Your browser is old and dusty. Try Google Chrome!

Details for slr1425

ORF slr1425
Accession NP_442824.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -395 -388 14.6904 0.0123
NP_440795.1_7 Reverse -388 -395 14.6904 0.0123
NP_442291.1_5 Forward -397 -381 -3.08806 0.234
NP_440897.1_6 Forward -355 -336 -4.32786 0.273
NP_441453.1_4 Reverse -387 -395 16.539 0.00633
NP_441453.1_4 Forward -396 -388 16.539 0.00633
NP_441453.1_7 Reverse -341 -348 11.9372 0.298
NP_442151.1_6 Reverse -192 -206 11.2093 0.106
NP_442151.1_6 Forward -396 -382 7.57108 0.194
NP_440226.1_1 Forward -396 -377 7.96426 0.0959
NP_440996.1_3 Forward -39 -21 10.4422 0.247
NP_442655.1_2 Reverse -155 -174 7.07928 0.159
NP_442173.1_1 Forward -395 -387 15.4574 0.00633
NP_442173.1_1 Reverse -388 -396 15.4574 0.00633
NP_442752.1_4 Forward -396 -389 13.8055 0.0199
NP_442752.1_4 Reverse -387 -394 13.8055 0.0199
NP_443027.1_4 Reverse -385 -395 13.2547 0.0521
NP_441812.1_1 Forward -127 -113 13.5686 0.231
NP_441812.1_3 Forward -397 -383 10.4227 0.222
NP_442975.1_10 Reverse -383 -397 3.93223 0.249
NP_441675.1_4 Forward -48 -29 5.211 0.245
NP_440784.1_7 Forward -395 -388 15.9687 0.0123
NP_440784.1_7 Reverse -388 -395 15.9687 0.0123
NP_440061.1_9 Forward -398 -384 11.5037 0.109
NP_440061.1_9 Reverse -385 -399 10.5204 0.124
NP_442062.1_8 Reverse -387 -397 17.3846 0.00193
NP_442062.1_8 Forward -396 -386 10.3048 0.0493
NP_442062.1_8 Forward -37 -27 2.7333 0.297
NP_441900.1_2 Reverse -369 -387 0.706727 0.258
NP_440304.1_4 Reverse -385 -395 10.8948 0.051
NP_440304.1_4 Forward -398 -388 1.84832 0.299
NP_442242.1_4 Forward -395 -388 14.3954 0.0124
NP_442242.1_4 Reverse -388 -395 14.3954 0.0124
NP_440908.1_7 Reverse -179 -189 18.1713 0.285
NP_439918.1_2 Reverse -274 -293 -2.55715 0.244
NP_441208.1_9 Forward -399 -385 16.5192 0.0647
NP_440132.1_1 Forward -203 -185 23.3236 0.00786
NP_442110.1_7 Forward -396 -382 2.5562 0.222
NP_440856.1_4 Reverse -380 -399 0.392778 0.167
NP_440856.1_7 Forward -204 -185 -2.45882 0.191
NP_441083.1_5 Reverse -387 -397 20.3345 0.00053
NP_441083.1_5 Forward -396 -386 11.2881 0.0159
NP_441738.1_2 Forward -394 -387 15.28 0.0102
NP_441738.1_2 Reverse -389 -396 15.28 0.0102
NP_441738.1_2 Forward -253 -246 6.52862 0.261
NP_441738.1_2 Reverse -156 -163 6.03696 0.295
NP_440209.1_1 Reverse -387 -395 18.1123 0.00295
NP_440209.1_1 Forward -396 -388 18.1123 0.00295
NP_440209.1_5 Forward -395 -377 6.90232 0.272
NP_442889.1_8 Reverse -384 -398 11.307 0.0733
NP_440447.1_1 Reverse -382 -400 3.85406 0.245
