Your browser is old and dusty. Try Google Chrome!

Details for slr1449

ORF slr1449
Accession NP_440882.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -364 -378 1.17956 0.193
NP_440557.1_1 Reverse -334 -353 5.89931 0.154
NP_440795.1_7 Forward -371 -364 14.6904 0.0123
NP_440795.1_7 Reverse -364 -371 14.6904 0.0123
NP_441418.1_6 Reverse -363 -382 -21.0434 0.136
NP_440815.1_5 Reverse -363 -382 9.14423 0.228
NP_440897.1_6 Forward -372 -353 15.5349 0.0295
NP_440897.1_6 Reverse -363 -382 -2.06626 0.203
NP_441453.1_1 Reverse -356 -374 3.26332 0.273
NP_441453.1_4 Reverse -363 -371 16.539 0.00633
NP_441453.1_4 Forward -372 -364 16.539 0.00633
NP_441453.1_4 Forward -232 -224 3.85433 0.284
NP_441453.1_7 Reverse -371 -378 12.9205 0.23
NP_441623.1_1 Reverse -356 -374 -5.19239 0.284
NP_442151.1_4 Reverse -61 -80 16.7157 0.294
NP_442151.1_6 Reverse -363 -377 19.2725 0.00487
NP_442151.1_6 Forward -372 -358 8.84938 0.164
NP_441818.1_1 Forward -371 -360 15.4961 0.0264
NP_441818.1_1 Reverse -364 -375 14.4145 0.0502
NP_441818.1_9 Reverse -69 -88 -7.17871 0.27
NP_441630.1_3 Reverse -355 -374 14.6508 0.0499
NP_441630.1_3 Forward -380 -361 1.67108 0.239
NP_442655.1_1 Reverse -358 -377 2.45773 0.238
NP_442173.1_1 Forward -371 -363 15.4574 0.00633
NP_442173.1_1 Reverse -364 -372 15.4574 0.00633
NP_442752.1_4 Forward -372 -365 13.8055 0.0199
NP_442752.1_4 Reverse -363 -370 13.8055 0.0199
NP_443027.1_4 Reverse -361 -371 11.0914 0.107
NP_443027.1_4 Forward -374 -364 6.46988 0.275
NP_442975.1_10 Forward -376 -362 12.5853 0.0477
NP_440784.1_7 Forward -371 -364 15.9687 0.0123
NP_440784.1_7 Reverse -364 -371 15.9687 0.0123
NP_440061.1_9 Reverse -361 -375 14.1586 0.0722
NP_441476.1_5 Forward -157 -138 -5.80207 0.269
NP_440878.1_7 Reverse -138 -157 16.9115 0.217
NP_442062.1_8 Reverse -363 -373 17.6796 0.00193
NP_442062.1_8 Forward -372 -362 17.3846 0.00193
NP_442062.1_8 Forward -232 -222 3.12662 0.285
NP_441859.1_3 Forward -343 -324 1.47364 0.284
NP_440304.1_4 Forward -374 -364 17.9746 0.00654
NP_440304.1_4 Reverse -361 -371 1.84832 0.299
NP_442242.1_4 Forward -371 -364 14.3954 0.0124
NP_442242.1_4 Reverse -364 -371 14.3954 0.0124
NP_441208.1_9 Forward -375 -361 5.21113 0.275
NP_442110.1_2 Reverse -276 -289 14.9982 0.237
NP_442110.1_7 Reverse -363 -377 10.1277 0.0684
NP_441083.1_5 Forward -372 -362 20.3345 0.00053
NP_441083.1_5 Reverse -363 -373 19.3512 0.000718
NP_442827.1_8 Reverse -355 -374 7.57013 0.0956
NP_442827.1_8 Forward -380 -361 -1.27961 0.245
NP_441434.1_3 Forward -26 -7 -0.590531 0.234
NP_441738.1_2 Forward -370 -363 15.28 0.0102
NP_441738.1_2 Reverse -365 -372 15.28 0.0102
NP_441558.1_5 Reverse -361 -380 10.0292 0.107
NP_441558.1_5 Forward -374 -355 8.55425 0.147
NP_440209.1_1 Reverse -363 -371 18.1123 0.00295
NP_440209.1_1 Forward -372 -364 18.1123 0.00295
NP_442889.1_8 Forward -375 -361 11.012 0.0764
NP_440178.1_7 Reverse -362 -381 -4.32711 0.0548
NP_442706.1_5 Forward -23 -4 13.4399 0.26
NP_442570.1_3 Reverse -361 -380 -0.688862 0.212
NP_442462.1_3 Reverse -140 -159 17.3057 0.0344
NP_441716.1_1 Forward -372 -358 11.3077 0.0936
NP_442111.1_4 Reverse -362 -376 13.1759 0.0394
NP_440906.1_5 Forward -371 -364 15.8704 0.0124
NP_440906.1_5 Reverse -364 -371 15.8704 0.0124
NP_440747.1_10 Reverse -360 -372 16.7552 0.0019
NP_440747.1_10 Forward -375 -363 -1.92764 0.0192
NP_441130.1_10 Reverse -361 -375 15.2409 0.034
NP_441130.1_10 Forward -374 -360 8.25939 0.139
NP_441486.1_1 Reverse -220 -234 1.67122 0.103
NP_441486.1_1 Reverse -360 -374 -2.65535 0.175
NP_441486.1_1 Forward -375 -361 -2.95034 0.175
NP_442634.1_4 Reverse -361 -375 -3.44199 0.161
NP_442634.1_4 Forward -374 -360 -4.7203 0.217
NP_441265.1_3 Forward -378 -364 12.7826 0.0742
NP_442848.1_1 Forward -378 -364 -3.147 0.263
