Your browser is old and dusty. Try Google Chrome!

Details for slr1440

ORF slr1440
Accession NP_440868.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -234 -248 8.06273 0.0937
NP_441061.1_2 Reverse -367 -381 -0.295402 0.227
NP_441061.1_2 Forward -241 -227 -0.885388 0.242
NP_441061.1_2 Reverse -159 -173 -0.983719 0.246
NP_440795.1_7 Forward -241 -234 14.6904 0.0123
NP_440795.1_7 Reverse -234 -241 14.6904 0.0123
NP_441418.1_6 Forward -242 -223 -20.1584 0.106
NP_441418.1_6 Reverse -233 -252 -21.9284 0.163
NP_441418.1_6 Forward -375 -356 -29.3032 0.221
NP_441418.1_6 Reverse -366 -385 -30.5815 0.286
NP_442291.1_5 Forward -243 -227 1.5335 0.144
NP_441453.1_4 Reverse -233 -241 16.539 0.00633
NP_441453.1_4 Forward -242 -234 16.539 0.00633
NP_441453.1_4 Forward -375 -367 14.7691 0.0119
NP_441453.1_4 Reverse -366 -374 6.80426 0.121
NP_441453.1_4 Forward -173 -165 4.24765 0.259
NP_441453.1_7 Forward -310 -303 12.9205 0.23
NP_442151.1_6 Reverse -164 -178 12.3893 0.0749
NP_442151.1_6 Forward -242 -228 7.9644 0.184
NP_442151.1_6 Reverse -233 -247 5.40779 0.278
NP_440561.1_8 Forward -181 -162 7.27595 0.282
NP_441818.1_1 Forward -374 -363 14.4145 0.0502
NP_441818.1_1 Forward -241 -230 9.69459 0.232
NP_441818.1_1 Reverse -2 -13 8.51463 0.288
NP_441818.1_9 Forward -84 -65 -11.0136 0.3
NP_440226.1_1 Forward -242 -223 9.43923 0.0726
NP_440226.1_1 Reverse -233 -252 7.66927 0.102
NP_441465.1_8 Forward -246 -228 5.42735 0.289
NP_440150.1_6 Forward -157 -138 0.982764 0.295
NP_440996.1_3 Forward -255 -237 17.0304 0.114
NP_442744.1_8 Reverse -257 -276 -2.85214 0.297
NP_442173.1_1 Forward -241 -233 15.4574 0.00633
NP_442173.1_1 Reverse -234 -242 15.4574 0.00633
NP_442173.1_1 Forward -374 -366 12.0158 0.0316
NP_442173.1_1 Reverse -367 -375 12.0158 0.0316
NP_442752.1_4 Reverse -366 -373 13.8055 0.0199
NP_442752.1_4 Forward -242 -235 13.8055 0.0199
NP_442752.1_4 Reverse -233 -240 13.8055 0.0199
NP_442752.1_4 Reverse -307 -314 5.84064 0.166
NP_442752.1_4 Forward -154 -147 4.26735 0.293
NP_443027.1_4 Reverse -231 -241 14.828 0.0437
NP_443027.1_4 Forward -244 -234 13.943 0.0452
NP_441812.1_3 Forward -243 -229 14.9459 0.106
NP_441812.1_3 Reverse -232 -246 10.3243 0.222
NP_442975.1_10 Reverse -229 -243 13.8636 0.0459
NP_442975.1_10 Forward -246 -232 3.63724 0.252
NP_441225.1_4 Reverse -65 -84 -12.5869 0.285
NP_440784.1_7 Forward -241 -234 15.9687 0.0123
NP_440784.1_7 Reverse -234 -241 15.9687 0.0123
NP_440784.1_7 Reverse -367 -374 6.23397 0.241
NP_440784.1_7 Forward -374 -367 6.13563 0.241
NP_440061.1_9 Reverse -231 -245 12.3887 0.0971
NP_440061.1_9 Forward -377 -363 11.9953 0.103
NP_440061.1_9 Reverse -143 -157 11.2087 0.116
NP_440110.1_7 Forward -398 -379 11.8975 0.289
NP_441054.1_2 Forward -334 -315 14.9458 0.155
NP_441054.1_4 Forward -252 -234 2.47742 0.169
NP_441054.1_4 Forward -211 -193 0.314141 0.174
NP_442062.1_8 Forward -242 -232 19.4496 0.000558
NP_442062.1_8 Reverse -233 -243 19.4496 0.000558
NP_442062.1_8 Reverse -366 -376 8.23984 0.0793
NP_442062.1_8 Forward -375 -365 7.55152 0.0946
NP_442062.1_8 Forward -154 -144 5.19158 0.181
NP_442062.1_8 Forward -173 -163 4.10993 0.232
NP_441859.1_3 Reverse -232 -251 6.1935 0.182
NP_440304.1_4 Reverse -231 -241 10.8948 0.051
NP_440304.1_4 Forward -244 -234 9.91146 0.051
NP_440304.1_4 Forward -377 -367 9.12481 0.0626
NP_440304.1_4 Forward -12 -2 5.28991 0.218
NP_442242.1_4 Forward -241 -234 14.3954 0.0124
NP_442242.1_4 Reverse -234 -241 14.3954 0.0124
NP_440044.1_8 Forward -241 -222 7.27595 0.0842
NP_442097.1_1 Forward -319 -300 5.60432 0.187
NP_440916.1_1 Reverse -193 -207 10.521 0.206
NP_441208.1_9 Forward -245 -231 6.09611 0.253
NP_440370.1_10 Forward -251 -232 14.3558 0.103
NP_440132.1_1 Reverse -364 -382 7.78729 0.288
NP_442110.1_7 Forward -242 -228 1.86788 0.222
NP_442110.1_7 Reverse -360 -374 0.392915 0.261
NP_442110.1_7 Reverse -233 -247 -0.0987402 0.274
NP_441083.1_5 Forward -375 -365 19.0562 0.00147
NP_441083.1_5 Reverse -366 -376 16.7946 0.00546
NP_441083.1_5 Forward -242 -232 11.3864 0.0159
NP_441083.1_5 Reverse -233 -243 11.3864 0.0159
NP_441083.1_5 Forward -154 -144 8.23984 0.0429
NP_441083.1_5 Reverse -145 -155 0.373358 0.231
NP_442827.1_8 Forward -250 -231 4.42355 0.135
NP_442827.1_8 Reverse -358 -377 3.53858 0.144
NP_441434.1_7 Forward -240 -226 1.96621 0.288
NP_441738.1_2 Forward -373 -366 15.28 0.0102
NP_441738.1_2 Forward -240 -233 15.28 0.0102
NP_441738.1_2 Reverse -235 -242 15.28 0.0102
NP_441738.1_2 Forward -314 -307 8.20023 0.181
NP_441558.1_5 Reverse -231 -250 14.2574 0.0507
NP_441558.1_5 Forward -377 -358 6.39097 0.217
NP_441558.1_5 Reverse -162 -181 5.89931 0.236
NP_440209.1_1 Reverse -233 -241 18.1123 0.00295
NP_440209.1_1 Forward -242 -234 18.1123 0.00295
NP_440209.1_1 Reverse -366 -374 8.57422 0.0425
NP_440209.1_1 Forward -375 -367 8.47588 0.0457
NP_440209.1_1 Reverse -145 -153 5.0343 0.194
NP_442889.1_8 Forward -378 -364 6.58715 0.183
NP_442889.1_8 Reverse -230 -244 4.03056 0.27
NP_440447.1_1 Reverse -243 -261 2.28076 0.285
NP_441713.1_1 Forward -248 -229 -5.9004 0.114
NP_440178.1_7 Reverse -232 -251 -10.227 0.0742
NP_440178.1_7 Forward -243 -224 -14.4552 0.153
NP_440178.1_7 Forward -376 -357 -21.1417 0.213
NP_440178.1_7 Forward -282 -263 -23.01 0.287
NP_441716.1_1 Forward -375 -361 13.0776 0.0689
NP_441716.1_1 Reverse -145 -159 7.9644 0.153
NP_441716.1_1 Forward -173 -159 5.01447 0.243
NP_441716.1_1 Forward -138 -124 4.32615 0.256
NP_442111.1_4 Forward -376 -362 8.65272 0.0709
NP_442111.1_4 Reverse -365 -379 8.35772 0.0758
NP_442111.1_4 Forward -155 -141 4.62115 0.198
NP_442111.1_4 Forward -317 -303 3.44117 0.244
NP_440906.1_5 Forward -241 -234 15.8704 0.0124
NP_440906.1_5 Reverse -234 -241 15.8704 0.0124
NP_440906.1_5 Reverse -367 -374 6.23397 0.234
NP_440906.1_5 Forward -374 -367 6.13563 0.241
NP_440747.1_10 Reverse -363 -375 7.11881 0.00789
NP_440747.1_10 Forward -245 -233 -2.02597 0.0196
NP_440747.1_10 Reverse -230 -242 -2.02597 0.0196
NP_440747.1_10 Forward -157 -145 -2.32097 0.0331
NP_440747.1_10 Reverse -161 -173 -2.81262 0.0713
NP_440747.1_10 Reverse -142 -154 -2.91095 0.0732
NP_440747.1_10 Forward -378 -366 -11.8591 0.161
NP_441130.1_10 Reverse -231 -245 20.9441 0.00768
NP_441130.1_10 Forward -377 -363 14.6509 0.0428
NP_441130.1_10 Forward -244 -230 11.2093 0.107
NP_441486.1_1 Reverse -230 -244 11.8976 0.0137
NP_441486.1_1 Forward -245 -231 10.3243 0.0209
NP_441486.1_1 Reverse -363 -377 3.04785 0.0689
NP_441880.2_10 Reverse -234 -252 14.4738 0.111
NP_442634.1_4 Forward -244 -230 -3.63866 0.161
NP_440403.1_4 Reverse -357 -376 7.7676 0.093
NP_440403.1_10 Reverse -224 -243 4.12936 0.267
NP_440403.1_10 Reverse -299 -318 2.75272 0.279
NP_440842.1_10 Reverse -223 -237 1.76955 0.281
NP_442848.1_1 Reverse -360 -374 -0.885388 0.263
NP_442848.1_1 Forward -248 -234 -3.147 0.263
NP_441012.1_4 Reverse -235 -248 5.72248 0.291
NP_443018.1_3 Forward -241 -234 14.8871 0.0123
NP_443018.1_3 Reverse -234 -241 14.8871 0.0123
NP_443018.1_3 Forward -172 -165 12.5271 0.0523
NP_443018.1_3 Reverse -165 -172 12.5271 0.0523
NP_443018.1_3 Forward -374 -367 11.7405 0.0655
NP_443018.1_3 Reverse -258 -265 8.49558 0.141
NP_443018.1_3 Reverse -367 -374 5.44732 0.193
NP_441316.1_7 Reverse -231 -246 6.17475 0.107