NP_440447.1_6 Reverse -119 -137 5.03403 0.159
NP_440178.1_7 Forward -397 -378 -2.95047 0.0423
NP_442706.1_5 Reverse -30 -49 13.9204 0.245
NP_442111.1_4 Forward -397 -383 13.1759 0.0394
NP_441163.1_1 Reverse -22 -39 9.87119 0.223
NP_440906.1_5 Forward -395 -388 15.8704 0.0124
NP_440906.1_5 Reverse -388 -395 15.8704 0.0124
NP_440747.1_10 Forward -399 -387 24.7201 0.00036
NP_440747.1_10 Reverse -384 -396 17.1486 0.000663
NP_440747.1_10 Reverse -343 -355 -12.3507 0.27
NP_441486.1_1 Forward -399 -385 -2.45868 0.175
NP_441486.1_1 Reverse -384 -398 -2.55701 0.175
NP_442634.1_4 Reverse -385 -399 7.86607 0.0479
NP_442634.1_4 Forward -398 -384 -1.27871 0.149
NP_442634.1_4 Forward -203 -189 -5.80194 0.279
NP_441265.1_3 Reverse -381 -395 1.67122 0.2
NP_440842.1_6 Forward -203 -184 11.11 0.261
NP_440057.1_4 Forward -135 -116 12.5249 0.299
NP_442848.1_1 Reverse -148 -162 4.22782 0.109
NP_442848.1_9 Forward -336 -317 17.6007 0.0923
NP_443018.1_3 Forward -395 -388 14.8871 0.0123
NP_443018.1_3 Reverse -388 -395 14.8871 0.0123
NP_441316.1_7 Reverse -385 -400 2.5365 0.154
NP_441634.1_8 Forward -387 -373 4.12949 0.135
NP_441634.1_8 Reverse -250 -264 -4.22864 0.295
NP_440376.1_1 Forward -396 -387 19.4693 0.000692
NP_440376.1_1 Reverse -387 -396 19.4693 0.000692
NP_440376.1_1 Reverse -165 -174 0.884706 0.259
NP_441588.1_4 Reverse -389 -399 9.02648 0.14
NP_442687.1_7 Reverse -386 -396 9.02648 0.0994
NP_442687.1_7 Forward -397 -387 8.92815 0.0994
NP_442485.1_3 Reverse -181 -200 -0.197208 0.252
NP_441846.1_10 Forward -49 -30 -23.5016 0.289
NP_440642.1_10 Reverse -80 -94 5.1122 0.242
NP_442296.1_5 Reverse -378 -397 4.32602 0.251
NP_440236.1_2 Forward -142 -124 -4.99573 0.277
NP_442658.1_1 Reverse -385 -395 14.2375 0.0237
NP_442658.1_1 Forward -257 -247 7.94438 0.199
NP_442658.1_1 Forward -398 -388 6.76441 0.214
NP_442782.1_2 Forward -396 -382 8.84938 0.198
NP_441414.1_9 Forward -396 -377 -0.787193 0.0943
NP_441958.1_5 Reverse -386 -396 21.2195 0.000805
NP_441958.1_5 Forward -397 -387 12.2714 0.00183
NP_440203.1_5 Forward -171 -161 12.7626 0.138
NP_440203.1_5 Reverse -390 -400 11.8776 0.171
NP_440984.1_7 Reverse -382 -396 16.0275 0.0466
NP_440153.1_5 Forward -395 -381 5.01447 0.193
NP_442051.1_5 Forward -94 -75 9.14423 0.29
NP_440993.1_2 Reverse -382 -398 2.41848 0.265
NP_440827.1_3 Forward -179 -160 13.2741 0.226
NP_441099.1_5 Reverse -377 -396 -10.817 0.262
NP_442002.1_9 Reverse -27 -34 9.77388 0.258
NP_441294.1_7 Forward -178 -164 10.5945 0.181
NP_440411.1_10 Reverse -271 -290 12.7015 0.26
NP_441646.1_1 Reverse -366 -385 -1.7705 0.294