NP_443018.1_3 Forward -371 -364 14.8871 0.0123
NP_443018.1_3 Reverse -364 -371 14.8871 0.0123
NP_443018.1_3 Reverse -224 -231 4.07068 0.299
NP_441634.1_8 Reverse -361 -375 14.7492 0.0248
NP_441634.1_8 Reverse -84 -98 -3.83532 0.295
NP_440376.1_1 Forward -372 -363 19.4693 0.000692
NP_440376.1_1 Reverse -363 -372 19.4693 0.000692
NP_441588.1_4 Forward -370 -360 6.46988 0.193
NP_441588.1_4 Reverse -225 -235 5.87989 0.224
NP_442687.1_7 Forward -373 -363 18.5646 0.0028
NP_442687.1_7 Reverse -362 -372 8.92815 0.0994
NP_441077.1_6 Forward -65 -49 1.8378 0.294
NP_442589.1_5 Reverse -221 -240 18.0924 0.196
NP_441763.1_10 Forward -383 -364 11.6017 0.143
NP_442658.1_1 Forward -374 -364 17.6791 0.00565
NP_442658.1_1 Reverse -361 -371 7.94438 0.199
NP_440141.1_8 Reverse -214 -233 6.29264 0.265
NP_441414.1_9 Reverse -363 -382 0.196116 0.0845
NP_441414.1_9 Forward -372 -353 -2.0655 0.11
NP_441256.1_8 Forward -303 -284 1.96607 0.285
NP_442937.1_5 Reverse -358 -377 10.5209 0.158
NP_442937.1_5 Reverse -275 -294 6.98095 0.265
NP_441958.1_5 Forward -373 -363 20.5312 0.000966
NP_441958.1_5 Reverse -362 -372 12.2714 0.00183
NP_442836.1_5 Forward -378 -359 2.85105 0.248
NP_439905.1_1 Forward -371 -358 7.00078 0.269
NP_440995.1_8 Reverse -353 -372 2.3594 0.264
NP_440984.1_7 Forward -377 -363 10.0294 0.126
NP_440984.1_7 Reverse -358 -372 7.76774 0.163
NP_439990.1_5 Reverse -358 -371 13.4906 0.0942
NP_442376.1_2 Forward -377 -358 -13.1769 0.286
NP_442911.1_2 Reverse -213 -232 0.884433 0.0635
NP_442911.1_2 Forward -382 -363 -1.27885 0.0834
NP_441580.1_6 Forward -383 -364 -6.1954 0.235
NP_443055.1_6 Reverse -363 -381 4.14829 0.186
NP_440993.1_2 Forward -377 -361 3.00846 0.262
NP_440496.1_5 Reverse -265 -284 14.6576 0.224
NP_441099.1_5 Forward -382 -363 5.99764 0.0469
NP_441099.1_5 Reverse -353 -372 -5.50708 0.152
NP_442002.1_9 Forward -373 -366 14.1004 0.074
NP_442013.1_1 Forward -200 -181 9.14423 0.276
NP_441294.1_7 Forward -376 -362 16.7377 0.013
NP_442438.1_10 Forward -377 -363 8.45605 0.0782
NP_442438.1_10 Reverse -218 -232 -0.197071 0.253
NP_441000.1_6 Forward -373 -359 5.50613 0.0933
NP_440147.1_4 Reverse -361 -374 18.4072 0.00407
NP_440147.1_4 Forward -374 -361 11.6223 0.0326
NP_441550.1_8 Forward -374 -364 19.8424 0.00352
NP_441550.1_8 Reverse -361 -371 15.1225 0.0132
NP_441916.1_7 Reverse -363 -373 16.893 0.00407
NP_441916.1_7 Forward -372 -362 10.3048 0.0261
NP_441041.1_4 Reverse -363 -382 -0.000545616 0.0918
NP_441041.1_7 Forward -375 -363 21.8971 0.000853
NP_441568.1_6 Forward -36 -18 12.8934 0.244
NP_441725.1_5 Reverse -364 -374 18.7612 0.0119
NP_441725.1_5 Forward -371 -361 2.04498 0.115
NP_439966.1_7 Reverse -361 -371 15.3192 0.0152
NP_439966.1_7 Forward -374 -364 8.14104 0.14
NP_439966.1_9 Forward -374 -365 0.983037 0.253
NP_442941.1_3 Forward -371 -361 19.2529 0.00262
NP_442941.1_3 Reverse -364 -374 2.43831 0.14
NP_440289.1_2 Forward -375 -362 20.9638 0.003
NP_440289.1_2 Reverse -360 -373 5.91914 0.0605
NP_440289.1_4 Forward -299 -280 9.0459 0.283
NP_442281.1_1 Forward -377 -363 18.2885 0.00454
NP_442281.1_1 Forward -237 -223 3.53891 0.228
NP_441334.1_7 Reverse -361 -380 -19.9617 0.275
NP_442256.1_2 Reverse -361 -379 2.77242 0.107
NP_442256.1_2 Forward -374 -356 -8.14232 0.217
NP_440437.1_1 Forward -378 -359 0.0977854 0.172
NP_442500.1_8 Forward -356 -342 17.3124 0.137
NP_442500.1_8 Reverse -200 -214 9.31072 0.285
NP_440375.1_8 Reverse -364 -383 -1.08219 0.277
NP_441644.1_6 Forward -372 -362 17.3841 0.00127
NP_441644.1_6 Reverse -363 -373 15.7125 0.0048
NP_442215.1_2 Reverse -361 -377 10.0883 0.0514
NP_440253.1_2 Forward -372 -354 13.5888 0.0219
NP_440929.1_8 Forward -372 -363 19.2726 0.000701
NP_440929.1_8 Reverse -363 -372 19.2726 0.000701