NP_441316.1_7 Reverse -265 -280 -2.8717 0.273
NP_441634.1_8 Reverse -231 -245 12.8809 0.047
NP_441634.1_8 Reverse -162 -176 3.24451 0.154
NP_441634.1_8 Forward -244 -230 -4.32697 0.295
NP_440376.1_1 Forward -242 -233 19.4693 0.000692
NP_440376.1_1 Reverse -233 -242 19.4693 0.000692
NP_440376.1_1 Reverse -366 -375 15.7327 0.00625
NP_440376.1_1 Forward -375 -366 9.63616 0.0385
NP_440376.1_1 Reverse -118 -127 2.458 0.221
NP_440376.1_1 Forward -235 -226 0.589713 0.267
NP_440376.1_1 Forward -154 -145 0.0980582 0.285
NP_440376.1_1 Reverse -145 -154 -0.000272808 0.285
NP_441857.1_5 Forward -249 -231 1.10079 0.299
NP_441857.1_6 Forward -351 -341 16.7946 0.163
NP_441588.1_4 Forward -240 -230 6.96153 0.178
NP_442687.1_7 Forward -243 -233 15.8113 0.0125
NP_442687.1_7 Reverse -232 -242 15.8113 0.0125
NP_442687.1_7 Forward -376 -366 8.73149 0.101
NP_442687.1_7 Reverse -365 -375 6.66654 0.155
NP_442687.1_7 Reverse -77 -87 5.97822 0.179
NP_442687.1_7 Reverse -225 -235 4.0116 0.271
NP_442485.1_3 Reverse -222 -241 4.42435 0.179
NP_440642.1_10 Reverse -55 -69 2.8506 0.277
NP_441013.1_2 Reverse -355 -373 -1.35749 0.282
NP_441422.1_7 Reverse -231 -248 4.85706 0.106
NP_441763.1_10 Forward -253 -234 19.8614 0.0428
NP_441763.1_10 Reverse -303 -322 6.29183 0.269
NP_440360.1_8 Reverse -234 -253 14.6508 0.272
NP_442720.1_8 Reverse -377 -395 8.18062 0.297
NP_442658.1_1 Forward -244 -234 18.7607 0.00222
NP_442658.1_1 Reverse -231 -241 15.9091 0.00966
NP_442658.1_1 Reverse -250 -260 7.25606 0.214
NP_442658.1_1 Forward -377 -367 5.19112 0.28
NP_442658.1_1 Reverse -358 -368 5.09279 0.284
NP_441855.2_4 Forward -383 -364 12.5117 0.194
NP_442205.1_9 Forward -248 -232 -0.924775 0.264
NP_440656.1_8 Reverse -222 -241 -8.85033 0.273
NP_441414.1_9 Reverse -233 -252 6.39097 0.0404
NP_441414.1_9 Reverse -366 -385 -7.86702 0.227
NP_441414.1_9 Reverse -307 -326 -9.73531 0.266
NP_440607.1_5 Forward -90 -71 -1.27885 0.296
NP_441487.1_9 Forward -243 -224 15.4374 0.0454
NP_441256.1_8 Forward -358 -339 4.12936 0.272
NP_439959.1_3 Reverse -221 -240 8.65258 0.299
NP_442937.1_5 Forward -250 -231 7.07928 0.263
NP_442937.1_5 Reverse -361 -380 5.89931 0.295
NP_441958.1_5 Forward -243 -233 12.2714 0.00183
NP_441958.1_5 Reverse -232 -242 12.2714 0.00183
NP_441958.1_5 Forward -376 -366 10.6981 0.0112
NP_441958.1_5 Reverse -365 -375 10.0098 0.0167
NP_441958.1_5 Forward -155 -145 1.35667 0.0987
NP_442486.1_6 Reverse -66 -85 1.76941 0.266
NP_439905.1_1 Reverse -234 -247 20.9638 0.00648
NP_439905.1_1 Forward -374 -361 8.18076 0.236
NP_440984.1_7 Forward -247 -233 12.8809 0.121
NP_440984.1_7 Reverse -228 -242 7.86607 0.161
NP_440984.1_7 Forward -206 -192 4.52282 0.299
NP_441162.1_3 Forward -400 -381 8.16093 0.274
NP_439990.1_5 Reverse -361 -374 5.62415 0.283
NP_439990.1_5 Forward -266 -253 5.52582 0.289
NP_442911.1_2 Forward -252 -233 12.0942 0.0129
NP_442911.1_2 Forward -385 -366 -1.96717 0.092
NP_441580.1_6 Forward -253 -234 -7.17871 0.236
NP_441580.1_6 Reverse -222 -241 -7.67036 0.246
NP_440153.1_5 Forward -374 -360 1.76955 0.245
NP_440153.1_5 Forward -241 -227 1.37622 0.257
NP_442064.1_1 Reverse -52 -71 -9.14533 0.259
NP_442536.1_8 Forward -248 -229 15.3391 0.187
NP_443055.1_6 Reverse -225 -243 2.57501 0.206
NP_443055.1_6 Forward -383 -365 1.39504 0.231
NP_440993.1_2 Reverse -228 -244 9.98996 0.108
NP_440827.1_3 Reverse -297 -316 16.3224 0.161
NP_440602.1_8 Forward -242 -228 17.7975 0.0898
NP_441913.1_3 Forward -349 -336 14.672 0.237
NP_441099.1_5 Reverse -356 -375 -1.67217 0.112
NP_441099.1_5 Reverse -135 -154 -5.60541 0.152
NP_441099.1_5 Forward -252 -233 -8.55534 0.197
NP_441099.1_5 Reverse -143 -162 -10.7186 0.261
NP_442002.1_9 Forward -155 -148 14.1004 0.074
NP_442002.1_9 Forward -11 -4 11.3472 0.185
NP_442002.1_9 Forward -243 -236 10.7572 0.185
NP_442002.1_9 Reverse -232 -239 10.7572 0.185
NP_442598.1_2 Reverse -102 -111 16.5193 0.252
NP_441294.1_7 Reverse -362 -376 9.73057 0.229
NP_441646.1_1 Forward -382 -363 3.6377 0.206
NP_441646.1_1 Forward -288 -269 -1.7705 0.294
NP_441646.1_1 Reverse -56 -75 -1.7705 0.294
NP_441646.1_5 Reverse -124 -143 15.2408 0.291
NP_442438.1_10 Forward -247 -233 13.9626 0.0322
NP_442438.1_10 Reverse -228 -242 9.93102 0.0592
NP_442431.1_10 Forward -90 -72 14.1788 0.0736
NP_441292.1_2 Reverse -355 -374 -4.22878 0.224
NP_441000.1_6 Forward -243 -229 13.2743 0.0396
NP_441000.1_6 Reverse -232 -246 4.12949 0.0992
NP_441000.1_6 Forward -376 -362 2.94952 0.123
NP_441000.1_6 Reverse -74 -88 -0.0987402 0.2
NP_442771.1_1 Forward -244 -226 -5.09406 0.166
NP_442771.1_1 Reverse -364 -382 -5.38906 0.166
NP_440147.1_4 Reverse -231 -244 11.524 0.0326
NP_440147.1_4 Reverse -364 -377 7.19745 0.0736
NP_440147.1_4 Forward -156 -143 5.82081 0.112
NP_440147.1_4 Forward -244 -231 2.08423 0.21
NP_440147.1_4 Forward -377 -364 1.78924 0.22
NP_440147.1_4 Forward -175 -162 -0.767364 0.299
NP_441550.1_8 Forward -377 -367 14.4342 0.0151
NP_441550.1_8 Reverse -364 -374 13.8442 0.0207
NP_441550.1_8 Forward -244 -234 10.501 0.066
NP_441550.1_8 Reverse -231 -241 6.0761 0.214
NP_441916.1_7 Forward -242 -232 18.4663 0.00144
NP_441916.1_7 Reverse -233 -243 18.4663 0.00144
NP_441916.1_7 Reverse -366 -376 7.15819 0.0745
NP_441916.1_7 Reverse -145 -155 3.81494 0.202
NP_441916.1_10 Reverse -300 -319 1.27776 0.268
NP_441041.1_4 Reverse -233 -252 3.6377 0.0638
NP_441041.1_4 Forward -242 -223 -2.85214 0.117
NP_441041.1_7 Reverse -230 -242 10.916 0.0864
NP_441041.1_7 Forward -245 -233 10.2357 0.1
NP_440016.1_9 Reverse -372 -391 9.0459 0.278
NP_442004.1_6 Reverse -233 -247 9.2427 0.14
NP_441725.1_5 Forward -241 -231 11.2881 0.0247
NP_441725.1_5 Reverse -367 -377 11.2881 0.0247
NP_441725.1_5 Reverse -234 -244 9.02648 0.0553
NP_441725.1_5 Reverse -2 -12 0.176696 0.206
NP_439966.1_7 Reverse -231 -241 18.4657 0.00473
NP_439966.1_7 Forward -244 -234 17.4824 0.00636
NP_439966.1_7 Forward -377 -367 8.14104 0.14
NP_439966.1_7 Reverse -364 -374 5.58445 0.216
NP_439966.1_7 Reverse -379 -389 4.50281 0.269
NP_439966.1_9 Forward -244 -235 10.7178 0.0863
NP_439966.1_9 Reverse -231 -240 0.983037 0.253
NP_440736.1_3 Forward -244 -225 -0.295539 0.282
NP_442941.1_3 Forward -241 -231 11.4848 0.0116
NP_442941.1_3 Forward -374 -364 9.41981 0.0319
NP_442941.1_3 Forward -153 -143 6.96153 0.0903
NP_442941.1_3 Reverse -234 -244 2.53664 0.14
NP_442941.1_3 Reverse -367 -377 1.65166 0.147
NP_440289.1_2 Reverse -230 -243 14.6706 0.0107
NP_440289.1_2 Forward -245 -232 3.5592 0.0767
NP_440289.1_2 Forward -378 -365 3.26421 0.0811
NP_440289.1_2 Reverse -363 -376 -3.71729 0.267
NP_440983.1_5 Forward -227 -208 -1.27885 0.228
NP_442281.1_1 Reverse -228 -242 20.0584 0.00217
NP_442281.1_1 Forward -159 -145 7.66879 0.0949
NP_442281.1_1 Forward -247 -233 7.27547 0.104
NP_442281.1_1 Forward -380 -366 2.65393 0.26
NP_442281.1_1 Reverse -247 -261 2.16228 0.276
NP_440437.1_1 Reverse -227 -246 18.879 0.0125
NP_442012.1_1 Forward -248 -229 0.687771 0.235
NP_442049.1_6 Reverse -358 -377 8.06259 0.215
NP_441087.1_6 Forward -317 -299 4.34495 0.258
NP_441457.1_7 Reverse -231 -250 -1.18052 0.293
NP_441556.1_10 Forward -247 -233 15.478 0.144
NP_441556.1_10 Reverse -361 -375 12.4606 0.195
NP_440498.1_1 Forward -251 -233 10.0489 0.0786
NP_440498.1_1 Reverse -224 -242 7.19731 0.0845