NP_441646.1_1 Forward -362 -343 -1.96717 0.298
NP_441000.1_6 Forward -397 -383 -3.83532 0.225
NP_441000.1_6 Forward -256 -242 -5.11362 0.261
NP_440484.1_3 Reverse -385 -399 10.7177 0.242
NP_440484.1_3 Forward -96 -82 9.2427 0.27
NP_440147.1_4 Forward -398 -385 18.4072 0.00407
NP_440147.1_4 Reverse -385 -398 10.344 0.0355
NP_440147.1_4 Reverse -26 -39 3.16588 0.193
NP_441550.1_8 Reverse -385 -395 15.8108 0.0132
NP_441550.1_8 Forward -398 -388 14.6309 0.0132
NP_441916.1_7 Forward -396 -386 18.9579 0.00144
NP_441916.1_7 Reverse -387 -397 10.3048 0.0261
NP_441916.1_10 Reverse -379 -398 3.04771 0.236
NP_441916.1_10 Reverse -239 -258 0.392778 0.285
NP_440345.1_5 Reverse -1 -15 14.2385 0.276
NP_441041.1_4 Forward -396 -377 0.884433 0.0829
NP_441041.1_7 Reverse -384 -396 13.3454 0.0485
NP_441041.1_7 Forward -399 -387 8.58373 0.133
NP_442396.1_5 Forward -400 -387 11.6223 0.0913
NP_441725.1_4 Reverse -382 -396 4.03056 0.278
NP_441725.1_5 Reverse -388 -398 2.04498 0.115
NP_441725.1_5 Forward -395 -385 1.94665 0.115
NP_439966.1_7 Reverse -385 -395 14.3359 0.0203
NP_439966.1_7 Forward -398 -388 7.25606 0.15
NP_439966.1_7 Forward -257 -247 4.20782 0.285
NP_439966.1_9 Forward -358 -349 4.42462 0.253
NP_442941.1_3 Forward -395 -385 19.2529 0.00262
NP_442941.1_3 Reverse -388 -398 11.0914 0.0116
NP_440289.1_2 Reverse -384 -397 3.16588 0.0811
NP_441514.1_6 Forward -94 -87 14.2971 0.248
NP_442281.1_1 Reverse -382 -396 16.9119 0.00698
NP_441334.1_7 Forward -398 -379 -20.1584 0.275
NP_442256.1_2 Forward -398 -380 0.314141 0.123
NP_440437.1_1 Reverse -381 -400 -2.45882 0.219
NP_440647.1_9 Forward -398 -380 13.2938 0.125
NP_442012.1_1 Forward -362 -343 3.04771 0.188
NP_439983.1_7 Forward -40 -22 9.55725 0.287
NP_442049.1_4 Forward -390 -371 -0.295539 0.256
NP_441556.1_4 Reverse -183 -202 11.0656 0.257
NP_440498.1_1 Reverse -378 -396 0.117479 0.218
NP_441644.1_6 Forward -396 -386 19.0557 0.000803
NP_441644.1_6 Reverse -387 -397 17.3841 0.00127
NP_442215.1_2 Forward -398 -382 -0.43312 0.167
NP_442215.1_2 Forward -176 -160 -2.89139 0.206
NP_440929.1_8 Forward -396 -387 19.2726 0.000701
NP_440929.1_8 Reverse -387 -396 19.2726 0.000701
NP_440929.1_8 Forward -174 -165 2.06468 0.268
NP_442933.1_10 Forward -396 -387 17.601 0.00325
NP_442933.1_10 Reverse -387 -396 17.601 0.00325
NP_441751.2_8 Forward -395 -381 -2.26202 0.132
NP_442554.1_8 Forward -395 -385 17.2863 0.00543
NP_442554.1_8 Reverse -388 -398 15.3197 0.00882
NP_441762.1_7 Reverse -386 -398 0.530633 0.0747
NP_441762.1_7 Reverse -245 -257 -6.2542 0.284