NP_442933.1_1 Reverse -343 -362 10.1695 0.253
NP_442933.1_10 Forward -372 -363 17.601 0.00325
NP_442933.1_10 Reverse -363 -372 17.601 0.00325
NP_441751.2_8 Forward -371 -357 -4.52363 0.174
NP_441751.2_8 Reverse -364 -378 -5.21195 0.199
NP_442554.1_8 Reverse -364 -374 16.9913 0.0065
NP_442554.1_8 Forward -371 -361 16.2046 0.0065
NP_442554.1_8 Reverse -224 -234 1.94665 0.288
NP_441586.1_6 Forward -40 -21 9.14423 0.277
NP_441762.1_7 Reverse -362 -374 2.59558 0.0676
NP_441762.1_7 Forward -373 -361 1.80894 0.0735
NP_442142.1_4 Forward -375 -362 11.9167 0.0504
NP_442292.1_1 Forward -371 -362 18.486 0.00229
NP_442292.1_1 Reverse -364 -373 9.53783 0.0183
NP_442381.1_8 Forward -375 -356 4.42435 0.0708
NP_441711.1_4 Forward -381 -362 15.4374 0.0469
NP_443009.1_5 Reverse -362 -373 15.7911 0.0107
NP_443009.1_5 Forward -373 -362 11.1696 0.066
NP_441715.1_4 Forward -371 -361 17.3846 0.0106
NP_441198.1_8 Forward -374 -364 15.2245 0.0427
NP_441468.1_1 Forward -371 -364 15.8704 0.0124
NP_441468.1_1 Reverse -364 -371 15.8704 0.0124
NP_441468.1_1 Reverse -224 -231 10.9539 0.0726
NP_441020.2_6 Reverse -361 -378 7.90532 0.215
NP_441673.1_1 Forward -372 -363 20.8459 0.000698
NP_441673.1_1 Reverse -363 -372 20.8459 0.000698
NP_441826.1_2 Forward -378 -364 14.9459 0.0196
NP_441826.1_2 Reverse -381 -395 -0.0987402 0.204
NP_441826.1_5 Forward -152 -133 3.73603 0.259
NP_442868.1_6 Reverse -361 -371 19.2529 0.00563
NP_442868.1_6 Forward -374 -364 16.7946 0.0131
NP_442719.1_2 Forward -396 -378 -0.866561 0.173
NP_441612.1_2 Forward -372 -362 8.54929 0.21
NP_441911.1_10 Forward -360 -341 8.75181 0.25
NP_441911.1_10 Forward -357 -338 6.92008 0.289
NP_442808.1_1 Forward -373 -363 8.73102 0.0481
NP_442808.1_1 Reverse -362 -372 8.63269 0.0481
NP_442808.1_1 Forward -199 -189 3.51951 0.238
NP_442542.1_2 Forward -374 -361 20.6688 0.00569
NP_442050.1_5 Forward -374 -364 14.9258 0.0175
NP_442050.1_5 Reverse -361 -371 14.3359 0.0206
NP_440558.1_2 Reverse -330 -349 -6.49039 0.275
NP_441878.1_6 Forward -373 -363 20.2362 0.0046
NP_441878.1_6 Reverse -362 -372 10.4031 0.0176
NP_441878.1_6 Reverse -188 -198 -7.68978 0.255
NP_441036.1_8 Forward -373 -363 8.4365 0.174
NP_441036.1_8 Reverse -362 -372 8.33817 0.174
NP_441557.1_5 Forward -372 -363 19.9609 0.000699
NP_441557.1_5 Reverse -363 -372 19.9609 0.000699
NP_442066.2_4 Reverse -363 -382 10.4225 0.0664
NP_442066.2_9 Reverse -359 -372 10.639 0.154
NP_441433.1_8 Forward -287 -268 -1.47551 0.258
NP_440101.1_10 Forward -399 -380 1.76941 0.28
NP_442183.1_1 Reverse -363 -377 10.3243 0.0857
NP_440829.1_7 Forward -341 -327 22.6157 0.0154
NP_441549.1_9 Reverse -359 -377 -6.96235 0.206
NP_442347.1_2 Forward -371 -362 12.4878 0.056
NP_442347.1_2 Reverse -364 -373 3.34298 0.284
NP_442347.1_2 Reverse -126 -135 3.04799 0.289
NP_441037.1_4 Forward -374 -364 18.9151 0.00351
NP_442594.1_8 Reverse -78 -97 1.57275 0.299
NP_442594.1_10 Reverse -339 -358 8.84842 0.28
NP_441633.1_3 Reverse -361 -374 22.6354 0.00371
NP_440136.1_2 Forward -371 -364 15.9687 0.0123
NP_440136.1_2 Reverse -364 -371 15.9687 0.0123
NP_442998.1_10 Forward -370 -363 15.5754 0.0102
NP_442998.1_10 Reverse -365 -372 15.5754 0.0102
NP_440299.1_1 Reverse -359 -372 11.0318 0.0529
NP_440299.1_1 Forward -376 -363 10.3434 0.0573
NP_441799.1_1 Forward -236 -222 5.89884 0.19
NP_441799.1_1 Forward -376 -362 4.71887 0.238
NP_441799.1_1 Reverse -359 -373 4.71887 0.238
NP_441007.1_10 Forward -377 -364 10.7374 0.0646
NP_442334.1_1 Forward -384 -365 -6.1954 0.268
NP_442334.1_2 Reverse -377 -394 -7.82764 0.297
NP_442201.1_10 Forward -383 -364 -14.8485 0.291
NP_440256.1_1 Reverse -360 -379 -7.27704 0.232
NP_440256.1_1 Forward -375 -356 -8.85033 0.268
NP_440256.1_1 Reverse -301 -320 -9.83364 0.289
NP_441559.1_8 Reverse -358 -372 -5.80194 0.27