NP_442982.1_5 Reverse -297 -316 -1.37718 0.266
NP_442982.1_5 Reverse -223 -242 -3.54046 0.299
NP_443030.1_4 Forward -180 -161 -6.88371 0.291
NP_441644.1_6 Forward -375 -365 17.0891 0.00219
NP_441644.1_6 Forward -173 -163 11.4843 0.0481
NP_441644.1_6 Forward -242 -232 10.1076 0.0628
NP_441644.1_6 Reverse -233 -243 10.1076 0.0628
NP_441644.1_6 Reverse -164 -174 6.27276 0.163
NP_441644.1_6 Reverse -153 -163 6.27276 0.163
NP_441644.1_6 Reverse -366 -376 6.0761 0.167
NP_441644.1_6 Forward -154 -144 4.50281 0.235
NP_440867.1_6 Reverse -72 -91 18.9765 0.112
NP_440867.1_10 Forward -243 -224 10.9142 0.25
NP_442215.1_2 Forward -244 -228 5.17175 0.0796
NP_442215.1_2 Reverse -249 -265 -7.0213 0.284
NP_442029.1_6 Reverse -159 -178 3.14605 0.283
NP_440253.1_2 Forward -375 -357 9.55725 0.0478
NP_440253.1_2 Forward -242 -224 9.16393 0.0507
NP_440253.1_2 Reverse -366 -384 -2.93078 0.28
NP_440929.1_8 Forward -242 -233 19.2726 0.000701
NP_440929.1_8 Reverse -233 -242 19.2726 0.000701
NP_440929.1_8 Forward -375 -366 16.5193 0.00413
NP_440929.1_8 Reverse -366 -375 9.53783 0.0296
NP_442933.1_10 Forward -242 -233 17.601 0.00325
NP_442933.1_10 Reverse -233 -242 17.601 0.00325
NP_442933.1_10 Reverse -145 -154 11.5045 0.042
NP_442933.1_10 Forward -375 -366 8.06287 0.0885
NP_442933.1_10 Reverse -366 -375 7.96454 0.0937
NP_442671.1_2 Forward -108 -89 4.22167 0.182
NP_441751.2_8 Reverse -367 -381 -2.55701 0.132
NP_441751.2_8 Forward -265 -251 -4.32697 0.17
NP_441751.2_8 Reverse -234 -248 -5.31028 0.202
NP_441751.2_8 Reverse -146 -160 -6.39192 0.265
NP_442926.1_3 Forward -253 -234 2.26107 0.295
NP_442926.1_5 Forward -247 -228 14.0562 0.15
NP_442554.1_8 Reverse -234 -244 16.008 0.0065
NP_442554.1_8 Reverse -165 -175 14.238 0.0144
NP_442554.1_8 Forward -241 -231 13.8447 0.0145
NP_442554.1_8 Reverse -367 -377 12.4681 0.0263
NP_442554.1_8 Forward -172 -162 10.6981 0.0438
NP_442554.1_8 Forward -374 -364 6.37155 0.12
NP_441762.1_7 Reverse -232 -244 21.5735 0.00342
NP_441762.1_7 Forward -243 -231 12.0354 0.0142
NP_442142.1_4 Reverse -230 -243 18.4065 0.0255
NP_442142.1_4 Forward -245 -232 8.57349 0.112
NP_442142.1_4 Reverse -161 -174 5.62358 0.187
NP_442142.1_4 Forward -157 -144 5.13193 0.201
NP_442142.1_4 Forward -372 -359 4.54195 0.217
NP_442292.1_1 Forward -241 -232 9.63616 0.0183
NP_442292.1_1 Reverse -234 -243 9.63616 0.0183
NP_442292.1_1 Forward -374 -365 8.65285 0.0335
NP_442292.1_1 Forward -172 -163 5.21127 0.152
NP_442292.1_1 Reverse -165 -174 4.81794 0.17
NP_442292.1_1 Reverse -367 -376 -0.196935 0.239
NP_442292.1_5 Forward -246 -227 1.67108 0.257
NP_442476.1_6 Reverse -234 -248 24.6807 0.00269
NP_439989.1_6 Reverse -357 -376 5.30933 0.296
NP_442381.1_8 Forward -245 -226 -3.63879 0.126
NP_442381.1_8 Forward -386 -367 -5.99873 0.151
NP_443009.1_5 Reverse -232 -243 11.6612 0.0602
NP_443009.1_5 Forward -243 -232 11.6612 0.0602
NP_443009.1_5 Reverse -128 -139 8.61296 0.104
NP_443009.1_5 Reverse -365 -376 6.05637 0.177
NP_441715.1_4 Forward -241 -231 16.303 0.0117
NP_441715.1_4 Reverse -234 -244 9.32148 0.097
NP_441715.1_4 Forward -153 -143 7.64985 0.108
NP_441715.1_4 Forward -374 -364 7.55152 0.108
NP_441198.1_4 Forward -84 -65 8.75091 0.276
NP_441198.1_8 Forward -12 -2 10.1462 0.296
NP_440464.1_10 Reverse -326 -336 11.7668 0.282
NP_441468.1_1 Forward -241 -234 15.8704 0.0124
NP_441468.1_1 Reverse -234 -241 15.8704 0.0124
NP_441468.1_1 Reverse -367 -374 6.13563 0.209
NP_441468.1_1 Forward -374 -367 6.0373 0.223
NP_441468.1_1 Reverse -165 -172 3.97235 0.277
NP_441468.1_1 Forward -172 -165 3.97235 0.277
NP_441020.2_6 Forward -244 -227 18.9184 0.0103
NP_441020.2_6 Reverse -364 -381 7.70866 0.222
NP_441015.1_10 Forward -247 -228 -2.36049 0.178
NP_441673.1_1 Forward -242 -233 20.8459 0.000698
NP_441673.1_1 Reverse -233 -242 20.8459 0.000698
NP_441673.1_1 Reverse -366 -375 11.1111 0.0121
NP_441673.1_1 Forward -375 -366 11.0128 0.018
NP_441673.1_1 Forward -154 -145 1.37636 0.114
NP_441673.1_1 Reverse -145 -154 1.1797 0.163
NP_440672.1_1 Forward -78 -60 19.3903 0.124
NP_441826.1_2 Reverse -227 -241 4.32615 0.104
NP_441826.1_2 Forward -375 -361 2.65453 0.123
NP_442868.1_6 Reverse -364 -374 9.51814 0.0447
NP_442868.1_6 Forward -244 -234 8.53483 0.0555
NP_442868.1_6 Reverse -231 -241 0.963343 0.205
NP_442868.1_6 Reverse -143 -153 -0.41329 0.295
NP_441056.1_1 Forward -375 -356 -7.17871 0.271
NP_441612.1_2 Forward -154 -144 13.0995 0.21
NP_442227.1_4 Reverse -199 -218 24.778 0.00732
NP_442361.1_3 Reverse -227 -240 9.75405 0.272
NP_441911.1_7 Reverse -177 -196 -19.0774 0.275
NP_442808.1_1 Forward -243 -233 18.4657 0.00201
NP_442808.1_1 Reverse -232 -242 18.4657 0.00201
NP_442808.1_1 Forward -376 -366 9.321 0.0481
NP_440031.1_10 Forward -394 -375 14.4541 0.0942
NP_440145.1_3 Reverse -356 -375 -2.0655 0.161
NP_442542.1_2 Forward -244 -231 12.409 0.114
NP_442542.1_2 Reverse -364 -377 8.57408 0.154
NP_442542.1_2 Forward -377 -364 7.78743 0.17
NP_442542.1_2 Forward -385 -372 7.09911 0.193
NP_442542.1_9 Reverse -226 -240 17.5018 0.0454
NP_442542.1_9 Forward -396 -382 6.29216 0.243
NP_442050.1_5 Forward -377 -367 13.6475 0.0295
NP_442050.1_5 Reverse -231 -241 9.12434 0.193
NP_442050.1_5 Forward -244 -234 8.23937 0.234
NP_441114.1_3 Forward -259 -250 15.831 0.193
NP_440558.1_2 Reverse -161 -180 1.27776 0.182
NP_440558.1_2 Forward -384 -365 -6.49039 0.275
NP_440558.1_2 Forward -177 -158 -7.37537 0.293
NP_440111.2_4 Forward -380 -361 10.0292 0.239
NP_441498.1_3 Forward -327 -309 10.5398 0.214
NP_442789.1_4 Forward -259 -240 -4.91709 0.265
NP_440274.1_2 Reverse -59 -73 11.5037 0.26
NP_441518.1_3 Reverse -223 -242 -6.39206 0.136
NP_441878.1_6 Forward -376 -366 10.4031 0.0176
NP_441878.1_6 Forward -243 -233 10.4031 0.0176
NP_441878.1_6 Reverse -232 -242 10.4031 0.0176
NP_441878.1_6 Forward -174 -164 0.766681 0.134
NP_441878.1_6 Forward -155 -145 0.766681 0.134
NP_441878.1_6 Reverse -365 -375 0.668351 0.139
NP_441878.1_6 Reverse -163 -173 0.57002 0.14
NP_441036.1_7 Forward -72 -62 15.8108 0.292
NP_441036.1_8 Forward -243 -233 17.7779 0.000554
NP_441036.1_8 Reverse -232 -242 17.7779 0.000554
NP_441036.1_8 Forward -206 -196 7.84651 0.183
NP_441036.1_8 Reverse -365 -375 7.05986 0.21
NP_442650.1_2 Forward -78 -64 2.75286 0.246
NP_441557.1_4 Reverse -311 -325 10.9143 0.291
NP_441557.1_5 Forward -242 -233 19.9609 0.000699
NP_441557.1_5 Reverse -233 -242 19.9609 0.000699
NP_441557.1_5 Reverse -366 -375 10.2261 0.0144
NP_441557.1_5 Forward -375 -366 10.1278 0.0188
NP_441557.1_5 Forward -154 -145 0.491382 0.144
NP_441557.1_5 Reverse -145 -154 0.29472 0.174
NP_441445.1_1 Reverse -224 -243 4.03102 0.203
NP_441445.1_1 Forward -251 -232 3.44104 0.213
NP_442066.2_4 Reverse -374 -393 -1.7705 0.205
NP_442066.2_9 Forward -246 -233 10.934 0.154
NP_442795.1_3 Forward -337 -318 5.60432 0.257
NP_442419.1_2 Forward -247 -228 1.17943 0.238
NP_442419.1_2 Reverse -228 -247 -4.6221 0.291
NP_441308.1_8 Reverse -231 -241 10.1081 0.22
NP_441308.1_8 Forward -244 -234 9.22315 0.226
NP_440101.1_3 Forward -247 -228 14.2574 0.067
NP_440101.1_5 Reverse -226 -245 5.70265 0.196
NP_442183.1_1 Reverse -233 -247 17.7975 0.00938
NP_442183.1_1 Forward -242 -228 10.226 0.0869
NP_442183.1_1 Reverse -366 -380 9.43936 0.098
NP_440276.1_8 Reverse -54 -73 5.80098 0.3
