Your browser is old and dusty. Try Google Chrome!

Details for slr1455

ORF slr1455
Accession NP_442843.1
Symbol cysA
Category sulfate transport system ATP-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -340 -354 0.491246 0.207
NP_441418.1_6 Forward -261 -242 -29.0082 0.215
NP_441418.1_6 Forward -354 -335 -29.4998 0.228
NP_441623.1_1 Reverse -347 -365 7.00065 0.139
NP_440758.1_2 Forward -351 -332 4.22769 0.166
NP_442655.1_2 Reverse -46 -65 4.71934 0.23
NP_441934.1_8 Forward -263 -244 11.4058 0.292
NP_440061.1_9 Reverse -361 -375 9.93039 0.134
NP_441054.1_2 Reverse -304 -323 12.9791 0.212
NP_441054.1_2 Forward -372 -353 10.4225 0.284
NP_442062.1_3 Reverse -11 -30 5.01433 0.194
NP_442981.1_7 Forward -260 -241 3.04771 0.263
NP_442602.1_3 Forward -134 -115 -3.93378 0.293
NP_441594.1_6 Forward -351 -332 7.07928 0.181
NP_441594.1_6 Forward -231 -212 1.17943 0.272
NP_442742.1_9 Reverse -315 -334 -13.0786 0.269
NP_441925.1_2 Reverse -196 -215 1.37609 0.278
NP_441925.1_4 Reverse -347 -366 -11.9976 0.253
NP_441149.1_9 Forward -160 -141 -1.57461 0.288
NP_441434.1_1 Reverse -297 -311 8.41491 0.257
NP_441434.1_6 Forward -206 -196 17.5813 0.243
NP_440808.1_5 Forward -365 -346 14.5524 0.194
NP_440056.1_9 Forward -340 -321 13.0919 0.295
NP_442570.1_3 Reverse -355 -374 -9.44032 0.299
NP_441163.1_1 Reverse -245 -262 8.78956 0.226
NP_440481.1_6 Reverse -141 -159 17.2271 0.116
NP_441014.1_8 Reverse -340 -359 2.75272 0.214
NP_441012.1_4 Reverse -242 -255 6.60746 0.278
NP_443018.1_3 Reverse -364 -371 9.38056 0.128
NP_440376.1_1 Forward -93 -84 3.14632 0.207
NP_440066.1_5 Reverse -245 -264 7.17681 0.268
NP_442946.1_7 Reverse -217 -232 19.5528 0.142
NP_440042.1_2 Reverse -242 -261 -0.885524 0.233
NP_440667.1_2 Forward -249 -230 -8.752 0.293
NP_441950.1_7 Forward -360 -341 0.196116 0.191
NP_440360.1_5 Reverse -333 -352 -5.11376 0.297
NP_440141.1_8 Forward -243 -224 8.16093 0.232
NP_442782.1_2 Forward -367 -353 5.30946 0.245
NP_440607.1_8 Forward -236 -217 4.81767 0.209
NP_442937.1_5 Forward -266 -247 11.4058 0.14
NP_442937.1_5 Forward -353 -334 10.5209 0.158
NP_441127.1_1 Reverse -345 -359 10.521 0.244
NP_441127.1_1 Forward -252 -238 8.35772 0.3
NP_442690.1_1 Reverse -124 -143 -15.2418 0.28
NP_440153.1_8 Reverse -339 -352 6.31247 0.172
NP_443055.1_3 Reverse -295 -314 11.791 0.243
NP_443055.1_6 Reverse -244 -262 3.55831 0.195
NP_441099.1_5 Forward -382 -363 -11.6036 0.287
NP_441099.1_5 Reverse -242 -261 -11.8986 0.291
NP_442438.1_10 Forward -254 -240 7.47274 0.0933
NP_442438.1_10 Forward -353 -339 1.37622 0.197
