Your browser is old and dusty. Try Google Chrome!

Details for slr1456

ORF slr1456
Accession NP_442844.1
Symbol pilA4
Category type 4 pilin-like protein, or general secretion pathway protein G
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -349 -330 -22.3217 0.175
NP_441818.1_9 Forward -258 -239 -3.14714 0.22
NP_441465.1_5 Reverse -229 -243 17.8958 0.286
NP_441098.1_3 Reverse -172 -191 8.61937 0.204
NP_441438.1_1 Forward -192 -173 6.68596 0.258
NP_441054.1_2 Forward -261 -242 10.8159 0.283
NP_440878.1_9 Forward -236 -217 13.9625 0.0939
NP_441900.1_2 Reverse -339 -357 -5.48809 0.288
NP_440304.1_4 Forward -310 -300 4.69992 0.252
NP_440044.1_8 Forward -336 -317 0.982764 0.186
NP_440765.1_3 Reverse -248 -267 7.27595 0.268
NP_441365.1_5 Forward -193 -174 -4.32711 0.169
NP_441434.1_1 Reverse -177 -191 10.1338 0.233
NP_441713.1_2 Reverse -324 -343 20.649 0.0728
NP_440057.1_1 Reverse -218 -237 10.7175 0.232
NP_442687.1_7 Forward -309 -299 12.3697 0.0768
NP_442485.1_3 Reverse -251 -270 2.16274 0.215
NP_440642.1_10 Forward -39 -25 7.66879 0.221
NP_442782.1_2 Forward -308 -294 1.27789 0.281
NP_441487.1_6 Reverse -144 -163 -2.0655 0.286
NP_440203.1_5 Forward -158 -148 14.5325 0.0886
NP_442911.1_2 Reverse -180 -199 -10.6203 0.284
NP_441099.1_5 Forward -159 -140 -2.16383 0.118
NP_441916.1_7 Forward -308 -298 2.63497 0.246
NP_440569.1_10 Forward -227 -208 2.43462 0.293
NP_441725.1_5 Reverse -300 -310 0.373358 0.182
NP_442982.1_5 Forward -319 -300 5.50599 0.157
NP_442215.1_2 Reverse -137 -153 -5.15301 0.246
NP_442029.1_6 Reverse -2 -21 3.14605 0.283
NP_442933.1_2 Forward -283 -265 7.73683 0.257
NP_440183.1_1 Reverse -300 -319 10.4225 0.244
NP_441569.1_7 Forward -19 -5 16.6169 0.296
NP_441015.1_9 Reverse -240 -253 14.7683 0.292
NP_441764.1_8 Reverse -31 -41 12.3635 0.284
NP_442719.1_2 Reverse -299 -317 0.411736 0.162
NP_441911.1_10 Reverse -229 -248 8.07696 0.271
NP_442342.1_9 Reverse -144 -160 5.36841 0.239
NP_441114.1_3 Forward -159 -150 7.57121 0.231
NP_441433.1_8 Reverse -147 -166 3.6377 0.202
NP_442795.1_5 Forward -47 -28 6.4893 0.276
NP_441458.1_8 Forward -286 -267 6.04041 0.256
NP_442594.1_8 Reverse -149 -168 3.24438 0.286
NP_442317.1_6 Reverse -379 -398 1.96607 0.293
NP_440899.1_1 Forward -367 -348 7.62671 0.254
NP_441799.1_1 Reverse -324 -338 4.52221 0.247
NP_442334.1_2 Forward -318 -301 -14.4158 0.3
NP_440306.1_8 Reverse -269 -288 -0.886293 0.222
NP_439976.1_4 Forward -232 -213 9.63507 0.278
NP_441160.1_1 Reverse -221 -240 -11.8003 0.295
NP_440192.1_4 Forward -243 -224 10.4648 0.237
NP_443038.1_7 Forward -246 -228 19.6853 0.0625
NP_439937.1_8 Forward -320 -301 -4.42544 0.284
NP_442239.1_8 Reverse -293 -312 4.62101 0.296
NP_440819.1_5 Forward -287 -279 7.98423 0.228
NP_440819.1_5 Forward -318 -310 7.8859 0.266
NP_440316.1_10 Forward -156 -146 7.15819 0.251
NP_442165.1_2 Forward -252 -239 16.8339 0.281
NP_440297.1_9 Reverse -300 -310 4.79825 0.22
NP_440297.1_9 Forward -160 -150 3.81494 0.26
NP_442129.1_6 Forward -79 -60 13.8495 0.247
NP_440999.1_9 Reverse -336 -350 2.65453 0.146
NP_442892.1_6 Forward -385 -366 2.65439 0.253
NP_442454.1_2 Reverse -172 -191 8.06865 0.291
NP_442948.1_2 Reverse -252 -271 7.07928 0.229
NP_441834.1_10 Reverse -300 -319 6.29264 0.26
NP_440220.1_4 Forward -245 -226 -1.57461 0.264
NP_442120.1_10 Forward -244 -225 -9.14533 0.242
NP_440992.1_5 Reverse -226 -245 12.375 0.297
NP_441719.1_2 Reverse -123 -137 14.2134 0.278
NP_442695.1_3 Reverse -232 -246 17.6002 0.196
NP_440129.1_10 Reverse -145 -159 6.29277 0.177
NP_441851.1_10 Reverse -26 -36 4.50326 0.266
NP_440593.1_3 Forward -319 -300 -5.31042 0.259
NP_440593.1_3 Reverse -300 -319 -6.58872 0.278
NP_441732.1_2 Forward -400 -384 -17.2477 0.247
NP_440760.1_7 Forward -45 -26 6.29183 0.192