NP_441762.1_7 Forward -397 -385 -6.84419 0.284
NP_442142.1_4 Reverse -384 -397 12.9 0.0406
NP_442142.1_4 Forward -399 -386 12.8017 0.0409
NP_442142.1_4 Reverse -183 -196 4.64028 0.214
NP_442292.1_1 Reverse -388 -397 18.486 0.00229
NP_442292.1_1 Forward -395 -386 17.5026 0.00435
NP_441711.1_4 Reverse -378 -397 7.17762 0.144
NP_443009.1_5 Forward -397 -386 14.5128 0.02
NP_443009.1_5 Reverse -386 -397 10.1862 0.0792
NP_442408.2_1 Forward -249 -230 -7.37537 0.299
NP_441715.1_4 Forward -395 -385 16.7946 0.0106
NP_441715.1_4 Reverse -388 -398 7.94484 0.107
NP_441198.1_1 Reverse -373 -392 3.73603 0.217
NP_440379.1_6 Forward -396 -377 9.63589 0.191
NP_440464.1_10 Reverse -388 -398 13.0082 0.169
NP_441468.1_1 Forward -395 -388 15.8704 0.0124
NP_441468.1_1 Reverse -388 -395 15.8704 0.0124
NP_441020.2_6 Forward -398 -381 9.57695 0.168
NP_441020.2_6 Reverse -61 -78 9.47861 0.17
NP_441673.1_1 Forward -396 -387 20.8459 0.000698
NP_441673.1_1 Reverse -387 -396 20.8459 0.000698
NP_440286.1_1 Forward -151 -133 12.7038 0.166
NP_441172.1_8 Reverse -62 -76 18.1908 0.151
NP_442868.1_6 Reverse -385 -395 10.4031 0.038
NP_442868.1_6 Forward -398 -388 9.81313 0.038
NP_441612.1_2 Forward -87 -77 8.74291 0.21
NP_441612.1_2 Reverse -387 -397 8.54929 0.21
NP_442227.1_9 Forward -350 -331 17.699 0.126
NP_442808.1_1 Reverse -386 -396 8.73102 0.0481
NP_442808.1_1 Forward -397 -387 8.63269 0.0481
NP_440145.1_3 Reverse -377 -396 1.37609 0.129
NP_441906.1_5 Reverse -27 -46 8.06178 0.289
NP_442050.1_5 Reverse -385 -395 15.9091 0.0091
NP_442050.1_5 Forward -398 -388 7.64939 0.243
NP_440558.1_2 Forward -151 -132 -3.54046 0.236
NP_442789.1_4 Forward -203 -184 5.01433 0.148
NP_441878.1_6 Reverse -386 -396 10.5014 0.0176
NP_441878.1_6 Forward -397 -387 10.4031 0.0176
NP_441036.1_8 Reverse -386 -396 15.713 0.00724
NP_441036.1_8 Forward -397 -387 8.33817 0.174
NP_441557.1_5 Forward -396 -387 19.9609 0.000699
NP_441557.1_5 Reverse -387 -396 19.9609 0.000699
NP_442066.2_4 Forward -396 -377 -5.99873 0.246
NP_440084.1_6 Reverse -59 -73 17.8105 0.297
NP_441308.1_8 Reverse -62 -72 11.8781 0.22
NP_441564.1_10 Reverse -250 -269 3.24438 0.269
NP_442183.1_9 Forward -43 -33 11.0914 0.229
NP_441574.1_1 Forward -385 -366 -1.57384 0.22
NP_441549.1_9 Forward -400 -382 -4.30741 0.198
NP_440157.1_5 Forward -95 -76 20.3871 0.0889
NP_442170.1_5 Forward -396 -377 3.34271 0.172
NP_442347.1_2 Reverse -388 -397 12.4878 0.056
NP_442347.1_2 Forward -395 -386 3.34298 0.284
NP_442645.1_2 Reverse -238 -257 -16.3235 0.23
