_440160.1_5 Reverse -331 -341 15.5158 0.267
NP_442053.1_1 Forward -216 -207 18.3876 0.0007
NP_442053.1_1 Reverse -207 -216 18.3876 0.0007
NP_440505.1_3 Forward -218 -208 16.303 0.00696
NP_440505.1_3 Forward -338 -328 9.32148 0.122
NP_440505.1_3 Reverse -205 -215 9.22315 0.122
NP_442360.1_5 Forward -286 -276 14.3364 0.233
NP_441252.1_6 Forward -283 -276 11.6422 0.288
NP_441203.1_1 Reverse -171 -190 -12.7836 0.145
NP_441203.1_1 Forward -22 -3 -15.0452 0.21
NP_440914.1_1 Forward -216 -206 17.5935 0.000537
NP_440914.1_1 Reverse -207 -217 17.5935 0.000537
NP_440914.1_1 Forward -222 -212 9.68861 0.178
NP_440914.1_1 Forward -281 -271 9.10306 0.186
NP_440914.1_1 Reverse -327 -337 6.85846 0.263
NP_441011.1_8 Forward -335 -326 14.651 0.023
NP_441011.1_8 Forward -215 -206 8.25953 0.144
NP_441011.1_8 Reverse -208 -217 8.25953 0.144
NP_441011.1_8 Reverse -15 -24 5.21127 0.278
NP_442533.1_6 Forward -216 -207 17.2076 0.00137
NP_442533.1_6 Reverse -207 -216 17.2076 0.00137
NP_442533.1_6 Forward -336 -327 14.1594 0.0149
NP_442533.1_6 Reverse -327 -336 7.76787 0.0883
NP_442533.1_6 Reverse -272 -281 7.47288 0.0898
NP_442533.1_6 Reverse -213 -222 4.91628 0.165
NP_442533.1_6 Reverse -380 -389 4.71961 0.177
NP_442533.1_6 Reverse -266 -275 4.22796 0.186
NP_442533.1_6 Forward -275 -266 4.12963 0.191
NP_442533.1_6 Reverse -35 -44 4.12963 0.191
NP_442533.1_6 Forward -23 -14 3.04799 0.228
NP_442533.1_6 Forward -259 -250 1.57302 0.294
NP_442541.1_10 Reverse -266 -280 2.35894 0.262
NP_441482.1_7 Forward -222 -208 0.491246 0.0558
NP_441482.1_7 Reverse -201 -215 -8.35854 0.193
NP_441482.1_7 Forward -79 -65 -11.4068 0.262
NP_439944.1_9 Reverse -208 -218 19.0562 0.00329
NP_439944.1_9 Forward -215 -205 10.5014 0.0887
NP_439944.1_10 Reverse -368 -387 10.5209 0.293
NP_441028.1_6 Forward -149 -139 5.48612 0.255
NP_441028.1_6 Reverse -263 -273 3.8145 0.281
NP_440116.1_8 Forward -215 -196 10.1275 0.032
NP_440116.1_8 Reverse -208 -227 -0.688862 0.112
NP_440115.1_6 Forward -219 -209 8.4365 0.13
NP_440115.1_6 Forward -339 -329 5.28991 0.259
NP_440007.1_9 Reverse -281 -295 9.63603 0.17
NP_440007.1_9 Reverse -203 -217 1.08123 0.29
NP_441972.1_5 Forward -215 -196 2.94938 0.121
NP_441972.1_5 Forward -191 -172 -10.1286 0.299
NP_441106.1_1 Forward -217 -208 9.63616 0.0311
NP_441106.1_1 Reverse -206 -215 9.63616 0.0311
NP_441106.1_1 Reverse -326 -335 7.47288 0.0853
NP_441106.1_1 Forward -337 -328 6.48957 0.0895
NP_441106.1_1 Forward -223 -214 4.71961 0.21
NP_441106.1_1 Reverse -13 -22 2.94966 0.248
NP_441815.1_6 Reverse -316 -335 0.981987 0.254
NP_441869.1_2 Reverse -320 -339 8.35759 0.287
NP_439903.1_6 Forward -225 -206 2.6536 0.222
NP_442588.1_6 Forward -213 -194 10.7175 0.136
NP_442588.1_6 Reverse -363 -382 -2.36049 0.294
NP_442306.1_10 Forward -341 -322 -11.4069 0.129
NP_442306.1_10 Forward -157 -138 -21.4367 0.27
NP_442306.1_10 Reverse -30 -49 -21.83 0.291
NP_441286.1_1 Reverse -206 -218 21.3768 0.00196
