Your browser is old and dusty. Try Google Chrome!

Details for slr1457

ORF slr1457
Accession NP_442845.1
Symbol
Category chromate transport protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -329 -315 2.2612 0.178
NP_441418.1_6 Reverse -321 -340 -19.3717 0.0876
NP_442291.1_5 Reverse -320 -336 -1.21977 0.192
NP_440295.1_2 Forward -104 -85 5.40766 0.289
NP_440897.1_6 Forward -51 -32 -1.18128 0.187
NP_441453.1_4 Reverse -321 -329 6.70593 0.121
NP_442151.1_6 Forward -124 -110 11.0127 0.109
NP_442151.1_6 Forward -51 -37 6.09611 0.248
NP_441818.1_1 Reverse -322 -333 8.80962 0.277
NP_441818.1_9 Reverse -187 -206 -1.7705 0.2
NP_440226.1_1 Reverse -321 -340 2.75272 0.253
NP_441465.1_8 Forward -287 -269 6.41066 0.269
NP_442173.1_1 Forward -329 -321 5.82095 0.2
NP_442752.1_4 Reverse -321 -328 13.8055 0.0199
NP_442752.1_4 Reverse -245 -252 7.90559 0.144
NP_442752.1_4 Reverse -199 -206 5.54565 0.194
NP_443027.1_4 Reverse -319 -329 9.32148 0.166
NP_442975.1_10 Reverse -95 -109 2.8506 0.269
NP_442975.1_10 Forward -334 -320 2.45727 0.274
NP_440784.1_7 Forward -123 -116 8.59391 0.129
NP_440784.1_7 Forward -329 -322 6.23397 0.241
NP_440784.1_7 Reverse -322 -329 6.13563 0.241
NP_440061.1_9 Reverse -146 -160 10.1271 0.128
NP_440061.1_9 Forward -332 -318 7.86545 0.189
NP_440061.1_9 Forward -272 -258 7.3738 0.209
NP_442062.1_8 Reverse -321 -331 7.15819 0.107
NP_440304.1_4 Reverse -40 -50 7.84651 0.099
NP_442242.1_4 Reverse -322 -329 12.4288 0.0393
NP_442242.1_4 Reverse -214 -221 9.57722 0.227
NP_442242.1_4 Forward -50 -43 9.47889 0.251
NP_440044.1_8 Forward -329 -310 5.70265 0.0991
NP_441781.1_7 Reverse -321 -340 -0.197208 0.256
NP_441620.1_5 Reverse -275 -294 20.4523 0.0604
NP_441208.1_9 Forward -101 -87 6.78443 0.229
NP_442375.1_5 Reverse -86 -100 14.2569 0.289
NP_442110.1_7 Forward -51 -37 2.75286 0.222
NP_442110.1_7 Reverse -321 -335 0.589577 0.256
NP_441491.1_6 Forward -261 -247 16.9279 0.204
NP_441083.1_5 Forward -330 -320 1.74999 0.198
NP_441083.1_5 Reverse -321 -331 0.963343 0.218
NP_441738.1_2 Forward -328 -321 15.28 0.0102
NP_440209.1_1 Reverse -321 -329 14.8674 0.012
NP_442889.1_8 Forward -127 -113 6.0955 0.203
NP_442570.1_3 Reverse -227 -246 -7.17871 0.268
NP_440538.1_10 Reverse -87 -106 15.0441 0.187
NP_441716.1_1 Reverse -321 -335 11.0127 0.0936
NP_442111.1_4 Forward -52 -38 5.40779 0.166
NP_442111.1_4 Forward -331 -317 4.52282 0.203
NP_440906.1_5 Forward -329 -322 12.0355 0.0724
NP_440906.1_5 Reverse -322 -329 12.0355 0.0724
NP_440906.1_5 Reverse -214 -221 9.47889 0.116
NP_440747.1_10 Reverse -318 -330 -2.32097 0.0331
NP_440747.1_10 Forward -333 -321 -12.0557 0.199
NP_441130.1_10 Reverse -319 -333 7.27608 0.164
NP_442973.1_5 Reverse -33 -52 11.1109 0.258
NP_441486.1_1 Forward -333 -319 2.06454 0.0918
NP_440403.1_4 Reverse -250 -269 0.687771 0.14