NP_440915.1_6 Forward -376 -362 15.9292 0.0183
NP_440915.1_6 Reverse -359 -373 8.55439 0.0533
NP_440717.1_1 Reverse -364 -383 17.6007 0.1
NP_441704.1_8 Reverse -352 -371 9.53674 0.179
NP_441939.1_3 Reverse -364 -383 6.78429 0.222
NP_441494.1_6 Reverse -328 -341 16.6372 0.102
NP_441494.1_6 Forward -377 -364 8.9674 0.227
NP_442386.1_9 Reverse -362 -371 13.8639 0.0289
NP_442386.1_9 Forward -373 -364 6.39082 0.219
NP_441340.1_5 Forward -371 -364 15.6737 0.0124
NP_441340.1_5 Reverse -364 -371 15.6737 0.0124
NP_441952.1_3 Reverse -360 -379 15.7324 0.25
NP_440161.1_3 Forward -374 -355 8.75091 0.264
NP_441160.1_1 Forward -350 -331 -11.9969 0.295
NP_440586.1_8 Forward -371 -364 13.2151 0.026
NP_440586.1_8 Reverse -364 -371 13.2151 0.026
NP_440586.1_8 Forward -133 -126 12.6251 0.0546
NP_442251.1_6 Forward -371 -364 15.2804 0.0124
NP_442251.1_6 Reverse -364 -371 15.2804 0.0124
NP_441262.1_3 Reverse -363 -370 14.7888 0.0223
NP_441262.1_3 Forward -372 -365 14.7888 0.0223
NP_441262.1_3 Forward -134 -127 5.15232 0.265
NP_443051.1_1 Forward -373 -364 18.0926 0.00402
NP_443051.1_1 Reverse -362 -371 10.4228 0.00754
NP_440451.1_10 Reverse -364 -383 9.14342 0.264
NP_439937.1_9 Reverse -362 -379 -16.2847 0.287
NP_442294.1_3 Reverse -12 -26 14.8469 0.215
NP_441595.1_5 Forward -379 -361 5.32902 0.259
NP_442374.1_3 Reverse -64 -81 19.9017 0.156
NP_440439.1_1 Reverse -360 -373 3.85419 0.109
NP_439943.1_7 Reverse -93 -112 4.71934 0.278
NP_440372.1_2 Forward -371 -364 16.3621 0.0124
NP_440372.1_2 Reverse -364 -371 16.3621 0.0124
NP_440819.1_5 Reverse -176 -184 7.8859 0.266
NP_439977.1_5 Reverse -357 -376 9.53756 0.0937
NP_440139.1_1 Reverse -357 -376 4.22689 0.189
NP_441572.1_7 Forward -378 -359 0.0977854 0.174
NP_441245.1_3 Reverse -151 -170 13.9625 0.181
NP_442384.1_10 Forward -372 -359 12.2123 0.0296
NP_442384.1_10 Reverse -363 -376 4.54251 0.153
NP_442262.1_10 Forward -371 -364 14.1988 0.0123
NP_442262.1_10 Reverse -364 -371 14.1988 0.0123
NP_442262.1_10 Reverse -224 -231 9.47889 0.187
NP_441689.1_5 Reverse -361 -371 5.78111 0.197
NP_441814.1_5 Forward -174 -155 8.06259 0.249
NP_440163.1_10 Reverse -83 -93 8.92815 0.256
NP_440344.1_10 Forward -379 -362 8.59364 0.0102
NP_440531.1_6 Forward -380 -361 2.85105 0.15
NP_440531.1_6 Forward -321 -302 -5.31042 0.296
NP_440562.1_10 Reverse -354 -372 7.00065 0.284
NP_440297.1_9 Reverse -364 -374 9.51814 0.0917
NP_440297.1_9 Forward -231 -221 0.0783647 0.282
NP_440297.1_9 Forward -371 -361 -0.118297 0.282
NP_440350.1_5 Reverse -335 -354 -7.27704 0.299
NP_442280.1_1 Reverse -363 -382 8.06259 0.162
NP_441896.1_3 Reverse -354 -373 -3.04881 0.294
NP_440894.1_10 Reverse -61 -80 6.78429 0.211
NP_440999.1_9 Forward -376 -362 13.9626 0.028
NP_440999.1_9 Reverse -139 -153 2.5562 0.148
NP_440888.1_2 Forward -372 -358 16.1252 0.00789
NP_440888.1_2 Reverse -363 -377 13.077 0.0339
NP_440888.1_2 Reverse -333 -347 6.19383 0.243
NP_439969.1_3 Forward -377 -358 3.34271 0.237
NP_441543.1_2 Forward -371 -362 16.9127 0.00359
NP_441543.1_2 Reverse -364 -373 9.34117 0.0818
NP_441543.1_2 Forward -133 -124 8.94785 0.0968
NP_440380.1_1 Forward -158 -139 -10.0303 0.271
NP_440380.1_5 Forward -347 -328 3.14605 0.299
NP_441319.1_8 Reverse -357 -375 4.44404 0.297
NP_441469.1_8 Reverse -222 -231 13.4711 0.073
NP_441469.1_8 Forward -373 -364 13.3727 0.073
NP_441469.1_8 Reverse -362 -371 6.48957 0.227
NP_443064.1_6 Reverse -363 -373 13.8273 0.0796
NP_443064.1_6 Forward -372 -362 12.5669 0.0796
NP_443064.1_6 Reverse -102 -112 9.27034 0.234
NP_442337.1_8 Reverse -268 -287 0.491109 0.251
NP_442578.1_7 Forward -371 -364 14.5921 0.026
NP_442578.1_7 Reverse -364 -371 14.5921 0.026
NP_442578.1_7 Forward -133 -126 12.6255 0.0418
NP_440710.1_1 Reverse -355 -373 -6.4707 0.225