NP_440199.1_10 Forward -352 -342 6.46988 0.299
NP_441022.1_1 Reverse -243 -252 11.4503 0.284
NP_442776.1_1 Reverse -140 -159 4.03102 0.278
NP_440352.1_5 Reverse -252 -271 9.93029 0.289
NP_443014.1_6 Forward -375 -356 17.2074 0.235
NP_441653.1_3 Forward -249 -235 13.1759 0.279
NP_441943.1_8 Forward -157 -138 -5.11376 0.245
NP_441329.1_6 Reverse -18 -37 -1.67153 0.293
NP_442796.1_10 Reverse -223 -242 14.2574 0.145
NP_440224.1_1 Reverse -140 -159 1.86774 0.132
NP_442199.1_4 Forward -35 -16 6.4893 0.249
NP_442914.1_8 Forward -255 -236 13.8641 0.223
NP_440875.1_9 Forward -158 -148 8.5667 0.233
NP_441813.1_3 Reverse -217 -236 15.2069 0.238
NP_442028.1_1 Reverse -269 -282 7.60564 0.292
NP_441892.1_1 Reverse -143 -160 -3.20608 0.235
NP_440900.1_5 Forward -342 -323 18.826 0.0957
NP_440546.1_6 Reverse -219 -238 6.58763 0.297
NP_440675.1_1 Reverse -296 -315 1.0811 0.299
NP_440462.1_6 Forward -264 -254 2.14332 0.294
NP_441497.1_2 Reverse -118 -137 6.39097 0.233
NP_442499.1_4 Reverse -344 -358 20.2558 0.0794
NP_442479.1_9 Forward -252 -233 -10.522 0.27
NP_441848.1_4 Forward -290 -274 9.65149 0.275
NP_441848.1_4 Forward -291 -275 7.93263 0.288
NP_442679.1_1 Forward -141 -122 -5.99873 0.298
NP_442829.1_2 Forward -136 -120 9.5906 0.287
NP_442844.1_1 Forward -70 -55 20.3344 0.263
NP_442844.1_2 Forward -188 -173 19.0599 0.229
NP_442844.1_3 Forward -144 -125 21.8289 0.0171
NP_442844.1_5 Forward -118 -99 20.4514 0.0523
NP_442844.1_6 Forward -366 -347 17.699 0.29
NP_442844.1_7 Forward -338 -319 17.5726 0.272
NP_442322.1_4 Reverse -69 -86 -7.92662 0.286
NP_440854.1_5 Forward -191 -177 15.0993 0.274
NP_440854.1_7 Forward -122 -108 15.9573 0.246
NP_441482.1_7 Forward -314 -300 -11.2101 0.245
NP_441482.1_7 Reverse -21 -35 -11.5051 0.268
NP_441028.1_6 Forward -33 -23 12.9592 0.166
NP_441028.1_6 Forward -34 -24 5.97777 0.234
NP_441028.1_6 Reverse -141 -151 3.8145 0.281
NP_441527.1_4 Forward -139 -120 -2.0535 0.153
NP_441527.1_4 Forward -138 -119 -2.0535 0.153
NP_441527.1_4 Reverse -97 -116 -3.58137 0.17
NP_441527.1_4 Reverse -100 -119 -6.25514 0.215
NP_441527.1_4 Forward -293 -274 -9.59736 0.26
NP_441527.1_5 Reverse -25 -44 11.9205 0.297
NP_441527.1_8 Reverse -230 -249 3.73603 0.279
NP_441602.1_3 Reverse -300 -319 1.47442 0.214
NP_441286.1_1 Forward -37 -25 -6.5492 0.267
NP_442463.1_3 Reverse -140 -159 9.93088 0.279
NP_441808.1_8 Reverse -300 -319 8.94757 0.259
NP_439999.1_6 Forward -301 -284 20.0976 0.21
NP_442264.1_2 Forward -165 -148 4.6604 0.295
NP_442362.1_7 Forward -325 -307 11.5239 0.24
NP_442323.1_7 Reverse -146 -165 1.47364 0.279
NP_441510.2_7 Reverse -247 -261 12.9786 0.28
NP_441272.1_8 Reverse -229 -247 10.5406 0.296
NP_440293.1_9 Reverse -300 -314 9.02504 0.294
NP_441981.1_3 Reverse -215 -229 14.6986 0.268
NP_441801.1_4 Reverse -142 -152 12.3697 0.201
NP_441984.1_3 Reverse -141 -159 4.9357 0.299
NP_440554.1_5 Forward -386 -368 13.5888 0.158
NP_441173.1_9 Forward -223 -215 11.7204 0.226
NP_441635.1_5 Forward -192 -178 20.0118 0.15
NP_439962.1_4 Reverse -224 -243 -2.75381 0.24
NP_442495.1_4 Forward -156 -146 16.7946 0.0771
NP_442418.1_1 Reverse -107 -126 19.469 0.106
NP_441766.1_2 Forward -262 -253 2.16301 0.262
NP_442226.1_1 Reverse -19 -38 10.6192 0.281
NP_442046.1_2 Reverse -115 -128 15.4346 0.229
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAAAGAGTTATTCACCTCGGTTCAGAAATCCAGGTGGAAGTATTGCTAATGGATAACACCGCTGTGCTTGCTTACCTAAACCGGGAACAAGGGCAACAGCTTAATCCTAAAGCTGGAAAAAAAGTATTTATTAAGCCCCGGGTCGCTAAGGTTTTTGCTGGAGCTTCTTCCGCGGCTTCTACCCATTTTATTTATGGTACGGGTATCTAAATAAACTATTTTAAACTGGATCTATAAGCTCCAATGCCCTGGGGAGTAACTGAAAGGAAACGAAAAAATAATCTTCTTCCTATTCTATTCCTTCTGATTGAGTAACCAGGACTTTTGGGTACGCTTTCGATTAGAAGTGTGAGGAAAGAGGTTTGCTTTCCCCCTGTTTAGTAATCCATCCCTAGAGCC