NP_440403.1_4 Reverse -312 -331 -8.26035 0.251
NP_441014.1_8 Forward -261 -242 -9.53865 0.296
NP_442848.1_1 Reverse -315 -329 6.98109 0.0791
NP_442848.1_1 Forward -336 -322 4.91614 0.0926
NP_441012.1_4 Forward -328 -315 6.1158 0.286
NP_443018.1_3 Forward -329 -322 5.34899 0.212
NP_443018.1_3 Reverse -322 -329 5.34899 0.212
NP_440376.1_1 Reverse -321 -330 -0.000272808 0.285
NP_440376.1_1 Forward -330 -321 -0.0986038 0.285
NP_442687.1_7 Reverse -41 -51 7.15819 0.138
NP_441797.1_7 Forward -73 -55 14.2771 0.21
NP_441846.1_10 Forward -286 -267 -22.125 0.257
NP_440642.1_10 Forward -19 -5 1.27731 0.296
NP_441013.1_2 Reverse -104 -122 -4.30741 0.298
NP_442198.1_3 Reverse -201 -220 5.211 0.259
NP_442782.1_2 Reverse -250 -264 1.86788 0.281
NP_442205.1_9 Forward -276 -260 -3.48138 0.283
NP_442544.1_2 Forward -293 -279 -1.77037 0.287
NP_442544.1_6 Reverse -102 -121 -5.70374 0.298
NP_440184.1_5 Reverse -311 -330 6.88262 0.224
NP_439959.1_3 Forward -267 -248 11.4058 0.229
NP_442937.1_5 Reverse -316 -335 14.1591 0.0814
NP_441958.1_5 Reverse -41 -51 0.373358 0.154
NP_441958.1_5 Reverse -320 -330 -6.41148 0.28
NP_440203.1_5 Forward -327 -317 13.5492 0.114
NP_442816.1_5 Reverse -245 -264 11.0125 0.2
NP_440984.1_7 Reverse -98 -112 4.52282 0.299
NP_441097.1_2 Reverse -184 -201 3.57876 0.293
NP_439990.1_5 Reverse -316 -329 11.0324 0.128
NP_442690.1_1 Forward -36 -17 -11.3086 0.228
NP_442690.1_1 Forward -47 -28 -12.4886 0.243
NP_442911.1_2 Forward -340 -321 4.71934 0.0369
NP_442210.1_9 Forward -55 -37 16.5388 0.183
NP_441913.1_1 Reverse -54 -70 16.1433 0.246
NP_441099.1_5 Forward -340 -321 -5.80207 0.154
NP_442002.1_1 Reverse -184 -202 -5.88071 0.249
NP_441294.1_7 Forward -334 -320 10.9784 0.161
NP_441646.1_1 Reverse -254 -273 -0.787193 0.272
NP_441646.1_1 Reverse -314 -333 -1.27885 0.281
NP_442438.1_10 Reverse -316 -330 0.491246 0.225
NP_440484.1_3 Reverse -319 -333 9.34103 0.268
NP_441550.1_8 Reverse -319 -329 7.45273 0.159
NP_441550.1_8 Forward -126 -116 6.17443 0.214
NP_441916.1_10 Reverse -313 -332 0.491109 0.281
NP_441041.1_4 Reverse -321 -340 -3.04881 0.119
NP_441041.1_7 Reverse -57 -69 8.00067 0.151
NP_441725.1_5 Reverse -322 -332 0.176696 0.206
NP_441725.1_5 Forward -50 -40 -0.118297 0.232
NP_441725.1_5 Forward -329 -319 -0.708283 0.267
NP_439966.1_7 Reverse -319 -329 4.99446 0.248
NP_439966.1_7 Forward -332 -322 4.30615 0.279
NP_439966.1_9 Reverse -319 -328 0.884706 0.253
NP_442941.1_3 Forward -50 -40 7.55152 0.0711
NP_442941.1_3 Forward -329 -319 1.25834 0.15
NP_442941.1_3 Reverse -322 -332 0.668351 0.19
NP_440260.1_8 Reverse -106 -124 -4.01242 0.263
NP_442281.1_1 Reverse -316 -330 4.03056 0.21
NP_440437.1_1 Reverse -90 -109 -4.13045 0.251
NP_441556.1_4 Forward -121 -102 10.3907 0.284
NP_440375.1_8 Reverse -43 -62 1.57275 0.247