NP_441462.1_2 Reverse -363 -373 20.1379 0.000967
NP_441462.1_2 Forward -372 -362 11.5831 0.00406
NP_441621.1_7 Forward -374 -360 -4.7203 0.242
NP_443062.1_1 Reverse -363 -381 9.03346 0.142
NP_443062.1_6 Reverse -355 -374 0.294447 0.299
NP_442204.1_5 Forward -382 -363 9.24257 0.105
NP_441560.1_8 Reverse -141 -160 11.9996 0.268
NP_441560.1_10 Forward -380 -361 7.86593 0.272
NP_440516.1_8 Forward -372 -363 16.9127 0.00442
NP_440516.1_8 Reverse -363 -372 16.9127 0.00442
NP_442428.1_4 Reverse -362 -381 2.75272 0.248
NP_442428.1_5 Forward -371 -364 15.8704 0.0124
NP_442428.1_5 Reverse -364 -371 15.8704 0.0124
NP_442428.1_5 Reverse -224 -231 4.66067 0.244
NP_441790.1_3 Reverse -364 -383 -4.52377 0.291
NP_441267.1_1 Reverse -357 -376 0.58944 0.281
NP_440673.1_3 Forward -370 -363 12.4288 0.0426
NP_440673.1_3 Reverse -365 -372 12.4288 0.0426
NP_440673.1_7 Forward -383 -364 15.8307 0.0874
NP_441052.1_2 Forward -372 -362 19.9412 0.00106
NP_441052.1_2 Reverse -363 -373 10.4031 0.0285
NP_442219.1_9 Forward -371 -362 17.7976 0.00718
NP_442219.1_9 Reverse -364 -373 8.25953 0.0681
NP_440436.1_4 Forward -371 -362 17.2072 0.00233
NP_440436.1_4 Reverse -364 -373 15.9289 0.00508
NP_440436.1_4 Forward -37 -28 6.19416 0.167
NP_441884.1_9 Forward -375 -356 -3.63879 0.0594
NP_441884.1_9 Reverse -360 -379 -22.6167 0.281
NP_440648.1_1 Reverse -363 -382 6.98095 0.19
NP_441719.1_4 Forward -371 -364 16.3621 0.0124
NP_441719.1_4 Reverse -364 -371 16.3621 0.0124
NP_441719.1_4 Forward -133 -126 3.77569 0.285
NP_441733.1_10 Forward -375 -362 10.049 0.106
NP_441733.1_10 Reverse -360 -373 5.32916 0.218
NP_441004.1_3 Reverse -83 -102 2.75272 0.265
NP_441004.1_4 Forward -182 -172 8.92815 0.262
NP_441004.1_5 Reverse -374 -388 7.66941 0.284
NP_442366.1_1 Reverse -6 -19 15.2606 0.272
NP_442873.1_3 Forward -382 -363 9.63507 0.182
NP_440296.1_10 Forward -375 -356 -13.5702 0.269
NP_441115.1_4 Reverse -362 -380 10.5398 0.173
NP_443054.1_2 Reverse -361 -375 17.5025 0.0359
NP_442430.1_10 Forward -382 -363 11.0117 0.257
NP_442308.1_4 Reverse -137 -156 1.76941 0.267
NP_441851.1_10 Forward -373 -363 17.4829 0.0027
NP_441851.1_10 Reverse -362 -372 15.8113 0.00552
NP_441851.1_10 Reverse -222 -232 4.89658 0.24
NP_442515.1_1 Forward -373 -359 18.9775 0.0192
NP_442515.1_1 Reverse -362 -376 7.17775 0.0939
NP_441396.1_5 Reverse -81 -90 7.47288 0.252
NP_441982.1_6 Forward -48 -39 15.2546 0.274
NP_440940.1_7 Forward -382 -364 8.08151 0.191
NP_441349.1_10 Reverse -353 -372 -9.047 0.281
NP_440432.1_9 Reverse -364 -379 16.8928 0.00961
NP_440432.1_9 Forward -371 -356 8.04304 0.0427
NP_439960.1_10 Reverse -369 -387 -2.53746 0.255
NP_442450.1_5 Forward -374 -364 10.1081 0.115
NP_440195.1_5 Forward -378 -359 2.3594 0.276
NP_440943.1_4 Reverse -170 -182 15.3786 0.189
NP_441450.1_3 Reverse -341 -360 7.57013 0.257
NP_441570.1_1 Reverse -363 -381 -0.275845 0.0447
NP_441570.1_1 Forward -372 -354 -16.4021 0.245
NP_441078.1_4 Forward -372 -363 19.6659 0.0007
NP_441078.1_4 Reverse -363 -372 19.6659 0.0007
NP_442729.1_8 Forward -376 -363 9.06573 0.125
NP_442443.1_4 Reverse -226 -236 12.7626 0.291
NP_440526.1_3 Reverse -364 -375 20.7076 0.0073
NP_440526.1_3 Forward -371 -360 1.04151 0.267
NP_441432.1_8 Reverse -362 -371 16.8143 0.00595
NP_441432.1_8 Forward -373 -364 8.35786 0.0755
NP_441432.1_9 Reverse -342 -355 11.3132 0.232
NP_442320.1_8 Forward -378 -364 5.60446 0.0334
NP_442320.1_8 Reverse -357 -371 -3.34366 0.117
NP_442320.1_8 Reverse -119 -133 -4.4253 0.168
NP_441732.1_2 Forward -376 -360 -15.0844 0.145
NP_440629.1_4 Forward -285 -266 9.3409 0.255
NP_442003.1_4 Reverse -364 -383 11.7992 0.272
NP_442003.1_7 Reverse -203 -221 17.3616 0.223
NP_440760.1_1 Reverse -363 -382 -11.3086 0.0851
