Your browser is old and dusty. Try Google Chrome!

Details for slr1459

ORF slr1459
Accession NP_442846.1
Symbol apcF
Category Phycobilisome
Definition phycobilisome core component
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -380 -366 11.3077 0.249
NP_441061.1_2 Reverse -280 -294 2.35953 0.177
NP_440557.1_1 Forward -287 -268 -0.197208 0.267
NP_440795.1_7 Forward -287 -280 14.6904 0.0123
NP_440795.1_7 Reverse -280 -287 14.6904 0.0123
NP_441418.1_6 Reverse -279 -298 -12.4886 0.066
NP_441418.1_6 Forward -288 -269 -20.945 0.133
NP_441418.1_6 Forward -297 -278 -30.2865 0.267
NP_441480.1_1 Forward -251 -232 -0.4922 0.287
NP_441480.1_5 Forward -242 -223 9.83255 0.282
NP_441453.1_4 Reverse -279 -287 16.539 0.00633
NP_441453.1_4 Forward -288 -280 16.539 0.00633
NP_441623.1_1 Forward -281 -263 -2.0458 0.241
NP_442151.1_6 Forward -288 -274 17.2075 0.0113
NP_442151.1_6 Reverse -279 -293 16.0275 0.0187
NP_441818.1_1 Forward -287 -276 8.51463 0.288
NP_441818.1_9 Forward -389 -370 9.73422 0.112
NP_441818.1_9 Forward -242 -223 8.55425 0.112
NP_441818.1_9 Forward -395 -376 -1.08219 0.198
NP_441630.1_3 Forward -296 -277 6.68596 0.126
NP_442623.1_3 Reverse -280 -299 -18.6834 0.263
NP_440931.1_7 Forward -324 -306 12.703 0.258
NP_442744.1_8 Forward -288 -269 -6.29373 0.297
NP_442287.1_1 Forward -46 -36 13.6475 0.277
NP_442655.1_1 Forward -293 -274 1.27776 0.238
NP_442655.1_10 Forward -291 -272 -19.4701 0.282
NP_442173.1_1 Forward -287 -279 15.4574 0.00633
NP_442173.1_1 Reverse -280 -288 15.4574 0.00633
NP_442752.1_4 Forward -288 -281 13.8055 0.0199
NP_442752.1_4 Reverse -279 -286 13.8055 0.0199
NP_443027.1_4 Reverse -312 -322 8.04317 0.219
NP_443027.1_4 Reverse -277 -287 7.35486 0.24
NP_443027.1_4 Forward -290 -280 6.46988 0.275
NP_442975.1_10 Reverse -3 -17 3.04726 0.263
NP_440784.1_7 Forward -287 -280 15.9687 0.0123
NP_440784.1_7 Reverse -280 -287 15.9687 0.0123
NP_440061.1_9 Reverse -277 -291 11.5037 0.109
NP_440110.1_8 Forward -290 -271 2.55606 0.211
NP_440110.1_8 Forward -388 -369 -2.75381 0.281
NP_441054.1_1 Reverse -347 -361 13.2743 0.275
NP_439979.1_2 Forward -300 -281 5.89931 0.292
NP_442062.1_8 Forward -288 -278 17.6796 0.00193
NP_442062.1_8 Reverse -279 -289 17.6796 0.00193
NP_440761.1_4 Forward -293 -274 -3.93378 0.132
NP_440761.1_4 Reverse -25 -44 -13.6686 0.257
NP_441995.1_8 Forward -18 -1 13.9035 0.26
NP_441859.1_3 Reverse -278 -297 6.39016 0.178
NP_441859.1_3 Reverse -186 -205 1.6703 0.278
NP_442972.1_1 Forward -166 -148 10.6535 0.265
NP_440304.1_4 Reverse -277 -287 18.9579 0.00406
NP_440304.1_4 Forward -290 -280 17.9746 0.00654
NP_442242.1_4 Forward -287 -280 14.3954 0.0124
NP_442242.1_4 Reverse -280 -287 14.3954 0.0124
NP_440908.1_5 Reverse -197 -214 11.2486 0.229
NP_441200.1_4 Reverse -310 -329 6.19431 0.283
NP_441208.1_1 Reverse -35 -54 -0.000545616 0.25
NP_441208.1_9 Forward -291 -277 7.66941 0.22
NP_440132.1_1 Forward -290 -272 8.86894 0.259
NP_442110.1_7 Forward -288 -274 12.291 0.0586
NP_442110.1_7 Reverse -279 -293 1.08123 0.239
NP_441925.1_4 Reverse -227 -246 -9.63771 0.224
NP_440014.1_6 Forward -297 -278 9.24257 0.254
NP_440856.1_7 Reverse -377 -396 -1.47551 0.182
NP_441083.1_5 Forward -288 -278 19.3512 0.000718
NP_441083.1_5 Reverse -279 -289 19.3512 0.000718
NP_441083.1_5 Forward -337 -327 2.43831 0.195
NP_442827.1_8 Reverse -271 -290 3.73524 0.144
NP_442827.1_8 Forward -296 -277 -2.95123 0.294
NP_441738.1_2 Forward -286 -279 15.28 0.0102
NP_441738.1_2 Reverse -281 -288 15.28 0.0102
NP_440209.1_1 Reverse -279 -287 18.1123 0.00295
NP_440209.1_1 Forward -288 -280 18.1123 0.00295
NP_440447.1_1 Reverse -274 -292 5.23069 0.213
NP_441713.1_1 Forward -294 -275 -10.6203 0.204
NP_440178.1_7 Reverse -278 -297 -20.7484 0.199
NP_440178.1_7 Forward -289 -270 -22.9117 0.282
NP_441716.1_1 Forward -288 -274 10.521 0.0951
NP_442111.1_4 Forward -289 -275 17.7975 0.00941
NP_442111.1_4 Reverse -278 -292 10.3243 0.0545
NP_440906.1_5 Forward -287 -280 15.8704 0.0124
NP_440906.1_5 Reverse -280 -287 15.8704 0.0124
NP_440747.1_10 Forward -291 -279 7.80712 0.00223
NP_440747.1_10 Reverse -276 -288 7.80712 0.00223
NP_441130.1_10 Reverse -277 -291 9.34103 0.126
NP_441486.1_1 Reverse -276 -290 -3.24533 0.177
NP_441486.1_1 Forward -291 -277 -4.7203 0.205
NP_442634.1_4 Forward -290 -276 13.9626 0.0209
NP_442634.1_4 Reverse -277 -291 4.91614 0.0699
NP_441265.1_3 Reverse -273 -287 11.5043 0.0897
NP_441265.1_3 Forward -294 -280 5.70279 0.181
NP_440842.1_6 Reverse -277 -296 9.53674 0.298
NP_441012.1_4 Reverse -344 -357 8.86907 0.272
NP_441012.1_4 Reverse -275 -288 7.19745 0.272
NP_443018.1_3 Forward -287 -280 14.8871 0.0123