NP_442444.1_6 Forward -250 -232 14.4682 0.21
NP_441549.1_9 Reverse -362 -380 -3.91409 0.198
NP_441549.1_9 Forward -246 -228 -5.38906 0.198
NP_441549.1_10 Reverse -291 -310 16.8141 0.204
NP_440861.1_3 Forward -386 -368 13.5888 0.19
NP_442347.1_2 Forward -241 -232 11.1111 0.056
NP_442347.1_2 Reverse -234 -243 11.1111 0.056
NP_442347.1_2 Forward -374 -365 10.3245 0.058
NP_442347.1_2 Reverse -146 -155 5.40793 0.23
NP_442645.1_2 Forward -250 -231 -20.2567 0.288
NP_442645.1_2 Reverse -358 -377 -22.0267 0.29
NP_441037.1_4 Forward -244 -234 16.2838 0.0168
NP_441037.1_4 Reverse -231 -241 7.02532 0.237
NP_441633.1_3 Reverse -231 -244 13.3923 0.018
NP_441633.1_3 Forward -244 -231 3.5592 0.0699
NP_441633.1_3 Reverse -364 -377 3.06754 0.0764
NP_441633.1_3 Reverse -143 -156 0.805932 0.115
NP_440136.1_2 Forward -241 -234 15.9687 0.0123
NP_440136.1_2 Reverse -234 -241 15.9687 0.0123
NP_440136.1_2 Reverse -367 -374 6.23397 0.171
NP_440136.1_2 Forward -374 -367 6.13563 0.193
NP_442998.1_10 Forward -373 -366 15.5754 0.0102
NP_442998.1_10 Forward -240 -233 15.5754 0.0102
NP_442998.1_10 Reverse -235 -242 15.5754 0.0102
NP_442998.1_10 Reverse -194 -201 10.2655 0.0946
NP_442998.1_10 Reverse -147 -154 5.93897 0.206
NP_442998.1_10 Reverse -368 -375 5.84064 0.235
NP_440299.1_1 Reverse -362 -375 8.37683 0.0945
NP_440299.1_1 Forward -246 -233 7.59019 0.109
NP_440299.1_1 Forward -379 -366 6.11523 0.152
NP_440299.1_1 Reverse -229 -242 2.28034 0.292
NP_441799.1_1 Forward -246 -232 17.6002 0.011
NP_441799.1_1 Reverse -229 -243 11.307 0.0591
NP_441799.1_1 Forward -379 -365 8.45543 0.114
NP_441007.1_10 Forward -247 -234 13.6873 0.0499
NP_442201.1_10 Reverse -222 -241 -12.4886 0.268
NP_440256.1_1 Reverse -363 -382 -3.73712 0.138
NP_440256.1_1 Forward -245 -226 -8.35868 0.259
NP_441559.1_8 Reverse -361 -375 2.75286 0.143
NP_441559.1_8 Reverse -124 -138 -6.58858 0.279
NP_441559.1_8 Forward -370 -356 -6.78525 0.279
NP_441559.1_8 Forward -247 -233 -6.98191 0.281
NP_440915.1_6 Reverse -362 -376 10.6193 0.0301
NP_440915.1_6 Forward -285 -271 2.35953 0.119
NP_440915.1_6 Forward -369 -355 -1.8687 0.251
NP_440915.1_6 Forward -246 -232 -2.16369 0.26
NP_440915.1_6 Reverse -303 -317 -3.147 0.29
NP_440915.1_6 Reverse -229 -243 -3.147 0.29
NP_442855.1_6 Forward -208 -189 14.0608 0.298
NP_442785.1_7 Forward -377 -363 18.3875 0.0892
NP_441704.1_8 Reverse -355 -374 8.35677 0.208
NP_442866.1_1 Forward -247 -228 2.94938 0.151
NP_442866.1_6 Reverse -364 -383 7.86593 0.254
NP_440748.1_4 Forward -90 -71 18.6815 0.137
NP_441464.1_8 Reverse -233 -247 10.816 0.178
NP_440026.1_4 Reverse -363 -382 11.7008 0.239
NP_441939.1_3 Reverse -234 -253 5.30933 0.28
NP_441494.1_6 Forward -247 -234 10.7374 0.225
NP_442993.1_1 Forward -242 -226 11.5633 0.0141
NP_442993.1_1 Reverse -233 -249 -11.1512 0.235
NP_442993.1_1 Reverse -79 -95 -11.7412 0.257
NP_442386.1_9 Reverse -232 -241 15.7322 0.0144
NP_442386.1_9 Forward -243 -234 15.7322 0.0144
NP_442386.1_9 Reverse -163 -172 9.04574 0.175
NP_442386.1_10 Forward -84 -71 4.64084 0.262
NP_441750.1_4 Reverse -362 -381 2.85105 0.243
NP_441340.1_5 Forward -241 -234 15.6737 0.0124
NP_441340.1_5 Reverse -234 -241 15.6737 0.0124
NP_441340.1_5 Reverse -367 -374 13.5105 0.0314
NP_441340.1_5 Forward -374 -367 5.84064 0.208
NP_441340.1_5 Reverse -165 -172 4.07068 0.239
NP_441340.1_5 Forward -172 -165 4.07068 0.239
NP_441271.1_1 Forward -248 -230 15.063 0.202
NP_442240.1_1 Reverse -133 -152 4.81688 0.268
NP_440586.1_1 Forward -205 -186 -1.7705 0.241
NP_440586.1_1 Forward -249 -230 -3.14714 0.263
NP_440586.1_1 Reverse -78 -97 -4.91709 0.278
NP_440586.1_8 Forward -241 -234 13.2151 0.026
NP_440586.1_8 Reverse -234 -241 13.2151 0.026
NP_440586.1_8 Forward -153 -146 12.6251 0.0546
NP_440586.1_8 Forward -374 -367 9.47853 0.146
NP_440586.1_8 Forward -172 -165 7.61025 0.227
NP_440586.1_8 Reverse -165 -172 7.61025 0.227
NP_440586.1_8 Reverse -367 -374 5.74197 0.283
NP_442251.1_6 Forward -241 -234 15.2804 0.0124
NP_442251.1_6 Reverse -234 -241 15.2804 0.0124
NP_440969.1_3 Reverse -22 -40 13.4897 0.214
NP_441262.1_3 Reverse -366 -373 14.7888 0.0223
NP_441262.1_3 Reverse -233 -240 14.7888 0.0223
NP_441262.1_3 Forward -242 -235 14.7888 0.0223
NP_440027.1_3 Forward -375 -357 9.06482 0.187
NP_443051.1_1 Reverse -232 -241 10.4228 0.00754
NP_443051.1_1 Forward -243 -234 10.4228 0.00754
NP_443051.1_1 Forward -376 -367 8.25953 0.0414
NP_443051.1_1 Reverse -365 -374 7.47288 0.0571
NP_443051.1_1 Forward -174 -165 -0.000272808 0.245
NP_443051.1_1 Forward -155 -146 -1.18024 0.297
NP_439937.1_8 Reverse -231 -250 3.14605 0.207
NP_439937.1_9 Reverse -232 -249 1.41477 0.0948
NP_439937.1_9 Forward -376 -359 -7.63163 0.164
NP_439937.1_9 Forward -235 -218 -9.20492 0.183
NP_439937.1_9 Forward -236 -219 -9.99156 0.22
NP_440439.1_1 Forward -245 -232 19.0955 0.0105
NP_440439.1_1 Reverse -363 -376 11.1307 0.0339
NP_440439.1_1 Reverse -230 -243 8.37742 0.0537
NP_440372.1_2 Forward -241 -234 16.3621 0.0124
NP_440372.1_2 Reverse -234 -241 16.3621 0.0124
NP_440372.1_2 Reverse -367 -374 13.8055 0.0214
NP_440372.1_2 Forward -374 -367 6.52896 0.188
NP_442783.1_8 Reverse -196 -215 13.7649 0.288
NP_440819.1_5 Reverse -313 -321 17.424 0.185
NP_440316.1_10 Forward -174 -164 6.37155 0.263
NP_441803.1_2 Reverse -228 -247 4.62101 0.177
NP_441803.1_2 Forward -247 -228 -0.0988766 0.267
NP_439977.1_5 Forward -248 -229 0.294447 0.211
NP_440139.1_1 Reverse -227 -246 6.98015 0.137
NP_440267.1_2 Forward -159 -145 18.3868 0.0267
NP_440267.1_2 Reverse -228 -242 8.45543 0.162
NP_442384.1_10 Forward -375 -362 19.2922 0.00338
NP_442384.1_10 Reverse -233 -246 9.36073 0.054
NP_442384.1_10 Reverse -366 -379 7.59077 0.0784
NP_442384.1_10 Forward -154 -141 7.19745 0.0866
NP_442384.1_10 Reverse -145 -158 1.88757 0.243
NP_442114.1_4 Reverse -233 -244 12.1534 0.107
NP_442114.1_8 Forward -119 -105 3.44058 0.295
NP_441877.1_7 Reverse -228 -247 3.73524 0.218
NP_441018.1_7 Forward -393 -374 10.6192 0.201
NP_441018.1_7 Reverse -362 -381 8.35759 0.249
NP_442262.1_10 Forward -241 -234 14.1988 0.0123
NP_442262.1_10 Reverse -234 -241 14.1988 0.0123
NP_442262.1_10 Forward -374 -367 13.2155 0.0213
NP_442262.1_10 Forward -172 -165 10.4622 0.145
NP_442262.1_10 Reverse -165 -172 10.4622 0.145
NP_442262.1_10 Reverse -258 -265 8.59391 0.22
NP_441689.1_5 Reverse -231 -241 8.53436 0.132
NP_441689.1_5 Forward -377 -367 6.37109 0.197
NP_442244.1_3 Forward -239 -220 4.32602 0.259
NP_440163.1_10 Reverse -230 -240 15.2213 0.0762
NP_440344.1_10 Reverse -226 -243 0.530496 0.0353
NP_440344.1_10 Forward -249 -232 -0.0594896 0.0381
NP_440344.1_10 Forward -382 -365 -11.8592 0.231
NP_440075.1_1 Forward -262 -243 6.78429 0.126
NP_440487.1_1 Forward -245 -226 6.78429 0.102
NP_441965.1_3 Forward -252 -233 -0.39387 0.259
NP_441965.1_10 Reverse -230 -246 7.72835 0.142
NP_441640.1_8 Reverse -252 -271 -5.99873 0.295
NP_442556.1_10 Reverse -210 -229 9.11728 0.279
NP_440297.1_9 Reverse -367 -377 9.32148 0.0917
NP_440297.1_9 Forward -241 -231 9.32148 0.0917
NP_440297.1_9 Forward -172 -162 0.176696 0.282
NP_440297.1_9 Reverse -234 -244 -0.216628 0.282
NP_440297.1_9 Reverse -165 -175 -0.216628 0.282
NP_442280.1_10 Reverse -54 -72 15.5841 0.109
NP_442280.1_10 Reverse -154 -172 4.96742 0.291
NP_441896.1_3 Reverse -357 -376 16.7157 0.0385