NP_441644.1_6 Reverse -321 -331 10.5993 0.0628
NP_441644.1_6 Forward -51 -41 9.51767 0.0747
NP_442215.1_2 Forward -71 -55 -4.46469 0.233
NP_442215.1_2 Forward -53 -37 -6.13632 0.264
NP_442215.1_2 Reverse -274 -290 -7.11963 0.286
NP_440929.1_8 Forward -330 -321 7.86621 0.0522
NP_440929.1_8 Reverse -321 -330 7.57121 0.0706
NP_442933.1_10 Reverse -321 -330 5.40793 0.19
NP_442933.1_10 Reverse -42 -51 4.22796 0.267
NP_441751.2_8 Forward -329 -315 -2.95034 0.134
NP_442554.1_8 Forward -329 -319 8.33817 0.0754
NP_442554.1_8 Reverse -322 -332 3.02829 0.245
NP_442292.1_1 Forward -329 -320 8.75118 0.0306
NP_442292.1_1 Reverse -322 -331 8.06287 0.0554
NP_442292.1_1 Forward -123 -114 5.21127 0.152
NP_441264.1_9 Forward -129 -115 14.8476 0.12
NP_443009.1_5 Reverse -260 -271 10.4812 0.0792
NP_443009.1_5 Reverse -41 -52 4.48308 0.244
NP_441715.1_4 Forward -50 -40 11.6814 0.0778
NP_441198.1_8 Reverse -259 -269 14.7362 0.0644
NP_441198.1_8 Forward -272 -262 10.5368 0.265
NP_441468.1_1 Forward -329 -322 6.13563 0.209
NP_441468.1_1 Reverse -322 -329 6.0373 0.223
NP_441468.1_1 Reverse -116 -123 4.26735 0.246
NP_441673.1_1 Forward -330 -321 1.27803 0.155
NP_441673.1_1 Reverse -321 -330 1.27803 0.155
NP_441826.1_2 Reverse -315 -329 10.521 0.0471
NP_441764.1_6 Reverse -338 -349 16.4799 0.284
NP_441764.1_8 Reverse -74 -84 14.0861 0.284
NP_442868.1_6 Reverse -319 -329 7.64985 0.0726
NP_442719.1_2 Forward -76 -58 -11.7812 0.296
NP_441056.1_1 Forward -124 -105 -7.37537 0.272
NP_441056.1_1 Forward -336 -317 -8.45701 0.282
NP_440145.1_3 Reverse -311 -330 23.0089 0.00632
NP_442718.1_2 Forward -285 -266 -4.81876 0.292
NP_442050.1_5 Forward -332 -322 6.56775 0.294
NP_440558.1_2 Reverse -312 -331 -3.73712 0.238
NP_440558.1_2 Forward -339 -320 -6.78538 0.28
NP_441878.1_6 Reverse -350 -360 0.0783647 0.152
NP_441036.1_8 Forward -331 -321 5.78156 0.258
NP_442650.1_2 Reverse -321 -335 4.52282 0.169
NP_441557.1_5 Forward -330 -321 7.66954 0.0443
NP_441557.1_5 Reverse -321 -330 0.983037 0.0911
NP_441557.1_5 Reverse -42 -51 -0.885252 0.26
NP_442183.1_1 Reverse -321 -335 7.17775 0.147
NP_442347.1_2 Forward -347 -338 7.96454 0.122
NP_442347.1_2 Forward -329 -320 3.93297 0.284
NP_442347.1_2 Forward -207 -198 2.94966 0.292
NP_442888.1_6 Reverse -92 -111 8.65258 0.195
NP_441037.1_4 Reverse -319 -329 8.48718 0.237
NP_441633.1_3 Forward -332 -319 -4.20895 0.185
NP_440136.1_2 Forward -329 -322 6.23397 0.171
NP_440136.1_2 Reverse -322 -329 6.13563 0.193
NP_442998.1_5 Forward -39 -29 8.63316 0.261
NP_442998.1_10 Forward -328 -321 15.5754 0.0102
NP_440299.1_1 Forward -334 -321 15.6533 0.0151
NP_440299.1_1 Reverse -317 -330 9.45847 0.0709
NP_441799.1_1 Forward -55 -41 4.71887 0.238
NP_441007.1_10 Reverse -316 -329 6.31247 0.167
NP_442334.1_2 Reverse -311 -328 -4.77938 0.2
NP_440256.1_1 Forward -54 -35 -7.76869 0.245