NP_441286.1_1 Forward -217 -205 12.9203 0.00815
NP_440670.1_8 Forward -216 -207 18.3876 0.000699
NP_440670.1_8 Reverse -207 -216 18.3876 0.000699
NP_440670.1_8 Forward -73 -64 5.40793 0.158
NP_441479.1_9 Reverse -278 -296 15.0638 0.271
NP_440886.1_7 Reverse -326 -336 8.73102 0.0805
NP_440886.1_7 Forward -217 -207 7.94438 0.0805
NP_440886.1_7 Reverse -206 -216 7.94438 0.0805
NP_440886.1_7 Forward -294 -284 3.42118 0.282
NP_442614.1_2 Reverse -207 -221 13.4709 0.124
NP_442072.1_9 Forward -217 -199 5.32902 0.0167
NP_442072.1_9 Reverse -206 -224 -13.1572 0.102
NP_442072.1_9 Forward -74 -56 -14.3372 0.142
NP_442072.1_9 Forward -111 -93 -15.9105 0.192
NP_440907.2_8 Forward -215 -205 7.64939 0.117
NP_442264.1_5 Reverse -272 -286 11.3077 0.262
NP_441463.1_3 Forward -226 -207 -1.47551 0.141
NP_441463.1_3 Reverse -317 -336 -7.86702 0.262
NP_441463.1_6 Forward -224 -210 11.2476 0.224
NP_441626.1_2 Forward -215 -208 15.7721 0.0124
NP_441626.1_2 Reverse -208 -215 15.7721 0.0124
NP_441626.1_2 Forward -335 -328 6.52896 0.137
NP_441626.1_2 Reverse -328 -335 5.93897 0.231
NP_441626.1_6 Reverse -203 -221 8.86816 0.247
NP_442365.1_7 Reverse -203 -222 5.99764 0.121
NP_442794.1_1 Reverse -203 -215 12.4287 0.0721
NP_442794.1_1 Forward -60 -48 3.57889 0.286
NP_442615.1_1 Reverse -198 -216 6.11567 0.0364
NP_442615.1_1 Reverse -318 -336 -7.06068 0.273
NP_441962.1_4 Forward -221 -202 -4.52377 0.158
NP_441962.1_4 Reverse -375 -394 -7.17871 0.185
NP_441742.1_7 Forward -156 -137 16.5191 0.245
NP_440387.1_1 Reverse -207 -223 20.3147 0.00303
NP_440387.1_1 Forward -216 -200 4.28677 0.0441
NP_440387.1_1 Reverse -293 -309 -6.13632 0.268
NP_441431.1_2 Reverse -324 -338 10.3237 0.162
NP_441431.1_2 Reverse -11 -25 5.89884 0.284
NP_441431.1_2 Forward -392 -378 5.50552 0.298
NP_441488.1_8 Reverse -202 -216 11.897 0.146
NP_441836.1_2 Forward -342 -323 4.81767 0.132
NP_441836.1_2 Reverse -321 -340 -0.197208 0.212
NP_441836.1_2 Forward -395 -376 -0.4922 0.212
NP_441993.1_1 Reverse -374 -393 1.16703 0.284
NP_440814.1_4 Reverse -198 -217 -5.40875 0.2
NP_440814.1_8 Reverse -290 -309 0.294447 0.269
NP_440114.1_10 Forward -73 -59 13.7659 0.0502
NP_440114.1_10 Reverse -207 -221 9.14437 0.183
NP_442698.1_10 Reverse -376 -395 6.09597 0.233
NP_441510.2_10 Forward -391 -372 15.0441 0.184
NP_440287.1_6 Reverse -198 -217 13.8641 0.12
NP_441272.1_4 Reverse -191 -210 4.81767 0.214
NP_440293.1_3 Forward -288 -269 2.94938 0.192
NP_441237.1_9 Forward -215 -205 14.828 0.0242
NP_442743.1_5 Forward -221 -202 11.4058 0.142
NP_442930.1_1 Reverse -340 -350 15.9091 0.19
NP_439910.1_2 Reverse -319 -336 -3.40274 0.0452
NP_439910.1_2 Forward -224 -207 -13.5308 0.162
NP_439910.1_2 Reverse -199 -216 -13.8258 0.163
NP_440502.1_3 Forward -87 -77 13.9847 0.278
NP_442867.1_8 Forward -294 -275 9.93088 0.214
NP_440457.1_1 Forward -220 -208 11.4454 0.092
NP_440457.1_1 Forward -77 -65 9.47875 0.0927