NP_443018.1_3 Reverse -280 -287 14.8871 0.0123
NP_443018.1_3 Reverse -196 -203 5.34899 0.212
NP_441316.1_7 Reverse -277 -292 16.8928 0.0397
NP_440376.1_1 Forward -288 -279 19.4693 0.000692
NP_440376.1_1 Reverse -279 -288 19.4693 0.000692
NP_442730.1_8 Reverse -271 -290 4.03023 0.273
NP_442687.1_7 Forward -289 -279 18.5646 0.0028
NP_442687.1_7 Reverse -278 -288 18.5646 0.0028
NP_442191.1_7 Forward -299 -280 13.9625 0.206
NP_440066.1_5 Forward -117 -98 7.37347 0.266
NP_442485.1_3 Reverse -132 -151 -2.55715 0.262
NP_442485.1_3 Forward -299 -280 -4.52377 0.282
NP_440781.1_1 Reverse -131 -145 18.8791 0.121
NP_440642.1_10 Forward -268 -254 4.22722 0.259
NP_441013.1_2 Forward -293 -275 0.609134 0.254
NP_440042.1_2 Reverse -204 -223 -1.27885 0.237
NP_440533.1_9 Forward -288 -269 9.43923 0.147
NP_440667.1_8 Forward -44 -25 15.8299 0.188
NP_440360.1_10 Reverse -281 -295 7.76774 0.227
NP_442658.1_1 Forward -290 -280 17.6791 0.00565
NP_442658.1_1 Reverse -277 -287 14.8275 0.0188
NP_442782.1_7 Forward -296 -277 0.687771 0.21
NP_442205.1_9 Forward -112 -96 -3.38305 0.282
NP_441487.1_6 Forward -296 -277 8.06259 0.195
NP_441487.1_6 Reverse -271 -290 -1.18052 0.283
NP_442300.1_10 Forward -297 -278 16.5191 0.153
NP_441256.1_8 Reverse -28 -47 6.19431 0.267
NP_441256.1_8 Forward -198 -179 3.14605 0.284
NP_442937.1_5 Forward -299 -280 10.8159 0.152
NP_441958.1_5 Forward -289 -279 20.5312 0.000966
NP_441958.1_5 Reverse -278 -288 20.5312 0.000966
NP_442057.1_5 Reverse -164 -182 12.7779 0.229
NP_440203.1_5 Forward -285 -275 15.8108 0.0611
NP_440203.1_5 Reverse -282 -292 11.2876 0.2
NP_442816.1_7 Reverse -160 -179 3.77151 0.287
NP_439905.1_1 Reverse -280 -293 10.1474 0.216
NP_439905.1_3 Forward -396 -377 13.6675 0.199
NP_440995.1_8 Forward -101 -82 1.37609 0.264
NP_440984.1_7 Forward -293 -279 19.7641 0.0061
NP_442376.1_2 Forward -293 -274 -11.8003 0.286
NP_442690.1_1 Reverse -147 -166 -12.1936 0.241
NP_442911.1_2 Forward -298 -279 3.93269 0.0406
NP_442911.1_2 Reverse -269 -288 -6.68705 0.19
NP_442064.1_4 Forward -355 -336 5.89851 0.26
NP_440993.1_2 Reverse -274 -290 12.2516 0.0735
NP_441099.1_5 Forward -298 -279 -7.4737 0.176
NP_441099.1_5 Reverse -269 -288 -8.85033 0.206
NP_442002.1_9 Forward -289 -282 14.1004 0.074
NP_442002.1_9 Reverse -278 -285 14.1004 0.074
NP_441646.1_1 Reverse -5 -24 1.67108 0.23
NP_442438.1_10 Reverse -274 -288 9.73436 0.0602
NP_442438.1_10 Forward -293 -279 4.32615 0.148
NP_442431.1_10 Forward -392 -374 12.1139 0.0904
NP_442771.1_1 Forward -290 -272 14.2771 0.0174
NP_442771.1_1 Reverse -277 -295 2.96908 0.0672
NP_442771.1_1 Reverse -263 -281 -9.81395 0.232
NP_440484.1_1 Reverse -188 -207 9.24175 0.258
NP_440147.1_4 Reverse -277 -290 13.6873 0.0313
NP_440147.1_4 Forward -290 -277 4.24752 0.167
NP_441550.1_8 Forward -290 -280 19.8424 0.00352
NP_441550.1_8 Reverse -277 -287 15.4175 0.0132
NP_441916.1_7 Reverse -279 -289 16.893 0.00407
NP_441916.1_7 Forward -288 -278 16.893 0.00407
NP_441041.1_4 Reverse -303 -322 -10.0303 0.227
NP_441041.1_4 Forward -300 -281 -12.9802 0.278
NP_441041.1_7 Forward -291 -279 18.593 0.00508
NP_441041.1_7 Reverse -276 -288 9.94422 0.104
NP_440569.1_10 Reverse -149 -168 5.68135 0.237
NP_441547.1_2 Forward -122 -104 2.87075 0.294
NP_442004.1_6 Forward -288 -274 8.84938 0.14
NP_442004.1_6 Reverse -97 -111 7.37441 0.161
NP_442004.1_6 Reverse -279 -293 5.1128 0.197
NP_440703.1_9 Reverse -216 -229 8.77016 0.226
NP_441725.1_5 Forward -287 -277 21.0229 0.00533
NP_441725.1_5 Reverse -280 -290 18.7612 0.0119
NP_439966.1_7 Reverse -277 -287 9.12434 0.119
NP_439966.1_7 Forward -290 -280 8.14104 0.14
NP_439966.1_7 Reverse -286 -296 4.20782 0.285
NP_439966.1_9 Forward -290 -281 0.983037 0.253
NP_442941.1_3 Forward -287 -277 11.3864 0.0116
NP_442941.1_3 Reverse -280 -290 2.43831 0.14
NP_440289.1_2 Reverse -276 -289 15.9489 0.00946
NP_440289.1_2 Forward -291 -278 14.2773 0.0116
NP_442281.1_1 Reverse -274 -288 20.3534 0.00192
NP_442281.1_1 Forward -293 -279 17.7968 0.00542
NP_441334.1_7 Forward -290 -271 -12.0953 0.139
NP_442256.1_2 Forward -290 -272 -7.55234 0.214
NP_440437.1_1 Reverse -273 -292 8.84924 0.0538
NP_442012.1_1 Forward -294 -275 9.3409 0.0937
NP_442012.1_1 Reverse -273 -292 8.16093 0.105
NP_442012.1_1 Reverse -181 -200 0.982764 0.226
NP_441556.1_10 Forward -293 -279 10.5138 0.267
NP_442982.1_5 Reverse -269 -288 0.491109 0.24
NP_441644.1_6 Forward -288 -278 15.7125 0.0048
NP_441644.1_6 Reverse -279 -289 15.7125 0.0048
NP_442215.1_2 Forward -290 -274 14.4149 0.0205
NP_442215.1_2 Forward -359 -343 13.0382 0.0255
NP_442215.1_2 Reverse -277 -293 -2.49807 0.198