NP_440760.1_1 Forward -372 -353 -15.8318 0.157
NP_440760.1_1 Forward -134 -115 -17.6018 0.202
NP_440913.1_1 Reverse -361 -379 20.3737 0.0707
NP_442489.1_2 Reverse -352 -371 2.0644 0.278
NP_442489.1_7 Forward -372 -363 20.1576 0.000695
NP_442489.1_7 Reverse -363 -372 20.1576 0.000695
NP_440559.1_1 Forward -371 -362 17.4043 0.00658
NP_440559.1_1 Reverse -364 -373 17.306 0.00658
NP_440559.1_1 Forward -133 -124 4.71961 0.217
NP_441659.2_8 Reverse -363 -373 19.3512 0.000966
NP_441659.2_8 Forward -372 -362 18.1713 0.00133
NP_442913.1_10 Forward -381 -362 21.6323 0.0136
NP_440708.1_6 Forward -196 -177 2.26107 0.179
NP_440779.1_5 Reverse -363 -380 -4.28772 0.11
NP_440779.1_5 Forward -372 -355 -14.2191 0.243
NP_442346.1_5 Forward -373 -363 17.9746 0.00128
NP_442346.1_5 Reverse -362 -372 16.6963 0.00248
NP_442346.1_5 Reverse -188 -198 7.64985 0.162
NP_440352.1_5 Forward -76 -57 11.4877 0.257
NP_440545.1_3 Reverse -359 -376 -1.92778 0.177
NP_440025.1_3 Reverse -41 -55 10.1267 0.29
NP_441126.1_6 Forward -70 -56 13.6618 0.295
NP_442603.1_7 Reverse -363 -377 11.5037 0.115
NP_442603.1_7 Forward -372 -358 10.1271 0.133
NP_441585.1_5 Forward -324 -305 -1.18128 0.298
NP_441888.1_9 Forward -313 -294 13.775 0.289
NP_440449.1_6 Forward -380 -362 13.2163 0.105
NP_441948.1_4 Reverse -356 -374 6.50899 0.0633
NP_441833.1_4 Forward -371 -364 15.9687 0.0124
NP_441833.1_4 Reverse -364 -371 15.9687 0.0124
NP_442799.1_2 Reverse -61 -80 11.1109 0.141
NP_441329.1_6 Forward -355 -336 -1.57604 0.293
NP_441329.1_6 Forward -56 -37 -1.57604 0.293
NP_442162.1_9 Forward -371 -364 16.2637 0.0124
NP_442162.1_9 Reverse -364 -371 16.2637 0.0124
NP_442140.1_3 Reverse -364 -374 14.828 0.0433
NP_442140.1_3 Forward -371 -361 10.3048 0.0902
NP_440875.1_9 Reverse -365 -375 8.5667 0.233
NP_441813.1_5 Reverse -361 -371 18.1713 0.00743
NP_441813.1_5 Forward -374 -364 8.92815 0.0347
NP_440590.1_4 Reverse -364 -377 12.704 0.013
NP_440590.1_4 Forward -371 -358 11.6223 0.019
NP_440567.1_1 Reverse -364 -378 16.2242 0.0166
NP_442497.1_10 Reverse -364 -373 19.8626 0.00532
NP_442497.1_10 Forward -371 -362 10.4228 0.0087
NP_440821.1_4 Forward -374 -364 19.5479 0.00399
NP_440821.1_4 Reverse -361 -371 9.41981 0.0286
NP_440821.1_4 Reverse -221 -231 -0.806614 0.296
NP_441239.1_9 Forward -374 -362 14.4936 0.0272
NP_441239.1_9 Reverse -361 -373 8.79043 0.122
NP_441239.1_9 Forward -344 -332 6.23383 0.197
NP_441239.1_9 Reverse -221 -233 4.5622 0.251
NP_441009.1_4 Reverse -363 -382 9.63589 0.298
NP_440624.1_5 Reverse -6 -24 9.20989 0.252
NP_441892.1_1 Forward -381 -364 13.3135 0.0401
NP_440604.1_6 Reverse -363 -382 8.75091 0.0797
NP_442044.1_9 Reverse -363 -382 8.55425 0.163
NP_440546.1_4 Reverse -363 -373 12.8578 0.0572
NP_440546.1_4 Forward -372 -362 10.046 0.109
NP_440546.1_4 Forward -82 -72 8.6886 0.176
NP_440675.1_1 Reverse -360 -379 2.65439 0.262
NP_440462.1_4 Reverse -79 -93 6.78443 0.278
NP_440462.1_6 Forward -374 -364 10.4031 0.0396
NP_440462.1_6 Reverse -361 -371 9.61647 0.0429
NP_440868.1_4 Reverse -359 -371 7.70879 0.0648
NP_441249.1_8 Reverse -80 -99 8.45592 0.19
NP_442402.1_4 Forward -194 -175 -5.01617 0.234
NP_441084.1_6 Forward -374 -360 9.92586 0.257
NP_440696.1_6 Reverse -61 -80 6.19431 0.266
NP_442039.1_4 Forward -371 -364 15.1821 0.0124
NP_442039.1_4 Reverse -364 -371 15.1821 0.0124
NP_441811.1_8 Reverse -119 -133 14.8476 0.162
NP_442679.1_1 Forward -358 -339 -0.197208 0.217
NP_440825.1_7 Reverse -126 -136 15.0567 0.152
NP_442837.1_3 Forward -371 -364 15.7721 0.0124
NP_442837.1_3 Reverse -364 -371 15.7721 0.0124
NP_442837.1_3 Reverse -126 -133 9.87221 0.106
NP_440160.1_3 Forward -330 -311 10.7167 0.209
NP_440160.1_3 Reverse -292 -311 10.7167 0.209
NP_442053.1_1 Forward -372 -363 18.3876 0.0007
NP_442053.1_1 Reverse -363 -372 18.3876 0.0007