NP_440457.1_1 Reverse -281 -293 4.16888 0.171
NP_440457.1_1 Reverse -31 -43 -0.846001 0.278
NP_442297.1_4 Reverse -281 -300 13.1133 0.255
NP_442509.1_9 Forward -216 -206 8.14104 0.192
NP_442509.1_9 Reverse -207 -217 8.14104 0.192
NP_442509.1_9 Reverse -143 -153 7.15773 0.234
NP_440660.1_6 Reverse -270 -289 11.3075 0.28
NP_442439.1_8 Reverse -326 -345 13.3725 0.172
NP_442514.1_5 Reverse -128 -147 -3.14789 0.222
NP_442514.1_5 Reverse -353 -372 -6.98278 0.275
NP_441440.1_8 Forward -290 -277 13.7856 0.299
NP_440554.1_4 Forward -335 -325 8.82982 0.0646
NP_440554.1_4 Reverse -208 -218 7.05986 0.106
NP_440554.1_4 Reverse -328 -338 5.97822 0.128
NP_440554.1_4 Reverse -214 -224 5.38824 0.15
NP_442862.1_3 Forward -347 -330 10.3636 0.211
NP_441885.1_5 Forward -216 -206 20.9245 0.000538
NP_441885.1_5 Reverse -207 -217 20.9245 0.000538
NP_441885.1_5 Reverse -327 -337 1.94665 0.0935
NP_441885.1_5 Forward -336 -326 0.471689 0.145
NP_441885.1_5 Reverse -272 -282 -0.118297 0.186
NP_440478.1_4 Forward -285 -266 20.4523 0.019
NP_440478.1_10 Reverse -325 -339 14.8476 0.107
NP_442341.1_7 Forward -217 -203 18.0925 0.0111
NP_442341.1_7 Reverse -206 -220 7.9644 0.0956
NP_442341.1_7 Forward -130 -116 5.60446 0.151
NP_442341.1_7 Forward -120 -106 4.52282 0.188
NP_442341.1_7 Forward -390 -376 1.96621 0.274
NP_442341.1_9 Reverse -205 -219 7.3738 0.2
NP_442341.1_9 Forward -218 -204 7.27547 0.202
NP_442341.1_9 Forward -296 -282 5.01387 0.284
NP_441173.1_9 Reverse -320 -328 9.75379 0.284
NP_441173.1_9 Forward -148 -140 9.75379 0.284
NP_442395.2_4 Forward -239 -220 0.0970122 0.279
NP_440423.1_6 Reverse -285 -304 -20.4534 0.259
NP_443000.1_7 Forward -218 -208 17.0896 0.00865
NP_443000.1_7 Reverse -205 -215 10.3048 0.0345
NP_443000.1_7 Forward -338 -328 10.2065 0.0355
NP_443000.1_7 Reverse -325 -335 1.06167 0.274
NP_440275.1_3 Forward -218 -208 8.1415 0.0602
NP_440275.1_3 Reverse -205 -215 8.04317 0.0602
NP_440275.1_3 Forward -338 -328 5.38824 0.153
NP_440091.1_1 Forward -220 -208 15.8703 0.0161
NP_440091.1_1 Reverse -203 -215 1.31728 0.198
NP_441307.1_6 Reverse -272 -291 7.37428 0.217
NP_439962.1_4 Forward -152 -133 -8.35868 0.293
NP_440149.1_8 Reverse -207 -226 12.9791 0.0312
NP_441105.1_3 Reverse -196 -215 -0.000545616 0.131
NP_441105.1_3 Forward -347 -328 -2.75381 0.167
NP_441105.1_3 Forward -227 -208 -3.04881 0.172
NP_441105.1_3 Reverse -202 -221 -3.24547 0.175
NP_441105.1_3 Reverse -261 -280 -5.21209 0.214
NP_441105.1_3 Forward -55 -36 -5.50708 0.22
NP_441105.1_3 Forward -34 -15 -7.86702 0.261
NP_441105.1_3 Reverse -316 -335 -8.16202 0.267
NP_440216.1_1 Forward -216 -202 0.196253 0.0284
NP_440216.1_1 Reverse -207 -221 -0.295402 0.0284
NP_440216.1_1 Forward -336 -322 -4.03198 0.096
NP_440216.1_9 Forward -231 -222 13.9627 0.184
NP_440172.1_1 Forward -216 -206 15.0247 0.00945
NP_440172.1_1 Reverse -207 -217 15.0247 0.00945
NP_440172.1_1 Forward -336 -326 8.23984 0.0653