NP_442029.1_6 Reverse -309 -328 6.98095 0.231
NP_440929.1_8 Forward -288 -279 19.2726 0.000701
NP_440929.1_8 Reverse -279 -288 19.2726 0.000701
NP_442933.1_2 Forward -164 -146 6.59093 0.269
NP_442933.1_10 Forward -288 -279 17.601 0.00325
NP_442933.1_10 Reverse -279 -288 17.601 0.00325
NP_441095.1_6 Forward -56 -37 6.29264 0.262
NP_441751.2_8 Reverse -280 -294 13.9626 0.0133
NP_441751.2_8 Forward -287 -273 -1.5737 0.129
NP_442926.1_3 Forward -299 -280 4.32602 0.265
NP_442926.1_5 Reverse -274 -293 12.4059 0.19
NP_442554.1_8 Reverse -280 -290 16.9913 0.0065
NP_442554.1_8 Forward -287 -277 14.828 0.0108
NP_441762.1_7 Reverse -278 -290 11.1504 0.0142
NP_441762.1_7 Forward -289 -277 1.61227 0.0736
NP_441762.1_7 Forward -298 -286 -5.46756 0.212
NP_442142.1_4 Reverse -276 -289 8.47516 0.113
NP_442142.1_4 Reverse -285 -298 6.60689 0.16
NP_442142.1_4 Forward -291 -278 6.50855 0.163
NP_442142.1_4 Reverse -383 -396 3.65697 0.248
NP_442292.1_1 Forward -287 -278 9.53783 0.0183
NP_442292.1_1 Reverse -280 -289 9.53783 0.0183
NP_442292.1_5 Forward -292 -273 -0.295539 0.257
NP_442476.1_6 Reverse -280 -294 12.0943 0.0525
NP_442476.1_6 Forward -287 -273 2.75286 0.174
NP_443009.1_5 Forward -289 -278 18.0527 0.00334
NP_443009.1_5 Reverse -278 -289 18.0527 0.00334
NP_441715.1_4 Forward -287 -277 7.25653 0.108
NP_440777.1_7 Reverse -79 -98 10.5209 0.284
NP_441198.1_8 Forward -290 -280 15.2245 0.0427
NP_441198.1_8 Reverse -277 -287 13.076 0.108
NP_441468.1_1 Forward -287 -280 15.8704 0.0124
NP_441468.1_1 Reverse -280 -287 15.8704 0.0124
NP_441020.2_6 Forward -290 -273 13.2152 0.0765
NP_441020.2_6 Reverse -277 -294 10.4619 0.142
NP_441015.1_10 Forward -299 -280 5.11266 0.116
NP_441015.1_10 Forward -293 -274 -5.60541 0.228
NP_441015.1_10 Forward -391 -372 -10.227 0.283
NP_441673.1_1 Forward -288 -279 20.8459 0.000698
NP_441673.1_1 Reverse -279 -288 20.8459 0.000698
NP_441826.1_2 Forward -294 -280 14.8476 0.0196
NP_441826.1_2 Reverse -273 -287 14.5526 0.0196
NP_442811.1_2 Forward -302 -283 0.196116 0.252
NP_442490.1_9 Forward -300 -281 -7.67036 0.278
NP_442868.1_6 Forward -290 -280 16.7946 0.0131
NP_442868.1_6 Reverse -277 -287 9.22315 0.0527
NP_442719.1_2 Forward -272 -254 -2.34152 0.186
NP_442719.1_2 Reverse -206 -224 -7.15971 0.232
NP_442719.1_2 Reverse -150 -168 -11.3879 0.291
NP_441056.1_1 Reverse -279 -298 -6.88371 0.271
NP_442808.1_1 Reverse -278 -288 8.73102 0.0481
NP_442808.1_1 Forward -289 -279 8.73102 0.0481
NP_442808.1_1 Reverse -287 -297 0.962914 0.299
NP_441101.1_10 Reverse -275 -294 2.0644 0.173
NP_440145.1_3 Reverse -269 -288 0.294447 0.137
NP_442542.1_2 Forward -290 -277 22.4387 0.00161
NP_442050.1_5 Reverse -277 -287 15.8108 0.0091
NP_442050.1_5 Forward -290 -280 14.9258 0.0175
NP_442342.1_9 Forward -290 -274 12.8416 0.103
NP_441493.2_4 Forward -297 -278 11.6025 0.241
NP_440601.1_2 Reverse -220 -238 14.8671 0.279
NP_441114.1_3 Reverse -197 -206 7.66954 0.231
NP_440558.1_2 Reverse -98 -117 10.1275 0.0976
NP_442789.1_5 Reverse -307 -326 4.42435 0.215
NP_441878.1_6 Forward -289 -279 20.2362 0.0046
NP_441878.1_6 Reverse -278 -288 20.2362 0.0046
NP_441878.1_6 Forward -197 -187 -7.59145 0.245
NP_441036.1_8 Forward -289 -279 8.4365 0.174
NP_441036.1_8 Reverse -278 -288 8.4365 0.174
NP_441557.1_5 Forward -288 -279 19.9609 0.000699
NP_441557.1_5 Reverse -279 -288 19.9609 0.000699
NP_441445.1_1 Forward -297 -278 8.65258 0.117
NP_441445.1_1 Forward -224 -205 -0.590531 0.297
NP_442066.2_4 Reverse -279 -298 6.68596 0.092
NP_442066.2_4 Forward -288 -269 -7.4737 0.28
NP_440101.1_3 Forward -293 -274 21.6323 0.0157
NP_440101.1_5 Reverse -272 -291 8.84924 0.183
NP_442830.1_5 Forward -46 -32 2.35894 0.271
NP_442183.1_1 Reverse -279 -293 9.73436 0.094
NP_442183.1_1 Forward -288 -274 8.84938 0.107
NP_442166.1_3 Reverse -141 -160 -10.522 0.264
NP_440595.1_8 Reverse -279 -298 9.0459 0.271
NP_441574.1_1 Forward -300 -281 -1.96717 0.222
NP_441549.1_9 Forward -292 -274 10.3439 0.0399
NP_441549.1_9 Reverse -275 -293 -1.16082 0.161
NP_442347.1_2 Reverse -83 -92 8.1612 0.108
NP_442347.1_2 Reverse -362 -371 3.83464 0.284
NP_442347.1_2 Forward -287 -278 3.34298 0.284
NP_442347.1_2 Reverse -280 -289 3.34298 0.284
NP_442347.1_10 Forward -317 -303 17.2068 0.149
NP_442645.1_2 Reverse -306 -325 -22.8133 0.296
NP_441037.1_4 Forward -290 -280 18.9151 0.00351
NP_441037.1_4 Reverse -277 -287 9.65667 0.21
NP_441037.1_4 Forward -16 -6 8.77956 0.237
NP_442594.1_8 Forward -375 -356 6.19431 0.236
NP_441633.1_3 Reverse -277 -290 6.01747 0.0481
NP_441633.1_3 Forward -290 -277 -3.81562 0.177
NP_441633.1_3 Forward -93 -80 -6.96221 0.283
NP_441633.1_3 Reverse -376 -389 -7.25721 0.3