NP_441559.1_8 Forward -325 -311 -4.91696 0.241
NP_441559.1_8 Forward -249 -235 -5.11362 0.248
NP_441559.1_8 Forward -315 -301 -6.68692 0.279
NP_440915.1_6 Reverse -257 -271 -3.54032 0.298
NP_440134.1_2 Reverse -57 -76 0.58944 0.298
NP_440749.1_1 Reverse -148 -167 12.0942 0.0685
NP_440748.1_5 Forward -199 -180 0.786102 0.242
NP_442386.1_5 Reverse -92 -111 5.60352 0.255
NP_441340.1_5 Reverse -322 -329 6.13563 0.175
NP_441340.1_5 Forward -329 -322 5.93897 0.198
NP_440586.1_8 Reverse -322 -329 11.4451 0.0645
NP_440586.1_8 Forward -123 -116 9.28187 0.164
NP_442251.1_6 Forward -329 -322 12.0355 0.0627
NP_442251.1_6 Forward -221 -214 10.4622 0.12
NP_442251.1_6 Forward -50 -43 10.3639 0.134
NP_442251.1_6 Forward -335 -328 7.11894 0.274
NP_440684.1_9 Reverse -193 -207 6.6861 0.294
NP_441262.1_3 Reverse -321 -328 14.7888 0.0223
NP_441262.1_3 Forward -330 -323 5.15232 0.265
NP_440027.1_3 Forward -208 -190 3.16499 0.278
NP_440027.1_3 Reverse -89 -107 2.47668 0.289
NP_443051.1_1 Reverse -320 -329 0.786375 0.125
NP_443051.1_1 Reverse -41 -50 -0.000272808 0.245
NP_442239.1_8 Reverse -189 -208 10.3242 0.245
NP_440372.1_2 Reverse -322 -329 6.72562 0.0929
NP_440372.1_2 Forward -329 -322 6.62729 0.151
NP_442488.1_4 Reverse -301 -320 11.7008 0.236
NP_439977.1_5 Reverse -315 -334 -1.37718 0.25
NP_440144.1_1 Reverse -67 -86 17.5024 0.203
NP_441572.1_7 Forward -264 -245 -2.95047 0.205
NP_441572.1_7 Reverse -250 -269 -4.6221 0.24
NP_442384.1_10 Forward -51 -38 2.87088 0.21
NP_442384.1_10 Forward -208 -195 0.805932 0.278
NP_441018.1_7 Reverse -105 -124 7.66927 0.268
NP_441018.1_7 Reverse -317 -336 6.78429 0.282
NP_442790.1_4 Forward -201 -182 -6.78538 0.146
NP_441689.1_5 Reverse -40 -50 5.68278 0.215
NP_441689.1_5 Forward -272 -262 5.58445 0.23
NP_440282.1_10 Forward -280 -261 -9.93197 0.29
NP_440562.1_3 Forward -329 -312 4.95539 0.18
NP_441965.1_3 Forward -340 -321 14.9458 0.076
NP_441965.1_10 Reverse -258 -274 2.02515 0.292
NP_441640.1_8 Reverse -322 -341 -3.24547 0.253
NP_440297.1_9 Reverse -322 -332 -0.216628 0.282
NP_440297.1_9 Reverse -116 -126 -0.216628 0.282
NP_442280.1_10 Reverse -105 -123 10.4218 0.223
NP_440888.1_2 Forward -51 -37 5.99717 0.254
NP_440803.1_3 Reverse -258 -277 5.70265 0.23
NP_442892.1_9 Forward -19 -5 15.4369 0.285
NP_442948.1_2 Reverse -320 -339 4.916 0.257
NP_442033.1_10 Forward -323 -304 -11.2103 0.251
NP_440575.1_8 Forward -301 -282 -7.57203 0.298
NP_442818.1_1 Forward -208 -189 -1.77127 0.273
NP_441543.1_2 Forward -329 -320 7.17789 0.131
NP_442845.1_2 Forward -276 -262 13.8643 0.0893
NP_442845.1_8 Forward -231 -212 17.7974 0.228
NP_440982.1_1 Forward -263 -244 4.52188 0.294
NP_441469.1_8 Forward -125 -116 9.24284 0.227
NP_443064.1_6 Forward -51 -41 8.30077 0.3
NP_442337.1_8 Forward -80 -61 -0.688862 0.278