NP_440172.1_1 Forward -73 -63 7.05986 0.0929
NP_442015.1_10 Forward -285 -272 12.5073 0.0368
NP_442015.1_10 Reverse -203 -216 11.3273 0.0372
NP_442015.1_10 Forward -220 -207 9.55739 0.0475
NP_442015.1_10 Forward -340 -327 -0.669033 0.277
NP_441226.1_7 Forward -215 -208 14.4934 0.0123
NP_441226.1_7 Reverse -208 -215 14.4934 0.0123
NP_441226.1_7 Reverse -328 -335 14.1984 0.024
NP_441226.1_7 Forward -22 -15 11.5435 0.0757
NP_441226.1_7 Reverse -214 -221 11.2485 0.0971
NP_441226.1_7 Forward -293 -286 6.52862 0.253
NP_441111.1_7 Forward -215 -207 18.7023 0.00294
NP_441111.1_7 Reverse -208 -216 18.7023 0.00294
NP_441111.1_7 Reverse -328 -336 8.86921 0.0589
NP_442379.1_10 Forward -223 -206 6.82368 0.112
NP_440244.1_1 Forward -365 -346 2.45773 0.186
NP_441766.1_2 Forward -216 -207 17.5026 0.00297
NP_441766.1_2 Reverse -207 -216 17.5026 0.00297
NP_441766.1_2 Forward -336 -327 8.1612 0.0645
NP_442417.1_5 Reverse -14 -28 9.34103 0.134
NP_442179.1_3 Reverse -208 -227 10.4225 0.192
NP_440416.1_9 Reverse -265 -284 -11.9969 0.155
NP_440416.1_9 Reverse -320 -339 -12.7836 0.16
NP_440416.1_9 Forward -288 -269 -17.0118 0.229
NP_440416.1_9 Reverse -200 -219 -17.3068 0.237
NP_440416.1_9 Reverse -206 -225 -19.8634 0.279
NP_440416.1_9 Forward -289 -270 -20.4534 0.285
NP_440416.1_9 Forward -343 -324 -20.5517 0.286
NP_443052.1_8 Forward -226 -207 -12.2919 0.252
NP_442116.1_2 Reverse -329 -348 14.1583 0.289
NP_440261.1_5 Reverse -328 -341 2.96921 0.0655
NP_440261.1_5 Forward -335 -322 -6.56889 0.201
NP_440261.1_5 Forward -215 -202 -10.4038 0.201
NP_440261.1_5 Reverse -208 -221 -12.1738 0.272
NP_440988.1_10 Forward -218 -204 8.19046 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGATATTTCGCATCCATGGCCACCGGATCTTGCCCTGTGACAAAGGGTAGGGGAATTTTTTGCTGGCGATGGCTGGGTAAATGCAGAGTAAGGGCTGCCTCTGTCACCCCATCCGCCTTGGGGAAGGCCAGGGGCAAATTCGACCAGGCCTGTAGCAAATCCGGCAGATCCAACGCAAAGGGATGGCGATCGCCAATGGTTTCTGGCAAAGGATGACCCCAGGTATCCGCCCAAAGAAACAGTTTGCCGCCGTTTTCCCCGTGGGAGGGTTGCCAATTACCGTGGATAGTCGCCATAGGATCTAGTTTCTGGTCTGTCCCATTCTAGGGCGATTGGTTATCCTTGATTATGGATGGGTCCCTGGCCCTCCTAACCTCAGCCGTCGCTCTTTGTCACCACC

CDS

ATGAGCCAAAATTCCAAAACTGCCCTGCGGGCCACCCTGCAAAGTCAGTTCTCGATTATTGTCAGTTTTTTAGCCATTTTTTGGCTTCTGGAAATCTTAGATGCGTTTGTTTTTCGGGGTAGTTTGGATCAATTTGGCATTTACCCCCGCTCCTTGGAAGGTCTGAGGGGAATTGTCTTTGCACCCTTTCTCCATGCCGATTTTGGTCATTTAATTGCCAACAGCGTCCCGTTCGTTGTTCTTGCCTGGTTGGTGATGCTCCAGGAAGTGAGTGATTTTTGGATTGTGACCATTATCACCATGGTGGTGGGCGGCCTGGGAGTCTGGTTGATCGCTCCCCCTAACACCGTCACCGTTGGGGCTAGCATTCTGATTTTTGGTTACTTAGGATTTTTACTCTTTCGAGGTTGGTTCCAAAAAAACCTGGCTTCCATTGTCCTTTCTATCGTTGTCCTAGTTCTCTACGGCAGTGCCCTTTGGGGACTATTGCCTGGTCGGGCGGGGGTTTCTTGGCAGGGTCATTTATTTGGCTTCATCGGTGGAGCGATCGCCGCTTGGTTAATTGCTAGGGAAAAGCATTACTACAGCAAAAATTAG

Protein

MSQNSKTALRATLQSQFSIIVSFLAIFWLLEILDAFVFRGSLDQFGIYPRSLEGLRGIVFAPFLHADFGHLIANSVPFVVLAWLVMLQEVSDFWIVTIITMVVGGLGVWLIAPPNTVTVGASILIFGYLGFLLFRGWFQKNLASIVLSIVVLVLYGSALWGLLPGRAGVSWQGHLFGFIGGAIAAWLIAREKHYYSKN