NP_440136.1_2 Forward -287 -280 15.9687 0.0123
NP_440136.1_2 Reverse -280 -287 15.9687 0.0123
NP_442590.1_9 Reverse -205 -224 12.8808 0.223
NP_442998.1_10 Forward -286 -279 15.5754 0.0102
NP_442998.1_10 Reverse -281 -288 15.5754 0.0102
NP_440731.1_2 Reverse -309 -328 5.11266 0.293
NP_440731.1_10 Reverse -352 -371 11.4058 0.292
NP_440899.1_2 Reverse -268 -287 10.3234 0.166
NP_440899.1_8 Reverse -150 -169 -6.29373 0.231
NP_440299.1_1 Reverse -275 -288 19.0949 0.00293
NP_440299.1_1 Forward -292 -279 8.86849 0.0835
NP_440299.1_1 Forward -316 -303 5.82024 0.162
NP_441799.1_1 Forward -292 -278 8.84875 0.105
NP_441007.1_10 Forward -293 -280 18.9972 0.0299
NP_441007.1_10 Reverse -274 -287 -0.275709 0.273
NP_442334.1_2 Forward -298 -281 -13.8258 0.297
NP_442201.1_10 Forward -299 -280 -12.6852 0.268
NP_442333.2_5 Forward -299 -280 -11.2103 0.246
NP_442333.2_5 Reverse -331 -350 -11.3086 0.246
NP_440256.1_1 Forward -315 -296 -0.295539 0.0918
NP_440087.1_1 Forward -297 -278 -3.73712 0.237
NP_442007.1_8 Reverse -278 -296 13.4897 0.258
NP_441559.1_8 Reverse -274 -288 -6.68692 0.279
NP_441270.1_5 Forward -123 -104 11.14 0.294
NP_442860.1_7 Forward -168 -150 9.57635 0.283
NP_440915.1_6 Reverse -275 -289 13.4709 0.0187
NP_440915.1_6 Forward -292 -278 13.3726 0.0187
NP_440915.1_6 Reverse -324 -338 -2.65535 0.278
NP_442866.1_1 Forward -293 -274 16.2241 0.0681
NP_442031.1_5 Forward -400 -381 4.916 0.298
NP_441464.1_8 Reverse -378 -392 6.09611 0.247
NP_440695.1_5 Forward -300 -281 1.76941 0.277
NP_440695.1_5 Reverse -279 -298 -1.37718 0.284
NP_441199.1_6 Reverse -275 -294 10.1275 0.0781
NP_441494.1_6 Forward -293 -280 17.4239 0.0758
NP_441494.1_6 Reverse -274 -287 7.98409 0.242
NP_442386.1_9 Forward -289 -280 6.39082 0.219
NP_442386.1_9 Reverse -278 -287 6.39082 0.219
NP_442386.1_10 Forward -377 -364 10.5407 0.217
NP_441340.1_5 Forward -287 -280 15.6737 0.0124
NP_441340.1_5 Reverse -280 -287 15.6737 0.0124
NP_442791.1_1 Reverse -214 -233 6.78429 0.25
NP_440168.1_9 Reverse -277 -296 -1.27885 0.273
NP_442240.1_2 Forward -287 -268 -2.95047 0.0731
NP_440586.1_8 Forward -287 -280 13.2151 0.026
NP_440586.1_8 Reverse -280 -287 13.2151 0.026
NP_440586.1_8 Forward -184 -177 7.02027 0.279
NP_440586.1_9 Forward -232 -213 11.1109 0.258
NP_442251.1_6 Forward -287 -280 15.2804 0.0124
NP_442251.1_6 Reverse -280 -287 15.2804 0.0124
NP_440192.1_5 Forward -387 -368 2.85105 0.295
NP_442959.1_7 Forward -397 -378 -2.85214 0.25
NP_441262.1_3 Reverse -279 -286 14.7888 0.0223
NP_441262.1_3 Forward -288 -281 14.7888 0.0223
NP_443051.1_1 Reverse -278 -287 18.0926 0.00402
NP_443051.1_1 Forward -289 -280 18.0926 0.00402
NP_443051.1_5 Forward -177 -158 4.32602 0.293
NP_439984.1_3 Forward -295 -281 18.4851 0.0684
NP_439937.1_9 Reverse -278 -295 -5.07504 0.157
NP_439937.1_9 Forward -289 -272 -7.13998 0.157
NP_440408.1_7 Reverse -279 -298 14.5524 0.165
NP_440439.1_1 Forward -291 -278 10.639 0.0362
NP_440439.1_1 Reverse -276 -289 9.36073 0.0465
NP_440372.1_2 Forward -287 -280 16.3621 0.0124
NP_440372.1_2 Reverse -280 -287 16.3621 0.0124
NP_440171.1_3 Reverse -314 -333 3.53937 0.284
NP_441803.1_2 Reverse -274 -293 -0.000545616 0.263
NP_441803.1_2 Reverse -283 -302 -1.08219 0.294
NP_439977.1_5 Forward -294 -275 -0.983855 0.239
NP_440139.1_1 Reverse -273 -292 3.14526 0.214
NP_440139.1_1 Forward -294 -275 0.883656 0.279
NP_441572.1_7 Forward -294 -275 15.8307 0.026
NP_441572.1_7 Reverse -273 -292 10.2259 0.0626
NP_441572.1_7 Reverse -76 -95 -4.42544 0.235
NP_440267.1_2 Reverse -274 -288 6.39049 0.229
NP_442384.1_10 Forward -288 -275 18.0139 0.00545
NP_442384.1_10 Reverse -279 -292 10.049 0.047
NP_440364.1_10 Forward -242 -223 15.4374 0.256
NP_442790.1_4 Forward -297 -278 -10.522 0.213
NP_442790.1_4 Forward -245 -226 -10.9153 0.219
NP_442262.1_10 Forward -287 -280 14.1988 0.0123
NP_442262.1_10 Reverse -280 -287 14.1988 0.0123
NP_442262.1_10 Reverse -196 -203 7.6106 0.274
NP_441689.1_5 Reverse -277 -287 8.63269 0.132
NP_440344.1_10 Reverse -272 -289 -7.04099 0.115
NP_440282.1_2 Reverse -358 -377 11.8975 0.163
NP_440282.1_10 Forward -298 -279 -0.4922 0.21
NP_440282.1_10 Reverse -356 -375 -9.047 0.269
NP_440531.1_6 Reverse -198 -217 -4.03212 0.273
NP_440531.1_6 Reverse -271 -290 -5.01543 0.291
NP_441060.1_3 Forward -218 -199 12.9791 0.184
NP_440487.1_1 Forward -291 -272 -5.40875 0.218
NP_440562.1_3 Forward -287 -270 7.41366 0.15
NP_440562.1_3 Reverse -280 -297 7.31533 0.15
NP_441898.1_1 Forward -231 -212 17.0107 0.147
NP_440297.1_9 Forward -287 -277 19.0562 0.0359
NP_440297.1_9 Reverse -280 -290 9.51814 0.0917
NP_442280.1_10 Forward -322 -304 5.45442 0.284