NP_442645.1_2 Reverse -379 -398 -22.6167 0.292
NP_442965.1_2 Forward -55 -36 -8.16202 0.277
NP_441037.1_4 Forward -398 -388 7.9999 0.237
NP_441037.1_4 Reverse -385 -395 7.22024 0.237
NP_441633.1_3 Forward -398 -385 1.10092 0.109
NP_441633.1_3 Reverse -385 -398 -3.71729 0.177
NP_442764.1_3 Forward -382 -372 16.4013 0.295
NP_440136.1_2 Forward -395 -388 15.9687 0.0123
NP_440136.1_2 Reverse -388 -395 15.9687 0.0123
NP_440136.1_2 Reverse -247 -254 11.1505 0.0519
NP_442590.1_10 Forward -388 -369 3.53937 0.29
NP_442998.1_10 Forward -394 -387 15.5754 0.0102
NP_442998.1_10 Reverse -389 -396 15.5754 0.0102
NP_440299.1_1 Forward -400 -387 12.605 0.0362
NP_441799.1_1 Forward -400 -386 18.6818 0.00832
NP_441799.1_1 Reverse -383 -397 14.3553 0.0242
NP_441007.1_10 Reverse -382 -395 1.39592 0.203
NP_440256.1_1 Forward -399 -380 6.78429 0.0288
NP_440256.1_1 Reverse -343 -362 -4.91709 0.169
NP_441559.1_8 Forward -360 -346 6.19444 0.0806
NP_441559.1_8 Reverse -341 -355 2.5562 0.143
NP_441559.1_8 Reverse -382 -396 1.47456 0.155
NP_440915.1_6 Forward -400 -386 3.14618 0.107
NP_440915.1_6 Reverse -383 -397 1.08123 0.147
NP_441296.1_9 Reverse -84 -97 9.65513 0.277
NP_442785.1_7 Reverse -385 -399 10.7177 0.228
NP_440749.1_6 Forward -365 -346 7.96426 0.275
NP_440748.1_5 Forward -166 -147 -0.39387 0.26
NP_440026.1_7 Reverse -382 -397 15.7129 0.188
NP_441939.1_3 Forward -395 -376 16.2241 0.0417
NP_442386.1_9 Forward -397 -388 13.8639 0.0289
NP_442386.1_9 Forward -256 -247 11.209 0.0993
NP_442386.1_9 Reverse -386 -395 6.39082 0.219
NP_442386.1_9 Forward -295 -286 4.7192 0.289
NP_441340.1_5 Forward -395 -388 15.6737 0.0124
NP_441340.1_5 Reverse -388 -395 15.6737 0.0124
NP_441506.1_1 Reverse -103 -122 12.8642 0.283
NP_442240.1_2 Forward -395 -376 -10.522 0.137
NP_440586.1_1 Forward -386 -367 -5.80207 0.29
NP_440586.1_8 Forward -395 -388 13.2151 0.026
NP_440586.1_8 Reverse -388 -395 13.2151 0.026
NP_442251.1_6 Forward -395 -388 15.2804 0.0124
NP_442251.1_6 Reverse -388 -395 15.2804 0.0124
NP_440192.1_4 Forward -220 -201 9.39761 0.276
NP_441262.1_3 Reverse -387 -394 14.7888 0.0223
NP_441262.1_3 Forward -396 -389 14.7888 0.0223
NP_440027.1_8 Forward -399 -380 4.71854 0.287
NP_443051.1_1 Reverse -386 -395 19.5676 0.00335
NP_443051.1_1 Forward -397 -388 10.4228 0.00754
NP_440398.1_2 Reverse -313 -332 3.24438 0.237
NP_440408.1_7 Forward -361 -342 10.0292 0.253
NP_440439.1_1 Reverse -384 -397 10.934 0.0339
NP_440439.1_1 Forward -399 -386 0.0192843 0.203
NP_439943.1_1 Reverse -322 -341 -8.55534 0.28
NP_440372.1_2 Forward -395 -388 16.3621 0.0124