NP_442578.1_7 Reverse -322 -329 5.93897 0.183
NP_443062.1_1 Reverse -213 -231 6.40076 0.202
NP_442204.1_1 Reverse -317 -328 2.41861 0.266
NP_442204.1_1 Reverse -183 -194 1.14031 0.28
NP_440516.1_8 Reverse -321 -330 8.25953 0.0391
NP_442428.1_5 Reverse -116 -123 11.4455 0.062
NP_442428.1_5 Forward -329 -322 6.13563 0.209
NP_442428.1_5 Reverse -322 -329 6.0373 0.212
NP_441867.1_2 Forward -115 -96 -20.7484 0.297
NP_440673.1_3 Forward -328 -321 12.4288 0.0426
NP_441052.1_2 Forward -330 -320 1.65166 0.233
NP_441052.1_2 Reverse -321 -331 0.57002 0.256
NP_442219.1_8 Reverse -311 -330 6.42771 0.298
NP_442219.1_9 Forward -329 -320 8.06287 0.0696
NP_442219.1_9 Reverse -43 -52 5.50626 0.153
NP_440436.1_4 Forward -329 -320 13.9623 0.0193
NP_440436.1_4 Reverse -322 -331 4.81753 0.239
NP_440314.1_9 Forward -329 -310 7.17762 0.0497
NP_440648.1_6 Reverse -18 -37 10.6184 0.174
NP_441719.1_4 Reverse -322 -329 6.72562 0.093
NP_441719.1_4 Forward -329 -322 6.62729 0.151
NP_441719.1_6 Forward -72 -53 5.2102 0.293
NP_441004.1_1 Forward -189 -170 -16.6185 0.286
NP_441004.1_2 Forward -261 -242 -1.27885 0.259
NP_442206.1_10 Reverse -321 -336 2.92983 0.196
NP_440094.1_6 Reverse -202 -221 9.93088 0.213
NP_441851.1_10 Reverse -320 -330 5.87989 0.196
NP_441851.1_10 Reverse -260 -270 5.68323 0.203
NP_441851.1_10 Forward -331 -321 4.50326 0.266
NP_440682.1_2 Forward -374 -355 -16.9135 0.299
NP_441668.1_5 Reverse -66 -85 10.5209 0.225
NP_442515.1_1 Reverse -320 -334 -2.55701 0.277
NP_440593.1_3 Forward -335 -316 -6.29373 0.272
NP_441409.1_6 Forward -336 -317 -1.7705 0.0781
NP_441409.1_6 Reverse -207 -226 -13.3736 0.236
NP_440431.1_4 Reverse -286 -305 -9.59736 0.287
NP_442168.1_5 Forward -269 -250 5.11266 0.202
NP_442168.1_5 Forward -128 -109 -0.0988766 0.261
NP_440483.1_1 Forward -119 -100 2.45773 0.18
NP_441570.1_1 Reverse -321 -339 -7.94566 0.0989
NP_441570.1_1 Forward -124 -106 -9.91228 0.153
NP_441570.1_1 Reverse -42 -60 -15.9105 0.236
NP_441078.1_4 Reverse -321 -330 0.0980582 0.205
NP_441078.1_4 Forward -330 -321 0.0980582 0.205
NP_442443.1_1 Forward -266 -247 -5.60541 0.282
NP_442443.1_2 Forward -262 -243 13.9625 0.179
NP_440526.1_3 Forward -329 -318 14.9061 0.0646
NP_441432.1_8 Reverse -41 -50 7.96454 0.0953
NP_441432.1_8 Reverse -320 -329 7.17789 0.102
NP_441432.1_8 Forward -286 -277 2.55633 0.298
NP_441432.1_8 Reverse -66 -75 2.55633 0.298
NP_442320.1_8 Reverse -315 -329 -5.11362 0.206
NP_442320.1_8 Forward -336 -322 -5.60527 0.236
NP_441732.1_2 Forward -334 -318 -7.80794 0.0935
NP_441732.1_2 Reverse -38 -54 -15.9694 0.164
NP_441732.1_2 Reverse -317 -333 -16.3627 0.165
NP_442003.1_9 Forward -50 -31 6.68596 0.235
NP_440199.1_10 Reverse -86 -96 7.05986 0.242
NP_441945.1_10 Reverse -102 -121 8.25926 0.273
NP_442489.1_7 Forward -330 -321 0.786375 0.152
NP_442489.1_7 Reverse -321 -330 0.589713 0.17