NP_440894.1_10 Forward -293 -274 12.9791 0.121
NP_440894.1_10 Reverse -274 -293 2.16274 0.294
NP_440937.1_5 Forward -357 -338 10.5209 0.275
NP_442067.1_4 Reverse -268 -287 17.0107 0.0557
NP_440999.1_9 Forward -292 -278 7.66941 0.0846
NP_440999.1_9 Reverse -347 -361 1.17956 0.169
NP_440999.1_9 Reverse -275 -289 1.17956 0.169
NP_440888.1_2 Forward -288 -274 9.73373 0.116
NP_440888.1_2 Reverse -279 -293 7.17714 0.205
NP_440822.1_8 Reverse -140 -159 15.6341 0.161
NP_439969.1_3 Reverse -274 -293 -1.57384 0.279
NP_439969.1_3 Forward -293 -274 -2.16383 0.297
NP_442948.1_2 Forward -209 -190 9.0459 0.186
NP_442033.1_10 Forward -290 -271 9.63589 0.0493
NP_442818.1_3 Forward -219 -202 3.48043 0.234
NP_441543.1_2 Forward -287 -278 9.34117 0.0818
NP_441543.1_2 Reverse -280 -289 9.34117 0.0818
NP_442845.1_2 Forward -288 -274 13.3726 0.0955
NP_442845.1_2 Forward -112 -98 11.3077 0.131
NP_442845.1_2 Forward -294 -280 7.86607 0.195
NP_442845.1_2 Reverse -273 -287 5.50613 0.231
NP_442845.1_2 Reverse -36 -50 4.12949 0.267
NP_441551.1_5 Forward -292 -276 18.3473 0.0365
NP_440982.1_1 Reverse -101 -120 3.34192 0.297
NP_441469.1_8 Reverse -278 -287 13.3727 0.073
NP_441469.1_8 Forward -289 -280 13.3727 0.073
NP_443064.1_6 Forward -288 -278 13.8273 0.0796
NP_443064.1_6 Reverse -279 -289 13.8273 0.0796
NP_440257.1_6 Forward -173 -154 24.5813 0.0138
NP_442578.1_5 Forward -336 -317 5.89931 0.238
NP_442578.1_7 Forward -287 -280 14.5921 0.026
NP_442578.1_7 Reverse -280 -287 14.5921 0.026
NP_441462.1_2 Forward -288 -278 20.1379 0.000967
NP_441462.1_2 Reverse -279 -289 20.1379 0.000967
NP_441621.1_7 Reverse -277 -291 4.91614 0.0934
NP_441621.1_7 Forward -290 -276 4.81781 0.0934
NP_441621.1_7 Forward -299 -285 -1.8687 0.188
NP_443062.1_1 Reverse -279 -297 9.03346 0.142
NP_443062.1_6 Reverse -257 -276 6.19431 0.186
NP_442204.1_1 Reverse -275 -286 9.79344 0.0736
NP_442204.1_5 Reverse -269 -288 2.26107 0.214
NP_441560.1_10 Reverse -271 -290 8.84924 0.235
NP_440516.1_8 Forward -288 -279 16.9127 0.00442
NP_440516.1_8 Reverse -279 -288 16.9127 0.00442
NP_440516.1_8 Forward -297 -288 -0.393597 0.255
NP_442846.1_8 Forward -25 -6 21.4356 0.114
NP_442428.1_5 Forward -287 -280 15.8704 0.0124
NP_442428.1_5 Reverse -280 -287 15.8704 0.0124
NP_442428.1_5 Reverse -83 -90 3.67736 0.298
NP_441867.1_2 Reverse -204 -223 -14.6519 0.289
NP_440673.1_2 Forward -225 -206 9.51162 0.243
NP_440673.1_3 Forward -286 -279 12.4288 0.0426
NP_440673.1_3 Reverse -281 -288 12.4288 0.0426
NP_440865.1_9 Forward -294 -275 3.04771 0.105
NP_440865.1_9 Reverse -273 -292 -1.27885 0.173
NP_441052.1_2 Forward -288 -278 10.4031 0.0285
NP_441052.1_2 Reverse -279 -289 10.4031 0.0285
NP_442219.1_8 Forward -225 -206 9.32671 0.233
NP_442219.1_9 Forward -287 -278 8.25953 0.0681
NP_442219.1_9 Reverse -280 -289 8.25953 0.0681
NP_440436.1_4 Forward -287 -278 15.9289 0.00508
NP_440436.1_4 Reverse -280 -289 15.9289 0.00508
NP_441884.1_9 Forward -300 -281 -13.6686 0.138
NP_441884.1_9 Forward -291 -272 -23.9933 0.284
NP_441884.1_9 Reverse -276 -295 -25.1733 0.29
NP_440314.1_9 Reverse -280 -299 5.80098 0.0661
NP_441719.1_4 Forward -287 -280 16.3621 0.0124
NP_441719.1_4 Reverse -280 -287 16.3621 0.0124
NP_441733.1_10 Forward -291 -278 15.1623 0.0629
NP_441733.1_10 Reverse -276 -289 5.42749 0.217
NP_441004.1_1 Forward -294 -275 0.294447 0.117
NP_441004.1_2 Forward -207 -188 2.85105 0.212
NP_441004.1_2 Forward -299 -280 1.96607 0.216
NP_441004.1_4 Forward -199 -189 9.22315 0.259
NP_441004.1_5 Forward -390 -376 6.58777 0.298
NP_442366.1_3 Forward -289 -271 -5.88071 0.298
NP_441115.1_4 Forward -289 -271 7.68819 0.278
NP_442206.1_1 Reverse -187 -206 -10.7186 0.219
NP_442206.1_4 Reverse -280 -299 5.70265 0.293
NP_440328.1_4 Reverse -273 -292 7.47261 0.124
NP_443054.1_2 Reverse -277 -291 11.8976 0.075
NP_443054.1_2 Reverse -186 -200 -0.197071 0.288
NP_441851.1_10 Forward -289 -279 17.4829 0.0027
NP_441851.1_10 Reverse -278 -288 17.4829 0.0027
NP_442011.1_1 Reverse -278 -297 9.14423 0.167
NP_441668.1_4 Forward -298 -279 2.94938 0.189
NP_442515.1_1 Reverse -278 -292 16.1259 0.0227
NP_442515.1_1 Forward -289 -275 4.62115 0.107
NP_442515.1_1 Reverse -377 -391 0.0979218 0.203
NP_442709.1_3 Forward -295 -276 9.24257 0.121
NP_442689.1_8 Reverse -151 -168 -7.63097 0.292
NP_441349.1_10 Reverse -269 -288 1.0811 0.0851
NP_441409.1_6 Reverse -273 -292 1.57275 0.0595
NP_441409.1_6 Forward -294 -275 -14.7502 0.266
NP_441394.1_10 Reverse -359 -377 9.45814 0.263
NP_442843.1_1 Forward -281 -262 -10.817 0.281
NP_442450.1_5 Reverse -277 -287 19.1546 0.0103
NP_442450.1_5 Forward -290 -280 10.1081 0.115