NP_440505.1_3 Reverse -361 -371 18.3679 0.00213
NP_440505.1_3 Forward -374 -364 7.84651 0.147
NP_441536.1_4 Forward -352 -334 10.0489 0.187
NP_440914.1_1 Forward -372 -362 17.5935 0.000537
NP_440914.1_1 Reverse -363 -373 8.51751 0.186
NP_441011.1_8 Reverse -364 -373 14.356 0.0249
NP_441011.1_8 Forward -371 -362 8.25953 0.144
NP_442533.1_6 Forward -372 -363 17.2076 0.00137
NP_442533.1_6 Reverse -363 -372 17.2076 0.00137
NP_442533.1_6 Reverse -286 -295 2.65466 0.246
NP_441482.1_7 Forward -378 -364 -8.35854 0.193
NP_441482.1_7 Reverse -357 -371 -12.2918 0.292
NP_439944.1_9 Reverse -364 -374 17.4829 0.00423
NP_439944.1_9 Forward -371 -361 10.5014 0.0887
NP_441028.1_6 Reverse -350 -360 4.20782 0.278
NP_440116.1_8 Reverse -364 -383 -0.295539 0.106
NP_441527.1_4 Forward -355 -336 17.9998 0.0458
NP_441527.1_4 Forward -361 -342 -9.50187 0.259
NP_441527.1_4 Forward -358 -339 -12.8441 0.294
NP_441527.1_4 Forward -354 -335 -12.9396 0.296
NP_441527.1_8 Reverse -120 -139 17.109 0.0697
NP_440115.1_6 Forward -375 -365 10.1081 0.115
NP_440115.1_6 Reverse -360 -370 6.76487 0.167
NP_440007.1_9 Forward -376 -362 3.73617 0.267
NP_441680.1_4 Forward -332 -313 -2.26216 0.267
NP_441059.1_4 Reverse -193 -212 7.07928 0.281
NP_441602.1_3 Reverse -358 -377 5.89931 0.141
NP_441602.1_4 Forward -324 -305 8.45592 0.29
NP_441972.1_5 Reverse -364 -383 -1.57384 0.177
NP_441106.1_1 Forward -373 -364 9.73449 0.0311
NP_441106.1_1 Reverse -362 -371 9.63616 0.0311
NP_440429.1_2 Reverse -358 -377 8.16093 0.274
NP_442306.1_10 Reverse -358 -377 -20.0601 0.202
NP_441286.1_1 Reverse -362 -374 24.2284 0.000758
NP_441286.1_1 Forward -373 -361 3.48056 0.0467
NP_442674.1_3 Forward -380 -361 4.62021 0.288
NP_440670.1_8 Forward -372 -363 18.3876 0.000699
NP_440670.1_8 Reverse -363 -372 18.3876 0.000699
NP_440886.1_7 Forward -373 -363 8.04271 0.0805
NP_440886.1_7 Reverse -362 -372 7.94438 0.0805
NP_440886.1_7 Forward -90 -80 4.60114 0.227
NP_442614.1_2 Reverse -363 -377 6.29277 0.291
NP_439995.1_5 Forward -382 -363 6.39097 0.276
NP_440404.1_1 Forward -308 -289 10.8159 0.285
NP_442072.1_9 Reverse -362 -380 -2.3408 0.0317
NP_441753.1_10 Forward -381 -362 12.2908 0.106
NP_442022.1_4 Reverse -315 -334 13.6675 0.166
NP_440907.2_8 Reverse -364 -374 19.449 0.00351
NP_441021.1_1 Reverse -364 -383 -8.752 0.2
NP_440841.1_4 Forward -374 -355 2.94938 0.0964
NP_442459.1_7 Reverse -334 -353 0.294447 0.272
NP_441463.1_3 Forward -48 -29 -5.80207 0.232
NP_441626.1_2 Forward -371 -364 15.7721 0.0124
NP_441626.1_2 Reverse -364 -371 15.7721 0.0124
NP_442365.1_5 Reverse -364 -383 6.29264 0.29
NP_441460.1_5 Forward -212 -198 14.3553 0.258
NP_442794.1_1 Reverse -359 -371 7.4138 0.138
NP_442615.1_1 Reverse -354 -372 3.75572 0.0518
NP_441962.1_4 Forward -377 -358 -11.2103 0.238
NP_440387.1_1 Reverse -363 -379 -0.334789 0.137
NP_440387.1_1 Forward -134 -118 -6.13632 0.268
NP_441963.1_8 Forward -150 -131 15.7316 0.131
NP_441431.1_2 Reverse -330 -344 9.04542 0.198
NP_441431.1_2 Forward -375 -361 6.88214 0.257
NP_441488.1_7 Reverse -357 -376 5.211 0.163
NP_441836.1_1 Reverse -352 -371 12.1811 0.263
NP_441836.1_2 Reverse -357 -376 -3.44213 0.238
NP_441993.1_1 Forward -378 -359 8.18396 0.151
NP_441993.1_1 Reverse -363 -382 6.81956 0.177
NP_440114.1_10 Reverse -363 -377 8.84938 0.192
NP_440492.1_4 Reverse -204 -223 14.664 0.212
NP_440766.1_4 Forward -376 -362 8.45605 0.0871
NP_441421.1_9 Reverse -202 -221 3.44104 0.226
NP_441237.1_9 Reverse -364 -374 17.2863 0.00348
NP_441246.1_7 Reverse -4 -23 7.17762 0.199
NP_442867.1_8 Forward -387 -368 7.17762 0.244
NP_440457.1_1 Forward -376 -364 15.1819 0.0611
NP_440457.1_1 Reverse -359 -371 -0.649339 0.271
NP_440798.1_6 Reverse -364 -377 3.26421 0.151
NP_442680.1_5 Forward -361 -342 6.12904 0.213