NP_442489.1_7 Forward -51 -42 -1.86856 0.259
NP_440559.1_1 Forward -329 -320 14.1594 0.0317
NP_440559.1_1 Reverse -322 -331 7.07956 0.112
NP_440559.1_1 Reverse -43 -52 4.42462 0.277
NP_441659.2_8 Reverse -321 -331 11.4848 0.0172
NP_442913.1_10 Forward -107 -88 1.57275 0.141
NP_442849.1_1 Reverse -65 -79 8.94771 0.264
NP_442008.1_2 Forward -266 -247 3.93269 0.245
NP_440708.1_6 Forward -122 -103 -7.96535 0.255
NP_442346.1_5 Reverse -320 -330 14.0414 0.0173
NP_442346.1_5 Reverse -41 -51 8.63316 0.131
NP_442346.1_5 Forward -325 -315 5.19158 0.256
NP_440545.1_3 Reverse -317 -334 5.05372 0.0646
NP_440545.1_3 Reverse -111 -128 -3.40274 0.203
NP_440545.1_3 Reverse -243 -260 -3.5994 0.208
NP_440545.1_3 Forward -334 -317 -3.99273 0.215
NP_440545.1_3 Forward -226 -209 -6.25434 0.273
NP_441653.1_2 Forward -203 -184 7.4916 0.215
NP_440010.1_4 Forward -340 -321 -2.55791 0.284
NP_440010.1_10 Reverse -309 -328 11.9958 0.192
NP_441888.1_7 Reverse -104 -118 1.76955 0.239
NP_441833.1_4 Forward -329 -322 14.1004 0.0258
NP_441833.1_4 Reverse -322 -329 6.13563 0.198
NP_441895.1_2 Reverse -244 -263 -26.7466 0.247
NP_442162.1_9 Forward -329 -322 6.62729 0.142
NP_442162.1_9 Reverse -322 -329 6.52896 0.178
NP_442140.1_3 Forward -329 -319 4.10993 0.261
NP_442140.1_3 Reverse -322 -332 3.91327 0.271
NP_442140.1_3 Reverse -116 -126 3.71661 0.283
NP_440875.1_9 Forward -328 -318 9.3454 0.233
NP_441813.1_5 Forward -332 -322 5.5849 0.118
NP_441813.1_7 Reverse -89 -103 8.3571 0.285
NP_440590.1_4 Forward -329 -316 2.87088 0.0788
NP_442497.1_10 Forward -329 -320 0.688044 0.141
NP_440821.1_4 Reverse -319 -329 8.1415 0.055
NP_440821.1_4 Forward -332 -322 7.94484 0.0591
NP_441892.1_1 Reverse -106 -123 -6.15601 0.298
NP_441892.1_10 Forward -112 -93 10.4225 0.262
NP_440949.1_7 Reverse -313 -332 13.175 0.209
NP_440412.1_2 Reverse -108 -127 5.40766 0.283
NP_440462.1_9 Reverse -101 -120 12.7825 0.259
NP_440401.1_9 Forward -204 -197 14.5917 0.287
NP_440696.1_3 Forward -108 -90 -4.20908 0.298
NP_442039.1_7 Reverse -63 -73 11.9764 0.257
NP_442039.1_7 Reverse -308 -318 11.8781 0.257
NP_440825.1_7 Reverse -43 -53 10.7626 0.294
NP_442837.1_3 Forward -329 -322 6.13563 0.25
NP_442837.1_3 Reverse -322 -329 5.93897 0.265
NP_442837.1_4 Forward -341 -322 7.66927 0.257
NP_440505.1_3 Reverse -319 -329 15.3197 0.0131
NP_440505.1_3 Reverse -310 -320 5.09324 0.246
NP_440505.1_3 Reverse -40 -50 4.3066 0.3
NP_440914.1_1 Forward -208 -198 11.0549 0.11
NP_440914.1_1 Forward -330 -320 6.95605 0.257
NP_441699.1_2 Reverse -65 -84 15.9291 0.234
NP_442533.1_6 Reverse -261 -270 5.01461 0.16
NP_442535.1_5 Reverse -32 -51 17.404 0.0411
NP_441482.1_7 Reverse -315 -329 -1.18038 0.0637
NP_439944.1_9 Reverse -322 -332 14.828 0.0321
NP_439944.1_9 Forward -329 -319 9.41981 0.1