NP_441896.1_3 Forward -251 -232 7.57094 0.0933
NP_440999.1_9 Forward -246 -232 9.63603 0.0615
NP_440999.1_9 Reverse -74 -88 6.98109 0.0925
NP_440999.1_9 Reverse -232 -246 1.86788 0.157
NP_440999.1_9 Reverse -362 -376 -2.85201 0.279
NP_440888.1_2 Forward -242 -228 17.2068 0.00437
NP_440888.1_2 Forward -375 -361 16.1252 0.00789
NP_440888.1_2 Reverse -233 -247 15.2402 0.0118
NP_440888.1_2 Forward -316 -302 9.14375 0.137
NP_440888.1_2 Reverse -57 -71 7.47213 0.194
NP_442892.1_9 Reverse -96 -110 11.4053 0.296
NP_442147.1_7 Reverse -224 -243 10.1275 0.25
NP_440491.1_1 Forward -245 -226 9.64582 0.206
NP_439969.1_1 Forward -318 -299 -6.58872 0.288
NP_442948.1_2 Forward -88 -69 2.75272 0.3
NP_442033.1_10 Forward -377 -358 0.294447 0.108
NP_442033.1_10 Reverse -162 -181 -10.227 0.23
NP_442807.1_10 Reverse -210 -224 21.3374 0.118
NP_441543.1_2 Forward -241 -232 18.486 0.00236
NP_441543.1_2 Reverse -234 -243 18.486 0.00236
NP_441543.1_2 Forward -153 -144 11.9961 0.047
NP_441543.1_2 Forward -374 -365 7.07956 0.131
NP_441543.1_2 Reverse -165 -174 4.12963 0.279
NP_442845.1_2 Forward -179 -165 9.2427 0.178
NP_442845.1_2 Forward -248 -234 7.86607 0.195
NP_441551.1_5 Forward -246 -230 10.8742 0.19
NP_441469.1_8 Reverse -232 -241 16.126 0.00797
NP_441469.1_8 Forward -243 -234 16.126 0.00797
NP_442315.1_4 Reverse -43 -61 10.6381 0.198
NP_443064.1_6 Reverse -366 -376 12.6639 0.0796
NP_443064.1_6 Reverse -129 -139 10.5308 0.148
NP_443064.1_6 Forward -375 -365 10.4338 0.153
NP_442578.1_7 Forward -241 -234 14.5921 0.026
NP_442578.1_7 Reverse -234 -241 14.5921 0.026
NP_442578.1_7 Forward -153 -146 12.6255 0.0418
NP_442578.1_7 Reverse -367 -374 6.0373 0.18
NP_440710.1_1 Forward -383 -365 -3.52077 0.208
NP_440710.1_1 Reverse -137 -155 -6.56903 0.225
NP_440220.1_4 Reverse -151 -170 1.08032 0.239
NP_441462.1_2 Reverse -366 -376 18.3679 0.0036
NP_441462.1_2 Forward -242 -232 11.5831 0.00406
NP_441462.1_2 Reverse -233 -243 11.5831 0.00406
NP_441462.1_2 Forward -375 -365 1.74999 0.0811
NP_441462.1_2 Reverse -145 -155 0.471689 0.148
NP_441621.1_7 Reverse -231 -245 6.09611 0.068
NP_441621.1_7 Forward -244 -230 5.99778 0.068
NP_443062.1_1 Forward -242 -224 10.6911 0.112
NP_443062.1_1 Reverse -252 -270 6.79079 0.192
NP_443062.1_1 Reverse -233 -251 4.74314 0.25
NP_443062.1_6 Forward -250 -231 1.17943 0.278
NP_441601.1_4 Reverse -71 -90 9.3409 0.155
NP_441601.1_4 Reverse -376 -395 -2.0655 0.293
NP_440519.1_6 Reverse -52 -66 11.3077 0.29
NP_440519.1_8 Forward -204 -188 6.54838 0.21
NP_442204.1_1 Reverse -362 -373 9.79344 0.0736
NP_442204.1_1 Forward -177 -166 7.63016 0.123
NP_442204.1_1 Reverse -303 -314 2.71361 0.266
NP_442204.1_5 Forward -252 -233 8.16093 0.122
NP_442204.1_5 Reverse -223 -242 4.52268 0.167
NP_442204.1_6 Reverse -357 -376 4.81767 0.286
NP_441560.1_5 Forward -167 -148 16.8141 0.204
NP_441560.1_8 Forward -99 -80 11.7075 0.287
NP_441560.1_10 Forward -383 -364 13.3725 0.127
NP_440516.1_8 Reverse -366 -375 16.9127 0.00442
NP_440516.1_8 Forward -242 -233 16.9127 0.00442
NP_440516.1_8 Reverse -233 -242 16.9127 0.00442
NP_440516.1_8 Forward -375 -366 14.8477 0.00685
NP_440516.1_8 Reverse -307 -316 -0.196935 0.185
NP_441033.1_2 Reverse -223 -242 -8.94866 0.293
NP_442428.1_5 Forward -241 -234 15.8704 0.0124
NP_442428.1_5 Reverse -234 -241 15.8704 0.0124
NP_442428.1_5 Reverse -367 -374 6.13563 0.209
NP_442428.1_5 Forward -374 -367 6.0373 0.212
NP_442428.1_5 Forward -172 -165 4.36568 0.271
NP_442428.1_5 Reverse -165 -172 4.36568 0.271
NP_440673.1_3 Forward -373 -366 12.4288 0.0426
NP_440673.1_3 Forward -240 -233 12.4288 0.0426
NP_440673.1_3 Reverse -235 -242 12.4288 0.0426
NP_440673.1_3 Reverse -147 -154 10.1672 0.149
NP_441052.1_2 Forward -154 -144 13.5497 0.0285
NP_441052.1_2 Forward -242 -232 10.5014 0.0285
NP_441052.1_2 Reverse -233 -243 10.5014 0.0285
NP_441052.1_2 Forward -375 -365 10.1081 0.0295
NP_441052.1_2 Forward -173 -163 4.0116 0.168
NP_441052.1_2 Reverse -366 -376 0.865012 0.256
NP_440992.1_5 Reverse -311 -330 13.4464 0.281
NP_442219.1_8 Forward -246 -227 8.45701 0.245
NP_442219.1_9 Forward -241 -232 8.35786 0.0681
NP_442219.1_9 Reverse -234 -243 8.35786 0.0681
NP_442219.1_9 Forward -374 -365 7.96454 0.0696
NP_440436.1_4 Forward -241 -232 18.1905 0.00233
NP_440436.1_4 Reverse -234 -243 18.1905 0.00233
NP_440436.1_4 Forward -374 -365 7.57079 0.124
NP_440436.1_4 Reverse -367 -376 6.39082 0.162
NP_441884.1_9 Reverse -230 -249 -14.0619 0.138
NP_441884.1_9 Forward -245 -226 -22.42 0.278
NP_441884.1_9 Forward -378 -359 -23.6 0.284
NP_440314.1_9 Reverse -119 -138 4.32602 0.0805
NP_440314.1_9 Reverse -146 -165 -9.53865 0.269
NP_440041.1_2 Forward -191 -172 -2.36049 0.236
NP_442577.1_9 Reverse -337 -351 9.83206 0.298
NP_441719.1_4 Forward -241 -234 16.3621 0.0124
NP_441719.1_4 Reverse -234 -241 16.3621 0.0124
NP_441719.1_4 Reverse -367 -374 6.82395 0.0855
NP_441719.1_4 Forward -374 -367 6.52896 0.188
NP_441719.1_4 Forward -153 -146 3.77569 0.285
NP_441733.1_10 Forward -245 -232 10.934 0.106
NP_441733.1_10 Reverse -230 -243 10.2457 0.106
NP_441004.1_1 Reverse -221 -240 -11.7019 0.241
NP_442813.1_4 Reverse -55 -74 -7.37537 0.299
NP_442366.1_3 Forward -243 -225 11.3272 0.0376
NP_442366.1_3 Forward -202 -184 -1.35749 0.211
NP_442366.1_3 Forward -38 -20 -3.91409 0.26
NP_441034.1_4 Reverse -267 -286 14.9398 0.237
NP_442694.1_3 Forward -183 -165 -4.40575 0.268
NP_442206.1_1 Reverse -233 -252 -11.6036 0.22
NP_440328.1_4 Reverse -227 -246 5.60432 0.145
NP_443054.1_2 Reverse -231 -245 12.4876 0.0722
NP_443054.1_2 Forward -244 -230 3.63784 0.24
NP_443054.1_2 Reverse -224 -238 1.17956 0.251
NP_442430.1_10 Forward -252 -233 9.24175 0.297
NP_441851.1_10 Forward -243 -233 16.008 0.00552
NP_441851.1_10 Reverse -232 -242 16.008 0.00552
NP_441851.1_10 Forward -376 -366 7.64985 0.135
NP_441851.1_10 Reverse -365 -375 6.17489 0.182
NP_441851.1_10 Forward -155 -145 4.20827 0.282
NP_442856.1_7 Reverse -224 -243 -3.3438 0.243
NP_442515.1_1 Reverse -232 -246 4.91614 0.107
NP_442515.1_1 Reverse -365 -379 4.12949 0.108
NP_442515.1_1 Forward -155 -141 0.786239 0.18
NP_442515.1_1 Forward -384 -370 -0.787057 0.235
NP_442515.1_1 Forward -376 -362 -0.787057 0.235
NP_441046.1_2 Forward -253 -234 0.392778 0.269
NP_441409.1_6 Reverse -261 -280 0.491109 0.0649
NP_441409.1_6 Forward -179 -160 -2.45882 0.0821
NP_441409.1_6 Forward -248 -229 -7.17871 0.145
NP_440432.1_9 Forward -241 -226 -0.315096 0.164
NP_442843.1_1 Forward -260 -241 -3.93378 0.23
NP_442843.1_1 Forward -172 -153 -4.91709 0.239
NP_442843.1_1 Forward -349 -330 -11.6036 0.291
NP_440474.1_8 Forward -241 -227 15.0436 0.0586
NP_440474.1_8 Reverse -234 -248 15.0436 0.0586
NP_440474.1_8 Forward -265 -251 4.03056 0.294
NP_441124.1_5 Forward -345 -335 10.1434 0.297
NP_442450.1_5 Forward -377 -367 9.7148 0.115
NP_442450.1_5 Reverse -231 -241 9.32148 0.115
NP_440588.1_2 Forward -251 -232 -1.47551 0.155
NP_440588.1_2 Reverse -66 -85 -1.57384 0.155
NP_440943.1_4 Reverse -244 -256 14.3953 0.296
NP_442006.1_2 Reverse -300 -317 -7.33598 0.171
NP_442006.1_2 Reverse -224 -241 -15.6941 0.228
NP_442006.1_2 Reverse -301 -318 -16.0874 0.238
NP_441003.1_9 Reverse -54 -73 5.11266 0.268
NP_442243.1_1 Reverse -360 -378 12.5064 0.112
NP_442243.1_1 Reverse -301 -319 -2.53818 0.293