NP_441000.1_6 Reverse -370 -384 1.27789 0.175
NP_441041.1_1 Forward -360 -341 6.68596 0.267
NP_441041.1_4 Forward -354 -335 -5.40875 0.152
NP_440569.1_10 Reverse -186 -205 10.3605 0.222
NP_441725.1_5 Reverse -346 -356 3.12662 0.115
NP_440983.1_5 Reverse -333 -352 -9.24366 0.3
NP_440260.1_7 Forward -251 -232 3.04771 0.241
NP_440260.1_7 Reverse -188 -207 -5.21209 0.258
NP_441514.1_4 Reverse -11 -30 12.4059 0.292
NP_442281.1_1 Reverse -358 -372 5.99717 0.139
NP_442281.1_1 Reverse -239 -253 2.45727 0.266
NP_441334.1_7 Reverse -337 -356 -12.8819 0.175
NP_442575.1_8 Forward -383 -364 -5.99873 0.277
NP_442012.1_1 Forward -99 -80 0.884433 0.229
NP_442012.1_5 Forward -355 -336 7.66927 0.252
NP_441644.1_1 Forward -354 -335 14.6508 0.15
NP_441644.1_6 Forward -249 -239 5.58445 0.184
NP_440587.1_5 Forward -240 -222 19.309 0.116
NP_440867.1_3 Reverse -175 -194 21.8289 0.021
NP_442029.1_1 Forward -350 -331 -20.4534 0.298
NP_440780.1_1 Reverse -61 -80 11.6973 0.243
NP_442933.1_2 Reverse -229 -247 6.49544 0.269
NP_442554.1_8 Forward -371 -361 5.38824 0.15
NP_442554.1_8 Reverse -364 -374 3.12662 0.239
NP_441523.1_6 Reverse -211 -230 3.53937 0.272
NP_441865.1_3 Reverse -65 -83 14.2771 0.242
NP_442301.1_2 Reverse -338 -357 6.09517 0.263
NP_440881.1_5 Forward -365 -346 12.4875 0.299
NP_441015.1_10 Forward -353 -334 -2.65548 0.18
NP_441826.1_2 Reverse -339 -353 3.93283 0.105
NP_441379.1_2 Forward -211 -192 4.32602 0.263
NP_441612.1_2 Forward -324 -314 13.5836 0.21
NP_442542.1_2 Forward -356 -343 6.1158 0.234
NP_441114.1_3 Forward -382 -373 6.39124 0.277
NP_440558.1_2 Reverse -216 -235 -2.55715 0.229
NP_440558.1_2 Forward -387 -368 -7.08038 0.287
NP_441518.1_3 Forward -87 -68 -15.1435 0.287
NP_441878.1_6 Forward -373 -363 0.766681 0.134
NP_442650.1_2 Reverse -246 -260 2.2612 0.286
NP_441557.1_8 Reverse -90 -100 10.5993 0.28
NP_441590.1_4 Reverse -236 -255 11.7983 0.249
NP_442419.1_2 Reverse -247 -266 -0.787193 0.246
NP_440101.1_10 Forward -354 -335 7.37428 0.193
NP_441574.1_1 Forward -348 -329 -0.787193 0.211
NP_442444.1_6 Forward -353 -335 12.6304 0.27
NP_441549.1_9 Reverse -175 -193 -4.01242 0.198
NP_441633.1_3 Reverse -334 -347 0.707601 0.117
NP_442998.1_5 Forward -325 -315 14.6313 0.149
NP_440731.1_2 Forward -360 -341 2.94938 0.297
NP_440299.1_1 Reverse -236 -249 4.64028 0.205
NP_441007.1_10 Forward -353 -340 8.18076 0.116
NP_442334.1_10 Reverse -210 -229 -16.8151 0.282
NP_443042.1_5 Reverse -158 -177 12.2561 0.264
NP_441559.1_8 Forward -229 -215 -7.17857 0.287
NP_441559.1_8 Forward -349 -335 -7.47356 0.294