NP_440116.1_8 Forward -329 -310 -0.197208 0.105
NP_440115.1_6 Reverse -318 -328 18.9579 0.0139
NP_440007.1_9 Reverse -317 -331 0.589577 0.294
NP_441972.1_5 Reverse -3 -22 -4.03212 0.204
NP_441972.1_5 Forward -123 -104 -5.40875 0.22
NP_441869.1_9 Reverse -156 -175 11.3075 0.293
NP_439903.1_6 Forward -339 -320 1.17865 0.253
NP_001035870.1_3 Reverse -98 -117 -6.09707 0.297
NP_442928.1_3 Reverse -246 -265 12.13 0.274
NP_441286.1_1 Forward -331 -319 10.6587 0.0171
NP_441286.1_1 Reverse -320 -332 9.67541 0.0217
NP_440670.1_8 Forward -330 -321 13.2744 0.0157
NP_440670.1_8 Reverse -321 -330 7.37455 0.0774
NP_440670.1_8 Reverse -60 -69 3.24465 0.29
NP_440404.1_9 Reverse -74 -93 7.97315 0.263
NP_441753.1_10 Reverse -244 -263 2.0644 0.248
NP_440907.2_8 Forward -269 -259 5.78111 0.188
NP_442264.1_2 Reverse -311 -328 16.4601 0.121
NP_441463.1_3 Forward -340 -321 0.786102 0.13
NP_441463.1_6 Forward -272 -258 12.8904 0.215
NP_442842.1_10 Forward -80 -61 0.562511 0.264
NP_441626.1_2 Forward -329 -322 6.0373 0.212
NP_441626.1_2 Reverse -322 -329 6.0373 0.212
NP_442221.1_4 Reverse -246 -265 5.80098 0.296
NP_440107.1_5 Forward -331 -312 -2.55715 0.178
NP_442794.1_1 Reverse -111 -123 15.8703 0.0426
NP_442794.1_1 Forward -334 -322 7.61046 0.136
NP_442794.1_1 Forward -122 -110 4.8572 0.244
NP_442794.1_1 Reverse -317 -329 3.18557 0.286
NP_442794.1_1 Reverse -38 -50 2.59558 0.287
NP_441962.1_4 Reverse -316 -335 -11.4069 0.241
NP_441962.1_4 Forward -335 -316 -11.8986 0.248
NP_440387.1_1 Forward -330 -314 2.32015 0.0827
NP_440387.1_1 Reverse -321 -337 -4.46469 0.187
NP_441993.1_1 Forward -112 -93 5.06532 0.208
NP_440095.1_6 Reverse -202 -221 9.83255 0.252
NP_440766.1_4 Forward -334 -320 0.392915 0.286
NP_440766.1_5 Forward -40 -28 8.22874 0.285
NP_441237.1_9 Forward -329 -319 10.5998 0.224
NP_442930.1_1 Forward -85 -75 14.4342 0.239
NP_439910.1_2 Forward -338 -321 -22.479 0.25
NP_440457.1_1 Reverse -317 -329 -0.452677 0.263
NP_441332.1_3 Forward -360 -341 7.37428 0.259
NP_441332.1_4 Reverse -14 -33 8.16093 0.234
NP_441436.1_2 Reverse -246 -265 5.40766 0.19
NP_440734.1_9 Reverse -89 -108 11.5042 0.249
NP_440756.1_1 Reverse -29 -48 17.0428 0.294
NP_441885.1_5 Reverse -321 -331 2.24165 0.0822
NP_441885.1_5 Forward -330 -320 1.35667 0.11
NP_441885.1_5 Reverse -42 -52 0.668351 0.133
NP_440628.1_1 Reverse -70 -80 15.4178 0.248
NP_442341.1_7 Forward -331 -317 1.37622 0.292
NP_442341.1_7 Reverse -1 -15 1.17956 0.297
NP_443000.1_7 Reverse -40 -50 4.89658 0.158
NP_443000.1_7 Reverse -319 -329 0.57002 0.294
NP_440275.1_3 Reverse -319 -329 8.04317 0.0602
NP_440275.1_3 Forward -332 -322 5.38824 0.153
NP_440091.1_1 Forward -334 -322 4.26721 0.14
NP_443010.1_10 Forward -273 -256 1.99772 0.287
NP_441122.1_1 Forward -73 -58 4.99478 0.28
NP_439962.1_4 Reverse -245 -264 2.85105 0.196