NP_441570.1_1 Forward -242 -224 -2.3408 0.065
NP_441570.1_1 Forward -154 -136 -15.5171 0.231
NP_441570.1_1 Forward -375 -357 -16.0088 0.237
NP_440078.1_10 Reverse -233 -252 3.04771 0.269
NP_441078.1_4 Forward -242 -233 19.6659 0.0007
NP_441078.1_4 Reverse -233 -242 19.6659 0.0007
NP_441078.1_4 Reverse -366 -375 9.93116 0.0203
NP_441078.1_4 Forward -375 -366 9.83282 0.0226
NP_441078.1_4 Forward -154 -145 0.393051 0.205
NP_441078.1_4 Reverse -145 -154 -0.000272808 0.205
NP_441078.1_4 Forward -173 -164 -1.6719 0.266
NP_441078.1_4 Reverse -164 -173 -1.77023 0.266
NP_442729.1_8 Forward -246 -233 9.75405 0.125
NP_441663.1_8 Reverse -301 -320 11.6025 0.074
NP_442443.1_4 Forward -116 -106 16.1058 0.155
NP_440526.1_3 Reverse -234 -245 2.41814 0.267
NP_440526.1_3 Forward -241 -230 1.92649 0.267
NP_441432.1_8 Reverse -365 -374 14.0611 0.0258
NP_441432.1_8 Reverse -232 -241 8.25953 0.0755
NP_441432.1_8 Forward -243 -234 8.25953 0.0755
NP_441432.1_8 Forward -174 -165 6.19458 0.118
NP_441432.1_8 Forward -67 -58 2.85133 0.281
NP_442320.1_8 Reverse -227 -241 13.1759 0.0144
NP_442320.1_8 Forward -248 -234 8.94771 0.0184
NP_442344.1_7 Forward -241 -222 12.7825 0.0207
NP_442344.1_7 Reverse -234 -253 -5.60541 0.168
NP_441732.1_2 Reverse -229 -245 -6.43131 0.0495
NP_441732.1_2 Forward -379 -363 -16.5594 0.174
NP_441732.1_2 Forward -177 -161 -16.7561 0.195
NP_441732.1_2 Reverse -188 -204 -17.641 0.281
NP_440497.1_2 Forward -259 -240 8.94757 0.208
NP_440497.1_2 Forward -374 -355 3.93269 0.293
NP_440629.1_4 Reverse -330 -349 10.9142 0.236
NP_442815.1_2 Forward -77 -59 17.0304 0.0672
NP_440760.1_1 Reverse -233 -252 -10.817 0.0847
NP_440760.1_1 Forward -375 -356 -15.6352 0.152
NP_442797.1_6 Forward -240 -221 12.4911 0.228
NP_442797.1_7 Reverse -359 -377 3.46073 0.234
NP_442797.1_7 Reverse -232 -250 -1.45582 0.299
NP_442274.1_8 Forward -318 -300 13.188 0.294
NP_440199.1_10 Reverse -230 -240 14.533 0.0861
NP_440913.1_1 Reverse -270 -288 6.70565 0.221
NP_442751.1_2 Forward -243 -224 8.65176 0.206
NP_441072.1_2 Forward -246 -227 9.43923 0.218
NP_442400.1_1 Forward -245 -226 4.22769 0.133
NP_440713.1_4 Reverse -356 -375 6.88262 0.184
NP_442489.1_7 Forward -242 -233 20.1576 0.000695
NP_442489.1_7 Reverse -233 -242 20.1576 0.000695
NP_442489.1_7 Forward -375 -366 10.5211 0.0102
NP_442489.1_7 Reverse -366 -375 10.4228 0.0151
NP_442489.1_7 Reverse -145 -154 7.47288 0.0613
NP_442489.1_7 Forward -154 -145 0.688044 0.152
NP_442489.1_7 Forward -173 -164 -1.6719 0.235
NP_442489.1_7 Reverse -164 -173 -1.77023 0.247
NP_440559.1_1 Reverse -367 -376 14.5527 0.0154
NP_440559.1_1 Reverse -234 -243 8.75118 0.0586
NP_440559.1_1 Forward -241 -232 8.75118 0.0586
NP_440559.1_1 Forward -374 -365 7.76787 0.0918
NP_440559.1_1 Forward -153 -144 4.62128 0.24
NP_441659.2_8 Forward -375 -365 15.0247 0.00732
NP_441659.2_8 Forward -242 -232 11.9764 0.0147
NP_441659.2_8 Reverse -233 -243 11.9764 0.0147
NP_441659.2_8 Reverse -366 -376 9.81313 0.0269
NP_441659.2_8 Forward -173 -163 3.02829 0.177
NP_441659.2_8 Reverse -145 -155 -0.118297 0.287
NP_440426.1_7 Forward -164 -145 0.196116 0.264
NP_442913.1_10 Reverse -224 -243 0.786102 0.151
NP_439912.1_4 Reverse -213 -232 19.6656 0.0845
NP_441040.1_2 Forward -319 -300 -7.08038 0.207
NP_441040.1_2 Forward -318 -299 -12.3902 0.255
NP_441040.1_2 Forward -244 -225 -15.1435 0.286
NP_440779.1_5 Forward -242 -225 -14.5141 0.246
NP_442346.1_5 Forward -174 -164 13.0581 0.0301
NP_442346.1_5 Forward -243 -233 9.02648 0.118
NP_442346.1_5 Reverse -232 -242 9.02648 0.118
NP_442346.1_5 Forward -376 -366 8.1415 0.146
NP_442346.1_5 Reverse -365 -375 7.55152 0.165
NP_442346.1_5 Forward -155 -145 5.48657 0.243
NP_442346.1_5 Reverse -163 -173 5.28991 0.253
NP_440545.1_3 Forward -177 -160 0.0388413 0.146
NP_440545.1_3 Reverse -160 -177 -1.43612 0.168
NP_440545.1_3 Reverse -229 -246 -2.3211 0.183
NP_440545.1_3 Forward -270 -253 -4.68105 0.23
NP_440545.1_3 Reverse -362 -379 -5.76269 0.259
NP_441856.1_3 Reverse -230 -249 0.58944 0.213
NP_440831.1_3 Reverse -224 -243 9.29946 0.202
NP_441629.1_1 Forward -383 -364 7.47261 0.253
NP_440555.1_1 Forward -184 -165 1.67108 0.294
NP_440459.1_2 Forward -182 -165 7.31533 0.296
NP_440010.1_4 Reverse -226 -245 -1.67294 0.267
NP_440010.1_4 Reverse -229 -248 -2.75457 0.289
NP_440010.1_10 Forward -387 -368 2.55606 0.276
NP_442603.1_7 Forward -375 -361 16.9119 0.0273
NP_442603.1_7 Reverse -366 -380 6.78381 0.23
NP_440449.1_6 Forward -250 -232 5.33794 0.279
NP_441948.1_4 Reverse -226 -244 14.3755 0.0318
NP_441833.1_4 Forward -241 -234 15.9687 0.0124
NP_441833.1_4 Reverse -234 -241 15.9687 0.0124
NP_441833.1_4 Forward -374 -367 6.52896 0.0924
NP_441833.1_4 Reverse -367 -374 6.23397 0.163
NP_442060.1_5 Forward -249 -230 11.9958 0.29
NP_441112.1_6 Reverse -223 -242 -1.18052 0.295
NP_442162.1_9 Forward -241 -234 16.2637 0.0124
NP_442162.1_9 Reverse -234 -241 16.2637 0.0124
NP_442162.1_9 Forward -374 -367 12.9205 0.0282
NP_442162.1_9 Reverse -367 -374 12.9205 0.0282
NP_442162.1_10 Forward -219 -200 17.7658 0.209
NP_440671.1_4 Reverse -227 -241 7.57108 0.214
NP_442404.1_9 Reverse -236 -250 12.487 0.263
NP_440224.1_1 Reverse -222 -241 1.96607 0.132
NP_442199.1_5 Reverse -225 -244 -2.75381 0.194
NP_442199.1_5 Forward -250 -231 -3.93378 0.216
NP_442140.1_3 Reverse -234 -244 17.4829 0.0159
NP_442140.1_3 Forward -241 -231 8.33817 0.119
NP_442140.1_3 Forward -374 -364 8.23984 0.122
NP_442140.1_3 Forward -172 -162 6.46988 0.168
NP_440875.1_9 Reverse -235 -245 15.2829 0.0295
NP_440875.1_9 Forward -314 -304 8.95605 0.233
NP_440875.1_9 Forward -240 -230 8.37203 0.233
NP_441813.1_5 Reverse -231 -241 17.188 0.00979
NP_441813.1_5 Forward -377 -367 12.9597 0.0182
NP_441813.1_5 Forward -244 -234 10.0098 0.0208
NP_441813.1_5 Reverse -364 -374 8.4365 0.0432
NP_440590.1_4 Forward -374 -361 13.6873 0.0128
NP_440590.1_4 Reverse -234 -247 12.3107 0.0148
NP_440590.1_4 Forward -241 -228 3.26421 0.0749
NP_440567.1_1 Reverse -234 -248 21.3374 0.012
NP_440567.1_1 Forward -241 -227 7.57108 0.0689
NP_440567.1_1 Reverse -367 -381 3.53951 0.141
NP_442497.1_10 Forward -241 -232 10.4228 0.0087
NP_442497.1_10 Reverse -234 -243 10.4228 0.0087
NP_442497.1_10 Reverse -367 -376 10.1278 0.0166
NP_442497.1_10 Forward -374 -365 0.589713 0.153
NP_442497.1_10 Reverse -146 -155 0.196389 0.208
NP_440821.1_4 Reverse -231 -241 19.0562 0.00399
NP_440821.1_4 Forward -244 -234 18.7612 0.00422
NP_440821.1_4 Forward -377 -367 10.0098 0.0221
NP_440821.1_4 Reverse -364 -374 -0.314959 0.251
NP_441239.1_9 Forward -244 -232 18.6235 0.0114
NP_441239.1_9 Reverse -231 -243 15.8703 0.0178
NP_441239.1_9 Forward -377 -365 10.4621 0.0783
NP_441239.1_9 Forward -175 -163 7.11881 0.169
NP_441239.1_9 Reverse -162 -174 5.34885 0.223
NP_441951.1_3 Reverse -232 -251 16.6174 0.286
NP_441951.1_4 Forward -375 -356 2.26107 0.283
NP_442568.1_8 Forward -118 -104 8.16106 0.292
NP_440400.1_1 Reverse -183 -202 -0.00131823 0.277
NP_442643.1_3 Forward -220 -201 -8.06369 0.295
NP_442629.1_5 Reverse -216 -230 15.6342 0.279
NP_440989.1_3 Forward -247 -228 14.3558 0.166
NP_441874.1_1 Forward -400 -386 8.45605 0.298
NP_440354.1_5 Reverse -54 -73 3.83436 0.236
NP_440354.1_7 Reverse -360 -378 10.1472 0.224
NP_440354.1_7 Forward -248 -230 8.96727 0.231