NP_440997.1_6 Forward -98 -79 8.65258 0.266
NP_440695.1_6 Reverse -53 -67 11.4779 0.265
NP_441494.1_6 Reverse -334 -347 9.45906 0.227
NP_442386.1_9 Reverse -362 -371 7.07914 0.219
NP_442386.1_9 Reverse -251 -260 5.9975 0.23
NP_442186.1_4 Forward -192 -174 12.8022 0.277
NP_440168.1_9 Forward -245 -226 3.04771 0.231
NP_440168.1_9 Forward -365 -346 -3.24547 0.292
NP_441160.1_5 Forward -239 -220 -6.58872 0.288
NP_440586.1_1 Forward -352 -333 0.687771 0.237
NP_440027.1_3 Reverse -234 -252 6.40989 0.225
NP_441657.1_7 Reverse -39 -49 15.7774 0.251
NP_441595.1_3 Forward -352 -342 16.598 0.202
NP_441181.1_6 Forward -362 -344 2.18243 0.299
NP_441789.1_7 Reverse -337 -356 -2.26292 0.257
NP_440316.1_10 Forward -373 -363 8.1415 0.24
NP_440316.1_10 Forward -355 -345 6.17489 0.265
NP_440267.1_2 Forward -318 -304 5.99717 0.248
NP_442384.1_10 Forward -225 -212 3.26421 0.197
NP_442384.1_10 Reverse -244 -257 0.510939 0.289
NP_442262.1_10 Reverse -364 -371 9.47889 0.187
NP_442244.1_3 Reverse -176 -195 9.83255 0.148
NP_440297.1_9 Reverse -364 -374 -0.216628 0.282
NP_440350.1_5 Reverse -273 -292 1.0811 0.158
NP_442280.1_10 Forward -161 -143 9.83744 0.231
NP_440894.1_2 Reverse -346 -365 2.55606 0.174
NP_440894.1_10 Reverse -79 -98 4.916 0.241
NP_442129.1_6 Forward -142 -123 14.4312 0.246
NP_440999.1_9 Reverse -335 -349 0.589577 0.18
NP_440888.1_2 Reverse -339 -353 5.50552 0.276
NP_441949.1_4 Forward -233 -214 9.0459 0.213
NP_441258.1_2 Reverse -59 -77 21.062 0.12
NP_442710.1_4 Reverse -340 -359 18.5843 0.149
NP_441469.1_8 Forward -355 -346 7.17789 0.227
NP_441223.1_5 Reverse -18 -32 16.7213 0.162
NP_440220.1_4 Reverse -350 -369 8.35677 0.176
NP_440220.1_4 Forward -88 -69 -3.34455 0.286
NP_441929.1_3 Reverse -72 -91 7.27595 0.266
NP_441929.1_6 Reverse -136 -155 6.09597 0.294
NP_442204.1_5 Forward -232 -213 2.85105 0.204
NP_442080.1_7 Forward -346 -327 -2.65548 0.287
NP_441052.1_2 Reverse -315 -325 -0.118297 0.266
NP_441884.1_8 Forward -373 -354 -7.4737 0.251
NP_441884.1_9 Reverse -351 -370 -23.01 0.284
NP_441004.1_1 Forward -360 -341 11.2092 0.0434
NP_441004.1_1 Forward -258 -239 -16.0285 0.281
NP_441004.1_1 Forward -261 -242 -16.7168 0.287
NP_441004.1_2 Forward -263 -244 9.53756 0.147
NP_441004.1_2 Forward -365 -346 5.89931 0.191
NP_441004.1_3 Forward -351 -332 3.6377 0.257
NP_441004.1_4 Forward -255 -245 9.41981 0.259
NP_441004.1_4 Forward -357 -347 9.12481 0.259
NP_441004.1_5 Forward -358 -344 10.7177 0.243
NP_442813.1_4 Forward -340 -321 0.491109 0.197
NP_442694.1_4 Forward -261 -252 12.6844 0.248
NP_442854.1_6 Reverse -304 -323 1.76941 0.279