NP_440588.1_2 Reverse -270 -289 14.7491 0.0154
NP_440588.1_2 Forward -297 -278 0.491109 0.146
NP_441031.1_6 Forward -310 -291 3.34271 0.194
NP_442006.1_2 Forward -205 -188 -18.939 0.296
NP_442006.1_2 Reverse -309 -326 -19.234 0.299
NP_441003.1_9 Forward -327 -308 3.93269 0.291
NP_441570.1_1 Forward -288 -270 -7.55234 0.0914
NP_441570.1_1 Reverse -82 -100 -17.6804 0.287
NP_441078.1_4 Forward -288 -279 19.6659 0.0007
NP_441078.1_4 Reverse -279 -288 19.6659 0.0007
NP_442729.1_5 Forward -235 -225 7.64985 0.278
NP_442729.1_8 Forward -292 -279 10.2457 0.125
NP_442729.1_8 Reverse -275 -288 8.67241 0.125
NP_441663.1_8 Reverse -273 -292 11.1109 0.0741
NP_441663.1_8 Forward -294 -275 10.7175 0.0741
NP_442443.1_1 Forward -296 -277 0.982764 0.212
NP_442443.1_1 Forward -230 -211 -5.40875 0.282
NP_440526.1_3 Reverse -280 -291 18.446 0.0306
NP_440526.1_3 Forward -287 -276 8.61296 0.118
NP_441432.1_8 Reverse -278 -287 8.35786 0.0755
NP_441432.1_8 Forward -289 -280 8.35786 0.0755
NP_442320.1_8 Reverse -273 -287 5.30946 0.0394
NP_442344.1_7 Reverse -280 -299 -9.44032 0.251
NP_441732.1_2 Reverse -275 -291 2.32015 0.0253
NP_442003.1_4 Reverse -83 -102 12.7825 0.257
NP_440760.1_1 Reverse -279 -298 -11.9969 0.0903
NP_442797.1_7 Reverse -272 -290 6.90232 0.198
NP_442797.1_7 Reverse -34 -52 -1.16082 0.293
NP_441805.1_2 Reverse -268 -287 -4.81876 0.282
NP_441072.1_2 Reverse -310 -329 7.57094 0.256
NP_440713.1_4 Forward -101 -82 5.30933 0.212
NP_442489.1_7 Forward -288 -279 20.1576 0.000695
NP_442489.1_7 Reverse -279 -288 20.1576 0.000695
NP_440565.1_7 Forward -305 -286 -0.688862 0.278
NP_442079.1_7 Reverse -280 -299 5.40766 0.175
NP_440559.1_1 Forward -287 -278 17.306 0.00658
NP_440559.1_1 Reverse -280 -289 17.306 0.00658
NP_441659.2_8 Forward -288 -278 19.3512 0.000966
NP_441659.2_8 Reverse -279 -289 19.3512 0.000966
NP_442913.1_10 Forward -297 -278 -2.55715 0.187
NP_441040.1_3 Forward -311 -292 13.2741 0.204
NP_442008.1_2 Reverse -276 -295 6.19431 0.223
NP_442776.1_2 Reverse -266 -285 12.0942 0.258
NP_441185.1_7 Forward -299 -280 24.8772 0.00187
NP_442346.1_2 Reverse -247 -266 4.32602 0.289
NP_442346.1_5 Forward -289 -279 17.9746 0.00128
NP_442346.1_5 Reverse -278 -288 17.9746 0.00128
NP_440545.1_3 Forward -292 -275 17.5418 0.0108
NP_440545.1_3 Reverse -275 -292 17.3451 0.0111
NP_440025.1_3 Reverse -155 -169 10.6108 0.29
NP_440831.1_3 Forward -297 -278 24.1523 0.00725
NP_441629.1_3 Reverse -223 -242 -2.55791 0.272
NP_440459.1_2 Reverse -277 -294 9.87194 0.215
NP_440459.1_2 Forward -290 -273 9.08529 0.239
NP_441653.1_2 Reverse -280 -299 10.0041 0.137
NP_441653.1_2 Forward -299 -280 7.10507 0.223
NP_442603.1_7 Forward -288 -274 19.0751 0.0119
NP_442603.1_7 Reverse -279 -293 15.7319 0.0414
NP_440449.1_6 Forward -346 -328 6.01878 0.263
NP_440449.1_6 Forward -296 -278 4.94889 0.287
NP_440449.1_6 Forward -52 -34 4.55984 0.296
NP_441833.1_4 Forward -287 -280 15.9687 0.0124
NP_441833.1_4 Reverse -280 -287 15.9687 0.0124
NP_441329.1_6 Forward -77 -58 -2.24448 0.294
NP_442162.1_4 Forward -303 -284 13.7658 0.261
NP_442162.1_9 Forward -287 -280 16.2637 0.0124
NP_442162.1_9 Reverse -280 -287 16.2637 0.0124
NP_440671.1_4 Reverse -273 -287 17.9942 0.0156
NP_440224.1_1 Reverse -268 -287 10.9142 0.0569
NP_440204.1_1 Forward -374 -355 1.17943 0.296
NP_442546.1_2 Reverse -148 -167 9.7334 0.115
NP_442140.1_3 Reverse -280 -290 14.828 0.0433
NP_442140.1_3 Forward -287 -277 5.68323 0.198
NP_441671.1_1 Forward -341 -322 -0.197208 0.273
NP_440875.1_9 Reverse -281 -291 9.24806 0.233
NP_441813.1_5 Reverse -277 -287 16.1063 0.01
NP_441813.1_5 Forward -290 -280 8.92815 0.0347
NP_440590.1_4 Forward -287 -274 -4.20895 0.258
NP_440590.1_4 Reverse -280 -293 -5.29059 0.277
NP_440567.1_1 Reverse -280 -294 15.2409 0.0178
NP_440567.1_1 Forward -287 -273 14.7492 0.0187
NP_442497.1_10 Forward -287 -278 19.8626 0.00532
NP_442497.1_10 Reverse -280 -289 19.8626 0.00532
NP_440821.1_4 Reverse -277 -287 19.8429 0.00399
NP_440821.1_4 Forward -290 -280 19.5479 0.00399
NP_441239.1_9 Forward -290 -278 18.0335 0.0142
NP_441239.1_9 Reverse -277 -289 15.2803 0.0217
NP_441892.1_1 Forward -297 -280 2.39878 0.14
NP_441892.1_1 Reverse -270 -287 -3.50107 0.242
NP_440665.1_1 Forward -312 -293 -12.3902 0.246
NP_442044.1_1 Reverse -274 -293 -14.6519 0.294
NP_441017.1_6 Reverse -338 -352 12.782 0.217
NP_440949.1_7 Reverse -289 -308 13.175 0.209
NP_440354.1_5 Reverse -276 -295 7.57094 0.174
NP_441617.1_6 Reverse -149 -168 5.50599 0.142
NP_440546.1_4 Forward -288 -278 12.8578 0.0572
NP_440546.1_4 Reverse -279 -289 12.8578 0.0572
NP_441230.1_5 Forward -293 -274 -0.885524 0.292