NP_441617.1_6 Reverse -334 -353 -1.37718 0.256
NP_442138.1_1 Forward -244 -225 4.91521 0.24
NP_442138.1_10 Forward -242 -223 0.0977854 0.142
NP_442052.1_8 Reverse -250 -260 14.533 0.253
NP_440546.1_4 Reverse -366 -376 13.8273 0.0459
NP_440546.1_4 Forward -242 -232 11.8882 0.0679
NP_440546.1_4 Reverse -233 -243 11.8882 0.0679
NP_440546.1_4 Forward -375 -365 7.42815 0.241
NP_440546.1_6 Forward -252 -233 18.4857 0.0838
NP_440546.1_8 Forward -400 -386 20.4524 0.237
NP_443033.1_3 Forward -368 -349 11.7992 0.268
NP_441230.1_5 Reverse -228 -247 2.85105 0.209
NP_441230.1_5 Reverse -148 -167 0.294447 0.271
NP_440462.1_6 Forward -244 -234 17.9746 0.00578
NP_440462.1_6 Reverse -231 -241 15.418 0.0142
NP_440462.1_6 Forward -377 -367 4.89658 0.18
NP_442611.1_1 Forward -242 -223 7.7676 0.14
NP_442611.1_1 Forward -316 -297 -1.08219 0.274
NP_440868.1_1 Forward -80 -61 20.2556 0.077
NP_440868.1_4 Forward -246 -234 21.5735 0.00629
NP_440868.1_4 Reverse -229 -241 8.49544 0.0602
NP_440868.1_4 Reverse -362 -374 8.00379 0.0602
NP_440868.1_5 Forward -275 -256 19.2004 0.132
NP_440868.1_8 Forward -205 -186 27.9255 0.00138
NP_440868.1_10 Forward -376 -358 22.7336 0.0406
NP_442479.1_9 Forward -352 -333 10.0292 0.16
NP_440696.1_3 Forward -183 -165 6.60732 0.188
NP_440696.1_3 Forward -246 -228 -1.84914 0.266
NP_441843.2_9 Reverse -235 -253 10.8811 0.225
NP_441843.2_9 Forward -240 -222 10.2002 0.244
NP_442039.1_4 Forward -241 -234 15.1821 0.0124
NP_442039.1_4 Reverse -234 -241 15.1821 0.0124
NP_442039.1_4 Reverse -367 -374 11.6422 0.0747
NP_442039.1_7 Forward -400 -390 7.25653 0.277
NP_441811.1_4 Reverse -231 -250 0.786102 0.29
NP_442409.1_10 Forward -320 -306 16.0269 0.266
NP_441926.1_3 Forward -242 -226 5.56507 0.17
NP_442817.1_1 Reverse -249 -268 19.174 0.145
NP_442837.1_3 Forward -241 -234 15.7721 0.0124
NP_442837.1_3 Reverse -234 -241 15.7721 0.0124
NP_442837.1_3 Reverse -146 -153 9.87221 0.106
NP_442837.1_3 Forward -374 -367 6.0373 0.25
NP_442837.1_3 Reverse -367 -374 6.0373 0.25
NP_440160.1_2 Reverse -224 -243 -9.047 0.293
NP_442053.1_1 Forward -242 -233 18.3876 0.0007
NP_442053.1_1 Reverse -233 -242 18.3876 0.0007
NP_442053.1_1 Forward -375 -366 16.6177 0.00257
NP_442053.1_1 Reverse -366 -375 8.65285 0.0741
NP_442053.1_1 Reverse -145 -154 6.5879 0.124
NP_440505.1_3 Reverse -364 -374 16.7946 0.00614
NP_440505.1_3 Forward -244 -234 14.1397 0.0235
NP_440505.1_3 Reverse -231 -241 13.8447 0.0247
NP_440505.1_3 Forward -385 -375 8.82982 0.133
NP_440505.1_3 Reverse -305 -315 5.38824 0.23
NP_441203.1_1 Forward -241 -222 -12.2919 0.143
NP_442532.1_7 Reverse -233 -247 15.8309 0.0587
NP_441408.2_7 Forward -74 -55 -3.44213 0.272
NP_440914.1_1 Forward -375 -365 15.6417 0.00456
NP_440914.1_1 Reverse -252 -262 9.10306 0.186
NP_440914.1_1 Forward -242 -232 8.6151 0.186
NP_440914.1_1 Reverse -233 -243 8.6151 0.186
NP_440914.1_1 Forward -154 -144 6.07773 0.297
NP_441011.1_8 Forward -241 -232 16.9127 0.00602
NP_441011.1_8 Reverse -234 -243 16.9127 0.00602
NP_441011.1_8 Reverse -367 -376 10.8161 0.094
NP_442101.1_10 Reverse -225 -244 -6.68705 0.196
NP_442533.1_6 Forward -242 -233 17.2076 0.00137
NP_442533.1_6 Reverse -233 -242 17.2076 0.00137
NP_442533.1_6 Forward -375 -366 14.2577 0.0132
NP_442533.1_6 Reverse -366 -375 7.47288 0.0898
NP_442533.1_6 Forward -173 -164 7.17789 0.0948
NP_442533.1_6 Reverse -164 -173 6.68623 0.105
NP_442533.1_6 Forward -154 -145 4.91628 0.165
NP_440263.1_5 Forward -348 -334 11.701 0.294
NP_443050.1_3 Reverse -254 -272 17.5221 0.17
NP_442229.1_1 Forward -244 -230 11.5037 0.18
NP_442535.1_9 Reverse -357 -375 -4.01242 0.262
NP_441482.1_7 Forward -381 -367 4.42448 0.0493
NP_441482.1_7 Reverse -360 -374 -10.2268 0.209
NP_439944.1_9 Reverse -234 -244 10.4031 0.0887
NP_439944.1_9 Forward -241 -231 10.3048 0.0887
NP_439944.1_9 Reverse -367 -377 8.04317 0.121
NP_441028.1_6 Reverse -6 -16 8.43603 0.216
NP_440116.1_5 Reverse -363 -380 12.6252 0.09
NP_440116.1_8 Reverse -367 -386 -6.49039 0.211
NP_440116.1_8 Forward -241 -222 -8.752 0.26
NP_441527.1_4 Forward -116 -97 -6.35064 0.217
NP_441527.1_4 Forward -119 -100 -10.0748 0.264
NP_441527.1_4 Forward -339 -320 -11.0297 0.278
NP_441527.1_8 Reverse -213 -232 2.3594 0.279
NP_440115.1_2 Forward -172 -153 18.289 0.221
NP_440115.1_6 Reverse -363 -373 15.0247 0.0505
NP_440115.1_6 Forward -157 -147 13.4514 0.0733
NP_440115.1_6 Forward -245 -235 9.61647 0.115
NP_441602.1_3 Forward -247 -228 9.43923 0.117
NP_441170.1_4 Forward -251 -233 7.29564 0.194
NP_441106.1_1 Reverse -232 -241 18.191 0.0028
NP_441106.1_1 Forward -243 -234 18.191 0.0028
NP_441106.1_1 Forward -174 -165 5.50626 0.145
NP_440429.1_4 Reverse -226 -245 12.2908 0.263
NP_442928.1_6 Reverse -145 -158 18.1122 0.247
NP_442306.1_10 Forward -247 -228 -19.9617 0.201
NP_442306.1_10 Reverse -361 -380 -20.5517 0.213
NP_441286.1_1 Reverse -365 -377 14.4936 0.00418
NP_441286.1_1 Reverse -232 -244 5.25052 0.0259
NP_441286.1_1 Forward -243 -231 4.95553 0.027
NP_441286.1_1 Reverse -144 -156 -4.18925 0.152
NP_441286.1_1 Forward -376 -364 -6.35254 0.26
NP_442674.1_1 Reverse -305 -324 11.5322 0.251
NP_440670.1_8 Forward -242 -233 18.3876 0.000699
NP_440670.1_8 Reverse -233 -242 18.3876 0.000699
NP_440670.1_8 Reverse -366 -375 18.0926 0.00136
NP_440670.1_8 Forward -375 -366 15.831 0.00494
NP_441930.1_2 Reverse -1 -11 12.0747 0.266
NP_440886.1_7 Forward -243 -233 17.7774 0.0011
NP_440886.1_7 Reverse -232 -242 17.7774 0.0011
NP_440886.1_7 Forward -376 -366 6.76441 0.114
NP_440886.1_7 Reverse -74 -84 6.17443 0.141
NP_442614.1_2 Reverse -307 -321 7.37441 0.275
NP_442614.1_2 Reverse -233 -247 6.6861 0.287
NP_442072.1_9 Reverse -232 -250 -12.1739 0.0823
NP_442072.1_9 Forward -243 -225 -21.8103 0.212
NP_442072.1_9 Reverse -225 -243 -23.3836 0.292
NP_441753.1_10 Forward -251 -232 6.4893 0.186
NP_441753.1_10 Reverse -224 -243 4.52268 0.198
NP_441753.1_10 Forward -384 -365 1.67108 0.257
NP_440907.2_8 Reverse -234 -244 17.4824 0.00685
NP_440907.2_8 Forward -241 -231 7.84605 0.117
NP_441021.1_8 Reverse -228 -246 18.3087 0.0605
NP_441021.1_8 Forward -247 -229 3.55906 0.226
NP_440841.1_4 Forward -164 -145 -7.86702 0.249
NP_441463.1_3 Forward -252 -233 8.65258 0.0487
NP_441463.1_3 Reverse -223 -242 0.687771 0.13
NP_441463.1_6 Reverse -231 -245 6.6092 0.267
NP_441626.1_2 Forward -241 -234 15.7721 0.0124
NP_441626.1_2 Reverse -234 -241 15.7721 0.0124
NP_441626.1_2 Reverse -367 -374 12.2322 0.0511
NP_441626.1_2 Forward -374 -367 5.93897 0.231
NP_442365.1_7 Reverse -362 -381 10.1275 0.0723
NP_440107.1_5 Reverse -128 -147 -7.27704 0.281
NP_442794.1_1 Reverse -188 -200 6.62715 0.169
NP_442615.1_1 Reverse -224 -242 4.83737 0.0426
NP_442615.1_1 Forward -251 -233 -3.02911 0.154
NP_441962.1_4 Forward -247 -228 -14.9469 0.296
NP_440387.1_1 Reverse -233 -249 13.9232 0.00763
NP_440387.1_1 Reverse -366 -382 7.92501 0.0282
NP_440387.1_1 Forward -242 -226 -1.12144 0.142
NP_440855.1_5 Reverse -379 -398 6.78348 0.285
NP_441431.1_2 Forward -245 -231 11.307 0.141
NP_441431.1_2 Reverse -230 -244 6.39049 0.272
NP_441488.1_8 Forward -178 -164 8.84875 0.172
NP_441488.1_8 Reverse -361 -375 7.86545 0.221
NP_441993.1_1 Forward -215 -196 5.06532 0.208
NP_440143.1_1 Forward -75 -56 17.2074 0.205
NP_440814.1_8 Forward -78 -59 0.294447 0.269