NP_443054.1_2 Reverse -250 -264 0.786239 0.254
NP_440611.1_6 Reverse -244 -263 5.40766 0.29
NP_440593.1_3 Reverse -334 -353 -5.31042 0.259
NP_440593.1_3 Forward -353 -334 -6.58872 0.278
NP_440463.1_8 Reverse -242 -261 6.53177 0.269
NP_440389.1_5 Reverse -332 -351 10.8728 0.295
NP_442843.1_1 Forward -371 -352 30.2854 0.000227
NP_442843.1_1 Forward -353 -334 -4.22878 0.235
NP_442843.1_2 Forward -346 -327 33.8253 0.00000187
NP_442843.1_4 Forward -265 -247 25.9785 0.00301
NP_442843.1_5 Forward -310 -291 20.9968 0.0578
NP_442843.1_7 Forward -208 -190 25.8055 0.00356
NP_442843.1_8 Forward -395 -376 30.3837 0.000591
NP_442843.1_9 Forward -287 -268 28.2204 0.00066
NP_439960.1_10 Forward -262 -244 0.0191479 0.216
NP_441124.1_5 Reverse -71 -81 15.5864 0.188
NP_440954.1_1 Forward -267 -248 -4.81876 0.289
NP_442006.1_2 Forward -261 -244 -15.7924 0.228
NP_442006.1_2 Forward -372 -355 -17.1691 0.27
NP_440539.1_9 Reverse -242 -261 -1.37718 0.286
NP_442443.1_1 Reverse -319 -338 -5.40875 0.282
NP_440526.1_3 Reverse -340 -351 7.62965 0.139
NP_441333.1_1 Reverse -270 -280 12.0666 0.241
NP_440290.1_1 Reverse -71 -80 17.3727 0.21
NP_440760.1_1 Reverse -363 -382 -22.715 0.267
NP_441945.1_10 Forward -361 -342 9.93088 0.258
NP_442727.1_1 Forward -262 -248 11.701 0.289
NP_442400.1_10 Forward -143 -130 11.2343 0.243
NP_441659.2_8 Reverse -339 -349 1.35667 0.242
NP_442346.1_1 Forward -260 -241 10.9142 0.27
NP_442346.1_5 Forward -373 -363 5.5849 0.238
NP_442346.1_5 Reverse -215 -225 4.69992 0.276
NP_442346.1_5 Forward -349 -339 4.60159 0.281
NP_440486.1_6 Forward -104 -85 9.83255 0.219
NP_440486.1_6 Forward -361 -342 8.84924 0.235
NP_440486.1_6 Forward -195 -176 6.19431 0.283
NP_440459.1_2 Forward -276 -259 10.9536 0.185
NP_442311.1_5 Forward -231 -212 0.982764 0.27
NP_440847.1_3 Reverse -355 -369 12.3887 0.249
NP_442875.1_8 Forward -212 -193 15.0441 0.147
NP_441050.1_5 Forward -352 -334 6.80398 0.182
NP_440671.1_1 Forward -400 -381 10.1506 0.191
NP_440671.1_4 Reverse -339 -353 5.80112 0.271
NP_442140.1_3 Reverse -364 -374 4.69992 0.238
NP_440875.1_9 Reverse -175 -185 8.5667 0.233
NP_441259.1_8 Forward -194 -175 12.6833 0.254
NP_440590.1_4 Reverse -340 -353 -1.16069 0.212
NP_440590.1_4 Reverse -214 -227 -2.24233 0.239
NP_440567.1_4 Forward -264 -245 10.4225 0.146
NP_441239.1_9 Reverse -361 -373 14.6903 0.0258
NP_441239.1_9 Reverse -250 -262 5.25052 0.223
NP_441239.1_9 Reverse -242 -254 3.57889 0.283
NP_441951.1_4 Forward -354 -335 0.294447 0.297
NP_441892.1_1 Reverse -330 -347 0.432165 0.168