NP_441656.1_6 Forward -357 -338 6.98095 0.252
NP_440462.1_6 Forward -290 -280 10.4031 0.0396
NP_440462.1_6 Reverse -277 -287 7.84651 0.0699
NP_440462.1_6 Reverse -312 -322 3.32329 0.25
NP_440868.1_4 Forward -292 -280 9.77374 0.043
NP_440868.1_4 Reverse -275 -287 -0.551008 0.274
NP_440868.1_8 Forward -292 -273 2.94938 0.139
NP_440696.1_3 Forward -292 -274 3.75572 0.206
NP_442039.1_4 Forward -287 -280 15.1821 0.0124
NP_442039.1_4 Reverse -280 -287 15.1821 0.0124
NP_442039.1_7 Forward -19 -9 12.9597 0.213
NP_441811.1_1 Reverse -264 -283 5.01433 0.28
NP_441811.1_4 Reverse -220 -239 7.37428 0.168
NP_442829.1_2 Forward -165 -149 11.6199 0.287
NP_442837.1_3 Forward -287 -280 15.7721 0.0124
NP_442837.1_3 Reverse -280 -287 15.7721 0.0124
NP_442837.1_3 Forward -322 -315 6.52896 0.2
NP_442837.1_3 Forward -105 -98 6.43063 0.212
NP_442053.1_1 Forward -288 -279 18.3876 0.0007
NP_442053.1_1 Reverse -279 -288 18.3876 0.0007
NP_442053.1_1 Forward -299 -290 4.42462 0.249
NP_442053.1_1 Reverse -288 -297 3.7363 0.29
NP_440505.1_3 Forward -290 -280 7.84651 0.147
NP_440505.1_3 Reverse -277 -287 7.55152 0.151
NP_441252.1_6 Reverse -40 -47 14.3954 0.168
NP_441203.1_1 Forward -287 -268 0.0977854 0.0636
NP_441203.1_1 Reverse -280 -299 -12.4886 0.143
NP_440914.1_1 Forward -288 -278 8.51751 0.186
NP_440914.1_1 Reverse -279 -289 8.51751 0.186
NP_440914.1_1 Reverse -234 -244 6.27291 0.288
NP_441011.1_8 Forward -287 -278 14.356 0.0249
NP_441011.1_8 Reverse -280 -289 14.356 0.0249
NP_442101.1_10 Reverse -271 -290 12.7825 0.0306
NP_442533.1_6 Forward -288 -279 17.2076 0.00137
NP_442533.1_6 Reverse -279 -288 17.2076 0.00137
NP_442533.1_6 Forward -45 -36 3.63797 0.206
NP_442232.1_3 Forward -296 -277 -13.1769 0.282
NP_441482.1_7 Reverse -273 -287 10.0294 0.0135
NP_441482.1_7 Forward -294 -280 -8.75187 0.193
NP_439944.1_9 Reverse -280 -290 17.4829 0.00423
NP_439944.1_9 Forward -287 -277 17.3846 0.00516
NP_441028.1_6 Forward -400 -390 5.19112 0.265
NP_440116.1_8 Reverse -280 -299 -2.26216 0.128
NP_441527.1_7 Forward -268 -249 9.93006 0.282
NP_440115.1_6 Forward -291 -281 19.2529 0.0106
NP_440115.1_6 Reverse -276 -286 9.7148 0.115
NP_440007.1_9 Reverse -275 -289 4.32615 0.267
NP_439965.1_7 Forward -313 -294 10.6116 0.294
NP_441961.1_3 Reverse -99 -118 20.354 0.0977
NP_442562.1_10 Forward -293 -274 16.8141 0.104
NP_441972.1_5 Reverse -280 -299 -2.0655 0.178
NP_441972.1_5 Reverse -242 -261 -9.73531 0.293
NP_441106.1_1 Forward -289 -280 9.73449 0.0311
NP_441106.1_1 Reverse -278 -287 9.73449 0.0311
NP_441286.1_1 Reverse -278 -290 14.7886 0.00418
NP_441286.1_1 Forward -289 -277 14.4936 0.00418
NP_442674.1_2 Forward -217 -198 11.0125 0.208
NP_442674.1_3 Forward -296 -277 7.4718 0.219
NP_440670.1_8 Forward -288 -279 18.3876 0.000699
NP_440670.1_8 Reverse -279 -288 18.3876 0.000699
NP_440670.1_8 Forward -312 -303 3.14632 0.296
NP_441930.1_1 Reverse -275 -294 14.5524 0.179
NP_440886.1_7 Forward -289 -279 8.04271 0.0805
NP_440886.1_7 Reverse -278 -288 8.04271 0.0805
NP_440886.1_7 Reverse -287 -297 6.96107 0.112
NP_442614.1_2 Reverse -279 -293 18.6825 0.0465
NP_442614.1_2 Forward -288 -274 10.226 0.234
NP_442614.1_2 Reverse -328 -342 6.09611 0.293
NP_442072.1_9 Reverse -278 -296 -10.5023 0.0789
NP_442072.1_9 Forward -289 -271 -21.3187 0.207
NP_440513.1_4 Reverse -279 -298 13.5691 0.19
NP_442022.1_4 Forward -389 -370 7.57094 0.268
NP_440907.2_8 Reverse -280 -290 19.449 0.00351
NP_440907.2_8 Forward -287 -277 9.81266 0.103
NP_442264.1_2 Forward -244 -227 11.2486 0.185
NP_442264.1_2 Forward -292 -275 10.1669 0.188
NP_442264.1_2 Forward -361 -344 9.18362 0.199
NP_441463.1_3 Forward -397 -378 -5.01543 0.22
NP_441463.1_6 Reverse -277 -291 10.4745 0.242
NP_441626.1_2 Forward -287 -280 15.7721 0.0124
NP_441626.1_2 Reverse -280 -287 15.7721 0.0124
NP_442794.1_1 Reverse -275 -287 10.2654 0.0721
NP_442615.1_1 Forward -297 -279 14.2771 0.0102
NP_442615.1_1 Reverse -270 -288 -4.79907 0.194
NP_441962.1_4 Reverse -274 -293 -11.1119 0.238
NP_440387.1_1 Forward -288 -272 -1.41643 0.142
NP_440387.1_1 Reverse -279 -295 -2.39974 0.147
NP_440855.1_3 Forward -269 -250 11.5033 0.185
NP_441431.1_2 Forward -291 -277 10.0287 0.17
NP_441431.1_2 Reverse -276 -290 6.98048 0.255
NP_441488.1_8 Forward -317 -303 8.94708 0.17
NP_441836.1_2 Reverse -170 -189 -6.1954 0.292
NP_441993.1_1 Forward -288 -269 5.45515 0.201
NP_441993.1_1 Forward -242 -223 2.72635 0.254
NP_441993.1_1 Reverse -273 -292 1.06957 0.285
NP_440814.1_4 Forward -297 -278 -12.5869 0.236
NP_440114.1_10 Reverse -279 -293 7.66941 0.229
NP_442437.1_8 Forward -299 -280 13.7658 0.133
NP_442437.1_8 Forward -233 -214 3.6377 0.288