NP_440114.1_10 Forward -242 -228 16.0275 0.0207
NP_440114.1_10 Reverse -233 -247 14.7492 0.0346
NP_440114.1_10 Reverse -366 -380 12.3893 0.0845
NP_440114.1_10 Reverse -1 -15 5.99778 0.289
NP_441853.1_5 Forward -389 -370 3.53937 0.279
NP_441510.2_7 Reverse -227 -241 10.9137 0.28
NP_441510.2_9 Forward -153 -134 8.35759 0.165
NP_440766.1_4 Reverse -362 -376 8.75105 0.0871
NP_440766.1_4 Reverse -229 -243 8.35772 0.0871
NP_440766.1_4 Forward -246 -232 7.86607 0.0871
NP_440766.1_5 Forward -347 -335 8.41973 0.277
NP_441237.1_9 Reverse -258 -268 11.4848 0.176
NP_441979.1_5 Reverse -227 -246 -12.4886 0.228
NP_439910.1_2 Reverse -225 -242 -11.7609 0.0788
NP_439910.1_2 Forward -250 -233 -12.2525 0.0788
NP_442867.1_8 Forward -241 -222 5.211 0.276
NP_440457.1_1 Reverse -362 -374 10.4621 0.092
NP_440457.1_1 Forward -379 -367 9.57708 0.092
NP_440457.1_1 Forward -158 -146 0.432302 0.25
NP_440457.1_1 Forward -246 -234 0.137309 0.25
NP_440457.1_1 Reverse -229 -241 0.0389777 0.25
NP_440213.1_5 Reverse -52 -71 8.55425 0.275
NP_442940.1_2 Reverse -233 -252 0.196116 0.296
NP_440798.1_6 Forward -241 -228 5.03416 0.14
NP_440798.1_6 Reverse -234 -247 3.5592 0.15
NP_441984.1_3 Forward -246 -228 5.13236 0.295
NP_441332.1_6 Reverse -74 -84 16.9714 0.0994
NP_441332.1_10 Reverse -221 -236 9.61633 0.252
NP_440473.1_1 Reverse -363 -382 16.6562 0.106
NP_442509.1_9 Forward -242 -232 16.2041 0.00739
NP_442509.1_9 Reverse -233 -243 16.2041 0.00739
NP_442509.1_9 Reverse -366 -376 14.6309 0.0263
NP_442509.1_9 Reverse -129 -139 11.9759 0.107
NP_442509.1_9 Reverse -145 -155 8.63269 0.192
NP_442509.1_9 Reverse -226 -236 7.25606 0.229
NP_440524.1_2 Reverse -253 -272 10.7175 0.14
NP_440554.1_4 Forward -241 -231 14.6313 0.02
NP_440554.1_4 Reverse -234 -244 13.943 0.0218
NP_440554.1_4 Forward -374 -364 5.97822 0.128
NP_441885.1_5 Forward -242 -232 11.4848 0.00668
NP_441885.1_5 Reverse -233 -243 11.4848 0.00668
NP_441885.1_5 Forward -375 -365 11.0914 0.00874
NP_441885.1_5 Reverse -366 -376 9.12481 0.0238
NP_441885.1_5 Forward -154 -144 2.04498 0.0868
NP_441428.1_8 Forward -250 -231 11.9958 0.168
NP_442341.1_7 Reverse -232 -246 17.8958 0.0111
NP_442341.1_7 Forward -243 -229 10.0294 0.0682
NP_442341.1_7 Forward -376 -362 8.55439 0.0864
NP_442341.1_7 Reverse -365 -379 2.94952 0.239
NP_442341.1_9 Reverse -305 -319 8.75042 0.166
NP_441756.1_5 Forward -394 -375 -3.93378 0.29
NP_441173.1_9 Reverse -338 -346 12.1137 0.21
NP_442395.2_4 Forward -236 -217 1.27698 0.245
NP_442534.1_7 Reverse -225 -244 6.98095 0.272
NP_440423.1_6 Forward -162 -143 -15.1435 0.229
NP_443000.1_7 Reverse -364 -374 10.2065 0.0355
NP_443000.1_7 Reverse -231 -241 8.73149 0.0437
NP_443000.1_7 Reverse -143 -153 7.25653 0.0927
NP_443000.1_7 Forward -244 -234 2.04498 0.226
NP_440507.2_3 Reverse -224 -243 9.14342 0.234
NP_441842.1_1 Reverse -235 -248 19.0949 0.0142
NP_441842.1_10 Reverse -226 -240 13.4709 0.0753
NP_441842.1_10 Forward -208 -194 10.1277 0.171
NP_441842.1_10 Forward -249 -235 9.34103 0.192
NP_440275.1_3 Forward -244 -234 17.9746 0.0082
NP_440275.1_3 Reverse -364 -374 12.5664 0.0316
NP_440275.1_3 Reverse -231 -241 8.4365 0.0602
NP_440091.1_1 Reverse -229 -241 18.3285 0.0114
NP_440091.1_1 Forward -246 -234 10.1671 0.0498
NP_443010.1_10 Reverse -230 -247 2.28762 0.277
NP_443010.1_10 Forward -245 -228 1.90109 0.289
NP_442451.1_2 Reverse -358 -377 3.24438 0.143
NP_442451.1_2 Reverse -225 -244 -9.34199 0.259
NP_439962.1_4 Reverse -225 -244 -7.37537 0.288
NP_440149.1_8 Forward -375 -356 0.58944 0.134
NP_441105.1_3 Forward -253 -234 0.196116 0.129
NP_441105.1_3 Forward -184 -165 -9.73531 0.295
NP_440216.1_1 Forward -242 -228 16.1259 0.00307
NP_440216.1_1 Reverse -233 -247 -1.27871 0.0303
NP_440216.1_1 Forward -375 -361 -1.77037 0.0383
NP_440216.1_1 Reverse -366 -380 -3.147 0.0729
NP_440216.1_1 Reverse -145 -159 -3.93365 0.0918
NP_440216.1_1 Forward -154 -140 -11.1118 0.163
NP_440216.1_9 Forward -171 -162 15.4377 0.132
NP_440172.1_1 Forward -375 -365 12.0747 0.0322
NP_440172.1_1 Forward -242 -232 8.73149 0.0586
NP_440172.1_1 Reverse -233 -243 8.73149 0.0586
NP_440172.1_1 Reverse -366 -376 6.56821 0.102
NP_440172.1_1 Forward -154 -144 2.43831 0.279
NP_440167.1_3 Forward -82 -63 9.53756 0.251
NP_442015.1_10 Reverse -362 -375 12.0157 0.0372
NP_442015.1_10 Forward -246 -233 3.06754 0.185
NP_442015.1_10 Reverse -160 -173 1.29759 0.206
NP_442015.1_10 Reverse -229 -242 0.904263 0.216
NP_442015.1_10 Reverse -138 -151 0.117615 0.241
NP_442015.1_10 Forward -158 -145 -0.0790467 0.25
NP_442015.1_10 Forward -379 -366 -1.16069 0.297
NP_441226.1_7 Forward -241 -234 14.4934 0.0123
NP_441226.1_7 Reverse -234 -241 14.4934 0.0123
NP_441226.1_7 Reverse -367 -374 12.7234 0.0312
NP_441226.1_7 Forward -374 -367 11.5435 0.0757
NP_442446.1_4 Reverse -232 -251 18.6823 0.123
NP_441535.1_3 Reverse -236 -255 11.1109 0.156
NP_441111.1_7 Forward -241 -233 18.7023 0.00294
NP_441111.1_7 Reverse -234 -242 18.7023 0.00294
NP_441111.1_7 Reverse -367 -375 8.96754 0.0463
NP_441111.1_7 Forward -374 -366 8.86921 0.0589
NP_440244.1_1 Reverse -299 -318 -8.65367 0.287
NP_440244.1_1 Forward -75 -56 -9.24366 0.287
NP_441766.1_2 Forward -242 -233 17.5026 0.00297
NP_441766.1_2 Reverse -233 -242 17.5026 0.00297
NP_441766.1_2 Forward -375 -366 13.9627 0.0114
NP_441766.1_2 Reverse -366 -375 7.76787 0.0714
NP_441766.1_9 Reverse -358 -377 4.62101 0.205
NP_442417.1_5 Forward -369 -355 8.25939 0.164
NP_440416.1_1 Forward -242 -223 -11.3086 0.272
NP_440416.1_1 Reverse -233 -252 -14.4552 0.288
NP_440416.1_9 Reverse -226 -245 -6.29373 0.0884
NP_440416.1_9 Reverse -134 -153 -18.6834 0.262
NP_440416.1_9 Reverse -138 -157 -18.9784 0.267
NP_440416.1_9 Reverse -62 -81 -19.7651 0.278
NP_443052.1_8 Reverse -223 -242 27.0405 0.000423
NP_443052.1_8 Forward -252 -233 9.24257 0.023
NP_443052.1_9 Reverse -376 -395 4.12936 0.156
NP_443052.1_9 Reverse -349 -368 -4.42544 0.258
NP_442403.1_8 Forward -205 -186 0.491109 0.241
NP_441430.1_6 Forward -184 -165 10.6192 0.269
NP_440261.1_5 Reverse -234 -247 6.80412 0.0316
NP_440261.1_5 Reverse -193 -206 -3.32397 0.127
NP_440261.1_5 Forward -374 -361 -6.47056 0.201
NP_440261.1_5 Forward -241 -228 -10.6005 0.201
NP_440988.1_10 Forward -377 -363 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATTGGCCGCAGGGAGTGGCAGTAGGCCGATCGCCAGCGATGCAGTTTAAGGATTTGGCTAAAATTCGGGCTGAAGAAGTTTTTCCCGTTCCCCTGGGGCCCGTAAATAGGTAAGCAGGTACGATGCGCTCCTGTTCAATGGCATTGCTCAATGTGGCGGCGATCGCCGTTTGGCCCACCAAATCTGCAAAGGTCTGGGGGCGATATTTATGGTGCAGAGGTTCGTAGGCCATGGCAAGGTAACCGGGCGATCAACAGACAGGGGGATTCTCAGCCTAACTCCAAAATGCAAAAAAAAGAGGTCAAGTTAACAGCCGGTGACGGGGGTGCTAAAGGCAAAGGGTAAGACGCTTAGAATGAAAGGGTCAGTGTTGATTTGTAAGACTAGAGGGCAATTCCG

CDS

ATGACAGGCCCCGTTATTTTTCACCTCGCTATCCCCGTTAATGATATTGCGAAAACTAAGGAATTTTACTGTGATCGCCTGGGGGCCAAGGCCGGCAGAGAAACCGATAAGGCAATAATTCTAGATTTCTACGGCCATCAGGTGGTGGCCCACATTACCCTGGAACCTTTAGTAAAACAACCGGGCATCTATCCCCGCCATTTTGGTTTAGTATTTCCTGTCGAAGCGGATTGGTTTGCTTTTTCTGAACAGGTGGAAGCGGCCGGAGTGCCCTATCATTTGCCGCCCAAGTTACGCTTTGCTGGAGAATTGACGGAACATCGCACTTTTTTCCTAGCTGACCCCTTCCATAACTATCTGGAATTCAAATGGTATCGTCACCAGGAAGCAATTTTTGATCTGAAAGAGTTTCTGGCCATTGGCGATCGCTAG

Protein

MTGPVIFHLAIPVNDIAKTKEFYCDRLGAKAGRETDKAIILDFYGHQVVAHITLEPLVKQPGIYPRHFGLVFPVEADWFAFSEQVEAAGVPYHLPPKLRFAGELTEHRTFFLADPFHNYLEFKWYRHQEAIFDLKEFLAIGDR