NP_442680.1_5 Forward -359 -340 -0.709294 0.292
NP_440801.1_8 Forward -373 -354 -0.000545616 0.262
NP_441984.1_3 Reverse -359 -377 15.9488 0.117
NP_441436.1_6 Reverse -363 -382 7.07928 0.26
NP_440473.1_9 Forward -383 -364 -7.86702 0.24
NP_442509.1_9 Reverse -363 -373 17.3841 0.00128
NP_442509.1_9 Forward -372 -362 8.14104 0.192
NP_441489.1_3 Forward -51 -37 6.79155 0.296
NP_440554.1_4 Forward -371 -361 8.92815 0.0646
NP_440554.1_4 Reverse -364 -374 6.27322 0.123
NP_440554.1_4 Forward -231 -221 3.12662 0.242
NP_441885.1_5 Forward -372 -362 20.9245 0.000538
NP_441885.1_5 Reverse -363 -373 11.3864 0.00668
NP_440478.1_10 Forward -374 -360 8.25939 0.257
NP_442341.1_7 Reverse -362 -376 19.0758 0.00893
NP_441756.1_5 Forward -376 -357 2.75272 0.206
NP_440423.1_6 Forward -380 -361 -12.9802 0.204
NP_443000.1_7 Reverse -361 -371 19.9412 0.00223
NP_443000.1_7 Forward -374 -364 2.14332 0.226
NP_441842.1_10 Forward -379 -365 11.8976 0.115
NP_440275.1_3 Forward -374 -364 19.5479 0.00756
NP_440275.1_3 Reverse -361 -371 15.123 0.0182
NP_440091.1_1 Forward -376 -364 3.2839 0.163
NP_440091.1_1 Reverse -359 -371 -0.452677 0.273
NP_442451.1_2 Reverse -355 -374 -7.27704 0.232
NP_442451.1_2 Forward -350 -331 -10.817 0.28
NP_440149.1_8 Forward -372 -353 -5.99873 0.238
NP_440149.1_8 Forward -274 -255 -6.09707 0.24
NP_441105.1_3 Forward -383 -364 -3.73712 0.185
NP_440216.1_1 Reverse -363 -377 8.25939 0.0061
NP_440216.1_1 Forward -372 -358 7.07942 0.01
NP_440172.1_1 Reverse -363 -373 16.303 0.00854
NP_440172.1_1 Forward -372 -362 15.0247 0.00945
NP_442015.1_10 Forward -376 -363 4.54251 0.167
NP_442015.1_10 Reverse -359 -372 2.77255 0.187
NP_441226.1_7 Forward -371 -364 14.4934 0.0123
NP_441226.1_7 Reverse -364 -371 14.4934 0.0123
NP_441226.1_7 Reverse -171 -178 6.82361 0.246
NP_442834.1_9 Reverse -369 -388 5.211 0.268
NP_441111.1_7 Forward -371 -363 18.7023 0.00294
NP_441111.1_7 Reverse -364 -372 18.7023 0.00294
NP_442379.1_10 Forward -379 -362 -0.649475 0.223
NP_441766.1_2 Forward -372 -363 17.5026 0.00297
NP_441766.1_2 Reverse -363 -372 17.5026 0.00297
NP_440416.1_9 Forward -379 -360 -22.0267 0.3
NP_443052.1_8 Forward -382 -363 8.84924 0.023
NP_443052.1_9 Forward -157 -138 -6.58872 0.285
NP_442116.1_2 Forward -325 -306 13.6666 0.289
NP_442154.1_1 Reverse -78 -96 -17.1888 0.249
NP_440261.1_5 Reverse -364 -377 8.67241 0.0244
NP_440261.1_5 Forward -371 -358 -4.50394 0.151
NP_440988.1_10 Forward -264 -250 4.60839 0.258
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAGGAGCCTTGACCACTCTCCACCCAGGGGCGATCGCCAGATAGGAAAAAAGAGCAGAAGAAATGGCTCCGACTACCAACCCGGACAAGCGTTGGATGAGTTAGAAGTCTTGGCCCACAGCAATTCAGAAAATACTATCGTTGCGGCCAGCTAAAAAACACGCATTTTAGCCATCTCAGTCCATACTTTTGATGATTTTCTCGACCATAACCCTGATTTTGCCCGACGGGTTTTGGAATTAGAACGTCGGCAGTTACAGCGGTTTGTGCGATCAATACAGCCCCTTTAGGCTAATCGATTGAACACTCCACCCCCATAACGCATCGGTCAACATCGGAAAAAGTATAGAATATGGTCAAAAATACGATTGTTAACGGTAAAATTCTAACCCTTTTCCGTA

CDS

GTGACAATGAATCCTCTCCCATTACAGAAGGAAGCAGAGAAACGCTCGCCAAGGCTTAATTCCCCATTTAAGTCACTAATGCGAATCCATTGGTGGATGGCCCTTGCCTATCTAATAGTTTTTTGCACTGGAACTTTAATGGTTAACTTAGAAAGGGGACAATTTTTACGCAGTGAACTATACGACTTCCACAAATCCATCGGTATATTAACCATGGCATTATTAACCTGGCGAATTTTCACCCTCTTACAGGTTTGGTGGCGTAAATATACTAAACGTCCCCCAAAGTTATCTCTGGCTTGGTGGCGCACCTTTACTCTCCACCTGAGCCTATATGTATTTATGGGAGTGATCCCAATTTCTGGCTTTTTACTCTCAAATTCCTTTAAAGCTAATAATGTCAGATTTTTCTCCATCACATTGCCCGATATTTTTCCCCAAAACGAAGCCATGGTAGAAATTGGCCGTAATGCCCATTTTTGGTTAGCTTATACTTTTCTAATTTTTATCTTTATACATATGCTAACTTACTGGAAAGTAATCAGGGCTAATTGGCGACGGTGGGTCAACTTTATCGGTAAATTTCAACAGCAGACCTAA

Protein

MTMNPLPLQKEAEKRSPRLNSPFKSLMRIHWWMALAYLIVFCTGTLMVNLERGQFLRSELYDFHKSIGILTMALLTWRIFTLLQVWWRKYTKRPPKLSLAWWRTFTLHLSLYVFMGVIPISGFLLSNSFKANNVRFFSITLPDIFPQNEAMVEIGRNAHFWLAYTFLIFIFIHMLTYWKVIRANWRRWVNFIGKFQQQT