NP_442323.1_7 Forward -317 -298 10.6184 0.147
NP_442323.1_7 Reverse -274 -293 8.65176 0.163
NP_440293.1_3 Forward -118 -99 -4.52377 0.264
NP_440766.1_4 Reverse -275 -289 15.2409 0.0269
NP_440766.1_4 Forward -292 -278 5.30946 0.112
NP_441237.1_9 Reverse -280 -290 17.2863 0.00348
NP_439910.1_2 Reverse -198 -215 -22.5773 0.267
NP_440457.1_1 Reverse -275 -287 18.1319 0.0403
NP_440457.1_1 Forward -292 -280 9.38042 0.0927
NP_440798.1_6 Reverse -280 -293 10.5407 0.074
NP_440798.1_6 Forward -287 -274 3.26421 0.151
NP_440801.1_8 Reverse -205 -224 6.68596 0.166
NP_440801.1_10 Reverse -275 -294 6.98095 0.279
NP_441889.1_4 Reverse -270 -289 8.45592 0.11
NP_441436.1_8 Forward -289 -270 15.4374 0.215
NP_442509.1_9 Forward -288 -278 17.3841 0.00128
NP_442509.1_9 Reverse -279 -289 17.3841 0.00128
NP_442509.1_9 Reverse -328 -338 8.43603 0.192
NP_441489.1_4 Forward -111 -97 13.4709 0.222
NP_440554.1_4 Forward -287 -277 6.96153 0.107
NP_440554.1_4 Reverse -280 -290 6.27322 0.123
NP_441885.1_5 Forward -288 -278 11.3864 0.00668
NP_441885.1_5 Reverse -279 -289 11.3864 0.00668
NP_440478.1_4 Forward -292 -273 14.7491 0.163
NP_440478.1_4 Reverse -275 -294 14.5524 0.168
NP_442341.1_7 Forward -289 -275 12.586 0.0436
NP_442341.1_7 Reverse -278 -292 11.111 0.0574
NP_441756.1_5 Reverse -275 -294 0.196116 0.24
NP_441173.1_9 Reverse -9 -17 13.1954 0.184
NP_442395.2_4 Forward -289 -270 6.88182 0.142
NP_443000.1_7 Reverse -277 -287 8.82982 0.0437
NP_443000.1_7 Forward -93 -83 5.48657 0.131
NP_443000.1_7 Forward -362 -352 2.14332 0.226
NP_443000.1_7 Forward -290 -280 2.14332 0.226
NP_440507.2_3 Reverse -270 -289 9.7334 0.216
NP_441842.1_10 Reverse -272 -286 6.19444 0.297
NP_440275.1_3 Forward -290 -280 19.5479 0.00756
NP_440275.1_3 Reverse -277 -287 10.0098 0.0454
NP_440679.1_10 Forward -393 -374 -13.5702 0.222
NP_442451.1_2 Forward -296 -277 -9.63698 0.259
NP_440175.1_4 Forward -389 -370 -11.0136 0.185
NP_442591.1_1 Reverse -241 -260 9.53756 0.224
NP_440149.1_8 Forward -221 -202 -1.67217 0.162
NP_441105.1_3 Reverse -268 -287 -2.26216 0.159
NP_440216.1_1 Forward -288 -274 7.57108 0.00935
NP_440216.1_1 Reverse -279 -293 7.57108 0.00935
NP_440172.1_1 Forward -288 -278 16.303 0.00854
NP_440172.1_1 Reverse -279 -289 16.303 0.00854
NP_442015.1_10 Reverse -275 -288 19.7838 0.00366
NP_442015.1_10 Forward -292 -279 3.26421 0.184
NP_441045.1_1 Forward -167 -148 19.5673 0.121
NP_441226.1_7 Forward -287 -280 14.4934 0.0123
NP_441226.1_7 Reverse -280 -287 14.4934 0.0123
NP_441226.1_7 Reverse -13 -20 6.52862 0.253
NP_441111.1_7 Forward -287 -279 18.7023 0.00294
NP_441111.1_7 Reverse -280 -288 18.7023 0.00294
NP_442379.1_10 Forward -295 -278 3.18543 0.19
NP_441766.1_2 Forward -288 -279 17.5026 0.00297
NP_441766.1_2 Reverse -279 -288 17.5026 0.00297
NP_441766.1_9 Forward -296 -277 4.22769 0.205
NP_442417.1_5 Forward -288 -274 9.93102 0.124
NP_440416.1_9 Reverse -272 -291 -6.39206 0.0899
NP_440416.1_9 Forward -295 -276 -14.7502 0.18
NP_440416.1_9 Reverse -284 -303 -18.5851 0.26
NP_440416.1_9 Forward -307 -288 -19.7651 0.278
NP_442116.1_6 Reverse -149 -166 7.88248 0.254
NP_442403.1_9 Forward -300 -281 9.43923 0.186
NP_442154.1_1 Forward -233 -215 -7.749 0.148
NP_442154.1_1 Forward -299 -281 -15.7138 0.224
NP_442154.1_1 Forward -242 -224 -17.1888 0.249
NP_440261.1_5 Reverse -280 -293 27.552 0.00402
NP_440261.1_5 Forward -287 -274 8.67241 0.0244
NP_440261.1_5 Forward -90 -77 -4.9956 0.183
NP_440988.1_10 Reverse -346 -360 7.41596 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTTTCCTCGATGGTGTTAATGCCGGTGCGTGGGGTTTAATGGTGGTCACTACCATTGGTTTAGCCCGTTCCGCCCTCATTGATCCCTTGACCATCTGCTTAGCGGTGCTCGGGGCGATCGCCCTGGGACGATTTTCCATCAGTTCCCATTGGTTAGTGGTCTTTGGTGCCCTGGTGGGCCTAGTTGGCCAAAGCTGGTCAATGGGTTAATGGCCTAGCCATGAATTTAACCGAGAAAATAATGCAAAAACTTAAGCCCCTGACGGCCTAAATATGTAGTTTTATTGCAGGGGTAAGGGCTCCCTTGACTTGCGTTCACTCGGAAATAATGATAGGTAGGAGAACTAAAATGGCTTGCCCAAGCCCCTTAACTATAAACTGCCGTTGGGAGAACCTTTTAA

CDS

ATGCGAGACGCGGTTACCACTTTAATAAAAAACTATGATTTGACCGGTCGCTATCTAGACCGGAACGCCATGGACGAGCTCAAAGCTTATTTTGAGTCCGGTTCGGCTAGGATTGCCGCCGCCGCCATGATTAACGCCAATTCGGCCACCATCGTCAAACGGGCCGCTGCCCAACTGTTTGAAGAAATTCCTGAGCTAATCCGCCCCAGTGGTAATGCCTACACTACCCGTCGTTTTTCCGCTTGTTTGCGGGATATGGACTATTATCTGCGCTATGCCAGCTATGCCCTGATTGCCGCAGACAACAACGTGCTCGATGAGCGGGTTCTGCAGGGACTACGGGAAACCTACAATTCCCTGGGCGTACCCATTGGGCCCACGGTGCGGGGCATTCAGATCATGAAGGAAATGATTGAAGCCATGGCAGAGGATTCCAGCCTGAACAGCACAGATTTTATTGCTTCCCCCTTTGACCATATGACCAGGGAACTGAGCGAACTTTCTGTCTAG

Protein

MRDAVTTLIKNYDLTGRYLDRNAMDELKAYFESGSARIAAAAMINANSATIVKRAAAQLFEEIPELIRPSGNAYTTRRFSACLRDMDYYLRYASYALIAADNNVLDERVLQGLRETYNSLGVPIGPTVRGIQIMKEMIEAMAEDSSLNSTDFIASPFDHMTRELSELSV