CDS

GTGAACTCATCTAAGACCGCATTCAGAGGTCATAATGTTTTTTTGCTCCGCCATGCCCTGGCATGCTCGACGGGATTCACCTTGCTGGAAATATTAGTTGTTGTGATCGTTATTGGTATTCTAGGGGCGATCGCCGTGCCGAACTTGCTGGCCCAAGTAGACAAGGCTAGGTACTCGGAAGCGAAAACCCAGATGAGCTGTATGGCCAAGGAATTAACGGTGTATCGCTATGAACATGGCACTTTTCCCCCGGATGTGAACCGTAATATTAAACCAGCAGGAATTGAGTGCTTTTACACCCGACAGAGTGGCCAGGTTCCTTTTGATTCCCAATACGATTACGATCGCCACGGTTCCCAGTGTTACGCCCATATTTCTTTCTTTGGCAAGGACGGAGAAAGGGATGCCCCCACTGCTGGCTCACCGGTATATCCTAATCCTGGACTTTACGATCACAGTGAAACGAACCCCAACTCCGACGACTGGGTTTATAGTCTTGGTTTAAATCCGGGAGGCATCGAATGTTAA

Protein

MNSSKTAFRGHNVFLLRHALACSTGFTLLEILVVVIVIGILGAIAVPNLLAQVDKARYSEAKTQMSCMAKELTVYRYEHGTFPPDVNRNIKPAGIECFYTRQSGQVPFDSQYDYDRHGSQCYAHISFFGKDGERDAPTAGSPVYPNPGLYDHSETNPNSDDWVYSLGLNPGGIEC