NP_440604.1_2 Reverse -51 -70 17.5024 0.269
NP_442193.1_1 Forward -267 -249 8.27895 0.272
NP_441874.1_1 Forward -232 -218 8.55439 0.298
NP_440833.1_6 Reverse -354 -368 10.6187 0.242
NP_442041.1_5 Reverse -334 -353 4.32602 0.233
NP_442479.1_9 Forward -83 -64 -6.29373 0.266
NP_440270.1_6 Reverse -358 -377 17.3057 0.125
NP_442402.1_4 Reverse -307 -326 -9.04772 0.285
NP_442679.1_1 Forward -136 -117 -0.4922 0.221
NP_442360.1_5 Forward -259 -249 13.353 0.279
NP_442532.1_1 Reverse -15 -29 15.0697 0.215
NP_442533.1_6 Reverse -363 -372 3.7363 0.204
NP_442533.1_6 Forward -348 -339 1.67135 0.293
NP_440263.1_5 Reverse -129 -143 8.75105 0.294
NP_441602.1_3 Forward -353 -334 -1.96717 0.231
NP_440886.1_7 Reverse -344 -354 5.38779 0.185
NP_440886.1_7 Reverse -335 -345 3.91283 0.26
NP_440828.1_1 Reverse -242 -261 9.04509 0.197
NP_440828.1_4 Reverse -338 -357 -7.47443 0.286
NP_440028.1_6 Forward -104 -86 10.2456 0.282
NP_442022.1_4 Forward -261 -242 8.45592 0.268
NP_442264.1_2 Forward -358 -341 6.72535 0.25
NP_442264.1_2 Reverse -175 -192 5.44704 0.276
NP_441021.1_1 Reverse -364 -383 -9.24366 0.212
NP_442211.1_9 Reverse -235 -254 2.26107 0.247
NP_441962.1_4 Forward -377 -358 -12.6852 0.263
NP_441962.1_4 Reverse -334 -353 -12.8819 0.265
NP_440855.1_1 Forward -264 -245 8.84924 0.127
NP_441993.1_1 Forward -267 -248 6.13735 0.186
NP_440358.1_8 Reverse -131 -150 -2.36049 0.3
NP_442805.1_5 Reverse -236 -255 -6.19614 0.284
NP_440467.1_8 Reverse -222 -241 11.7008 0.243
NP_442087.1_2 Forward -93 -74 14.8577 0.202
NP_440293.1_10 Forward -357 -338 3.34271 0.219
NP_440293.1_10 Forward -255 -236 -1.7705 0.271
NP_439988.1_3 Forward -264 -250 4.22782 0.295
NP_442743.1_1 Reverse -242 -261 10.9134 0.241
NP_442743.1_1 Reverse -353 -372 5.80018 0.268
NP_440643.1_6 Forward -383 -364 3.34271 0.238
NP_441531.1_7 Reverse -173 -192 15.8307 0.272
NP_440457.1_1 Forward -376 -364 6.03717 0.132
NP_441981.1_9 Reverse -64 -78 16.1259 0.293
NP_441984.1_3 Reverse -335 -353 8.7706 0.218
NP_443037.1_7 Forward -49 -30 -5.70374 0.276
NP_440734.1_9 Reverse -249 -268 10.1275 0.282
NP_441440.1_8 Forward -264 -251 16.4406 0.299
NP_442341.1_9 Forward -191 -177 7.27547 0.202
NP_441173.1_9 Reverse -317 -325 12.1137 0.21
NP_440423.1_6 Forward -269 -250 -20.1584 0.252
NP_440552.1_8 Reverse -60 -77 13.3255 0.207
NP_441561.1_7 Reverse -248 -267 6.98015 0.274
NP_442275.1_2 Forward -363 -344 3.14605 0.278
NP_441207.1_7 Forward -135 -121 11.3853 0.241
NP_439962.1_4 Reverse -244 -263 5.80098 0.165
NP_440175.1_7 Forward -339 -321 13.9499 0.174
NP_440149.1_8 Reverse -336 -355 -1.96717 0.162