NP_440880.1_6 Forward -293 -274 13.8633 0.24
NP_442495.1_5 Forward -273 -254 6.98095 0.291
NP_441105.1_3 Reverse -98 -117 -4.52377 0.201
NP_441105.1_3 Forward -233 -214 -9.73531 0.295
NP_440216.1_9 Reverse -10 -19 11.7011 0.254
NP_440172.1_1 Reverse -42 -52 4.20827 0.2
NP_440172.1_1 Forward -51 -41 1.94665 0.29
NP_442015.1_10 Forward -334 -321 12.0157 0.0372
NP_442015.1_10 Reverse -111 -124 7.29578 0.0904
NP_442015.1_10 Reverse -317 -330 -0.37404 0.264
NP_441111.1_7 Forward -329 -321 8.96754 0.0463
NP_442379.1_10 Forward -367 -350 1.02215 0.223
NP_441766.1_2 Forward -330 -321 6.5879 0.0918
NP_441766.1_9 Forward -260 -241 -3.04881 0.291
NP_441135.1_4 Reverse -206 -225 7.96426 0.284
NP_440261.1_5 Forward -329 -316 -10.7971 0.21
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAAACCAGCAGGAATTGAGTGCTTTTACACCCGACAGAGTGGCCAGGTTCCTTTTGATTCCCAATACGATTACGATCGCCACGGTTCCCAGTGTTACGCCCATATTTCTTTCTTTGGCAAGGACGGAGAAAGGGATGCCCCCACTGCTGGCTCACCGGTATATCCTAATCCTGGACTTTACGATCACAGTGAAACGAACCCCAACTCCGACGACTGGGTTTATAGTCTTGGTTTAAATCCGGGAGGCATCGAATGTTAACTCGGTCTTCATAGCTGTGCCATCACAAAGGCTGGGGTCAGTTGATGTTGGCCATTAAAATTTTCTCTGTTTGCCAATTGTCCATAGGTTAGCGATTACCTTAGGGTAAAACTTTGTTGTAGTTTCCGTTGGTTATTGATC

CDS

GTGAGTAATGAAGCCCCGATGGAAACTATCCCGGTGGACTATGGCACTTTAACGCCTCCGCAAAAATGGCAACGATTGCAGGAGTTGGCCTATTTATTTTTGCGGTTAGGACTGTTTTCCTTTGGCGGCCCTGCGGCCCACACCGCCATGATGGAGGAAGAAGTGGTGCGGCGACAACAATGGCTCAGCCACGAAAAATTTTTAGATTTGATTGGGGTGACCAATTTAATCCCCGGGCCTAATTCTACTGAGTTAGCCATTCACCTGGGCTATGAGCGGGGCAAATGGGCAGGTTTGATCATTGGCGGAGTTGCCTTTATTTTGCCGGCCATGGTAGTGGTCTGGTTATTGGCGATCGCCTATGTTCATTACCAGTCAGTGCCAGCGGTGGGCCATATGCTCTATGGCATCCAACCAATGATCATTCCCCTGATTGGCCAAGCTTTATGGAAATTGGGTCGGAAAGCACTAAAAAATCCCCTCACCATTGGGGCGGCGGTGTTGGTCATGGTGGGGACGGCCTGGGGAAAGCCGGAAATTTTACTATTACTGCTGGCGGGCTTAGCCCTGGTGTTGATCCAAATTGGGCGGGGACGTTTTCAATCTTTACCGCTGATTTTTTTACCCCTAGGTCAAATCGCTCCAGCCCCGGCGTTACCAGTAACAATCATCAACCCTTGGTCCGTGTTTGGCATTTTTCTGAAAATTGGTTGCCTGCTCTATGGCGGTGGTTACGTACTGTTTGCTTTTTTGCAAGCTGACCTCGTGGAGCGTTTGGAATGGCTGACTTCCCAGCAATTATTGGATGCGATCGCCATTGGCCAAATCACCCCTGGGCCACTATTCACCACGGCAACTTTTATTGGTTATTTATTGGCCGGCAACCCTGGGGCAATCGCCGCTACGGTGGGCATCTTTCTACCATCTTTTTTACTGGTGGCCTTGGTCAATCCCTGGGTCAGTACCCTGCAAAAATCCTTAATTTTCCGAGCTTTCCTCGATGGTGTTAATGCCGGTGCGTGGGGTTTAATGGTGGTCACTACCATTGGTTTAGCCCGTTCCGCCCTCATTGATCCCTTGACCATCTGCTTAGCGGTGCTCGGGGCGATCGCCCTGGGACGATTTTCCATCAGTTCCCATTGGTTAGTGGTCTTTGGTGCCCTGGTGGGCCTAGTTGGCCAAAGCTGGTCAATGGGTTAA

Protein

MSNEAPMETIPVDYGTLTPPQKWQRLQELAYLFLRLGLFSFGGPAAHTAMMEEEVVRRQQWLSHEKFLDLIGVTNLIPGPNSTELAIHLGYERGKWAGLIIGGVAFILPAMVVVWLLAIAYVHYQSVPAVGHMLYGIQPMIIPLIGQALWKLGRKALKNPLTIGAAVLVMVGTAWGKPEILLLLLAGLALVLIQIGRGRFQSLPLIFLPLGQIAPAPALPVTIINPWSVFGIFLKIGCLLYGGGYVLFAFLQADLVERLEWLTSQQLLDAIAIGQITPGPLFTTATFIGYLLAGNPGAIAATVGIFLPSFLLVALVNPWVSTLQKSLIFRAFLDGVNAGAWGLMVVTTIGLARSALIDPLTICLAVLGAIALGRFSISSHWLVVFGALVGLVGQSWSMG