NP_441105.1_3 Reverse -328 -347 -8.06369 0.265
NP_441105.1_3 Forward -383 -364 -9.047 0.283
NP_442373.1_2 Forward -363 -344 -11.2103 0.293
NP_440249.1_2 Reverse -192 -202 15.3192 0.268
NP_440249.1_2 Reverse -41 -51 14.3359 0.284
NP_440167.1_3 Forward -253 -234 10.9142 0.233
NP_440198.1_3 Reverse -242 -261 13.9616 0.277
NP_443052.1_9 Reverse -91 -110 -2.26216 0.235
NP_443052.1_9 Reverse -341 -360 -5.21209 0.265
NP_440591.1_3 Reverse -68 -86 4.34571 0.126
NP_442154.1_1 Forward -356 -338 -8.24065 0.158
NP_442154.1_1 Forward -263 -245 -8.24065 0.158
NP_442154.1_1 Forward -260 -242 -15.3205 0.218
NP_442154.1_1 Forward -236 -218 -15.7138 0.224
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTATGGAGTTCTGTTAACCAATGCTCGGGCCATGGGAGAGTTTGGCGCAGTGGCGGTGGTTTCCGGCAGTATTCTGGGCAAAACCAGTACATTACCTATTTTTGTGGAGCAGGAATACAAAAACTATCAAACGGAAGCGGCCTTTGGGGCAGCGGTGGTATTAGCTTTATTGGCAGTGGTGACCCTAGTTCTAAAGGAAATTTTAGAGCAGCGCACCGGGCATCATAAAGCTGTTTAACCTTTCACTTTCCCTGCCAAATTTCCGGGAAACTAAATAAAAGTACCAGGTATTACTGGAACTGCGGAGGGGACAGACCAAAATTTTGTCAACATAGCCTGAAACTAACACCATTTTTGAGTTTGACAATCTAACTTCTCTTATATTTAACTGAGGACATC

CDS

ATGAGTATTATTATTAATAACGTTTCTAAACAATTTGGCGATTTTACTGCTTTAAAAGATATTAACCTAGAAGTTCCCGATGGTAAGTTAGTTGCCTTATTGGGCCCTTCCGGTTCCGGAAAATCAACTTTGCTCAGGGCGATCGCCGGATTGGAAGAGCCGGATCAAGGGCAAATTATTATTAATGGTCAGGATGCCACCCATGTGGATATTCGTAAGCGCAACATTGGTTTTGTTTTTCAGCACTACGCTTTGTTTAAACATTTAACTATTCGACAAAATATTGCTTTTGGTTTGGAAATTCGCAAGCATCCCCCAGCGAAAACTAAGGAAAGGGTGGAGGAATTACTTTCATTAATCCAATTGGAAGGTTTAGGTAATCGTTACCCCTCCCAACTCTCTGGCGGCCAACGGCAACGGGTAGCCTTAGCCAGGGCTTTAGCAGTACAACCCCAGGTTTTATTATTAGATGAACCATTTGGGGCTCTGGATGCTAAAGTACGGAAAGAATTGCGGGCTTGGCTGCGAAAATTACATGATGAAGTGCATCTAACCAGCGTGTTTGTTACCCATGACCAGGAAGAGGCTATGGAAGTGGCGGATGAAATTGTGGTGATGAGTAATGGCAAAATCGAGCAAGTGGGCACTGCAGAAGAAATTTATGAGCACCCTGCCAGTCCTTTTGTGATGGGTTTCATTGGCGAAGTTAATGTTTTACCCCGTAATGCTTCCCTCTTTAACTACCACGCTTTTGAACCCCACTCCAGCAATAATGGGCATCAAGAGCCGGTTTTTGTCCGACCCCATGATTTTGAATTGTTAACGGAAGCGGACGATGCCAGCGTAGCGGGGACCATCAAAAGAGTTATTCACCTCGGTTCAGAAATCCAGGTGGAAGTATTGCTAATGGATAACACCGCTGTGCTTGCTTACCTAAACCGGGAACAAGGGCAACAGCTTAATCCTAAAGCTGGAAAAAAAGTATTTATTAAGCCCCGGGTCGCTAAGGTTTTTGCTGGAGCTTCTTCCGCGGCTTCTACCCATTTTATTTATGGTACGGGTATCTAA

Protein

MSIIINNVSKQFGDFTALKDINLEVPDGKLVALLGPSGSGKSTLLRAIAGLEEPDQGQIIINGQDATHVDIRKRNIGFVFQHYALFKHLTIRQNIAFGLEIRKHPPAKTKERVEELLSLIQLEGLGNRYPSQLSGGQRQRVALARALAVQPQVLLLDEPFGALDAKVRKELRAWLRKLHDEVHLTSVFVTHDQEEAMEVADEIVVMSNGKIEQVGTAEEIYEHPASPFVMGFIGEVNVLPRNASLFNYHAFEPHSSNNGHQEPVFVRPHDFELLTEADDASVAGTIKRVIHLGSEIQVEVLLMDNTAVLAYLNREQGQQLNPKAGKKVFIKPRVAKVFAGASSAASTHFIYGTGI