NP_440372.1_2 Reverse -388 -395 16.3621 0.0124
NP_441138.1_5 Reverse -297 -310 4.16793 0.297
NP_441789.1_7 Reverse -378 -397 3.9319 0.193
NP_441803.1_2 Forward -336 -317 4.03102 0.182
NP_441803.1_2 Reverse -187 -206 -1.18052 0.294
NP_441572.1_7 Reverse -381 -400 -4.32711 0.232
NP_440267.1_2 Reverse -382 -396 20.5501 0.00946
NP_440267.1_2 Reverse -367 -381 5.99717 0.248
NP_442384.1_10 Reverse -387 -400 15.5556 0.00986
NP_442384.1_10 Forward -396 -383 9.95071 0.047
NP_442384.1_10 Reverse -346 -359 5.23083 0.134
NP_442384.1_10 Forward -365 -352 2.57589 0.22
NP_440221.1_8 Reverse -128 -147 11.7008 0.295
NP_441018.1_7 Reverse -122 -141 9.63589 0.22
NP_440399.1_1 Forward -273 -254 29.3021 0.000714
NP_440399.1_2 Forward -165 -146 21.3373 0.0186
NP_440399.1_3 Forward -57 -38 30.2854 0.00018
NP_440399.1_4 Forward -192 -173 26.6471 0.00564
NP_440399.1_5 Forward -294 -275 24.778 0.0184
NP_440399.1_9 Forward -212 -193 24.8772 0.0114
NP_442262.1_10 Forward -395 -388 14.1988 0.0123
NP_442262.1_10 Reverse -388 -395 14.1988 0.0123
NP_441689.1_5 Reverse -385 -395 8.3377 0.132
NP_441689.1_5 Forward -398 -388 5.78111 0.197
NP_440531.1_6 Reverse -379 -398 5.99764 0.112
NP_441965.1_10 Reverse -384 -400 13.2349 0.103
NP_441965.1_10 Reverse -319 -335 3.20513 0.271
NP_442693.1_6 Forward -283 -264 1.0811 0.278
NP_440297.1_9 Reverse -388 -398 -0.118297 0.282
NP_440297.1_9 Forward -395 -385 -0.216628 0.282
NP_440100.1_3 Reverse -380 -399 -1.96717 0.166
NP_442280.1_1 Forward -396 -377 9.53756 0.162
NP_441103.1_9 Forward -247 -237 12.7825 0.284
NP_440999.1_9 Reverse -383 -397 0.687908 0.177
NP_440999.1_9 Forward -322 -308 -1.96703 0.254
NP_440999.1_9 Forward -400 -386 -2.36035 0.268
NP_440999.1_9 Reverse -372 -386 -2.36035 0.268
NP_440888.1_2 Forward -396 -382 13.2736 0.0307
NP_440600.1_4 Reverse -379 -397 -0.0791831 0.146
NP_439969.1_3 Forward -386 -367 -1.27885 0.275
NP_442277.1_4 Forward -260 -241 6.1935 0.165
NP_441543.1_2 Reverse -388 -397 16.9127 0.00359
NP_441543.1_2 Forward -395 -386 15.9293 0.00518
NP_442845.1_2 Forward -174 -160 8.75105 0.187
NP_442845.1_2 Reverse -279 -293 7.66941 0.195
NP_442845.1_2 Reverse -159 -173 6.3911 0.21
NP_441551.1_5 Forward -400 -384 8.02265 0.241
NP_441469.1_8 Forward -256 -247 12.6844 0.0995
NP_441469.1_8 Reverse -386 -395 6.5879 0.227
NP_441469.1_8 Forward -397 -388 6.48957 0.227
NP_443064.1_6 Reverse -387 -397 12.5669 0.0796
NP_443064.1_6 Forward -396 -386 10.8217 0.13
NP_443064.1_6 Forward -355 -345 9.75513 0.199
NP_442578.1_7 Forward -395 -388 14.5921 0.026
NP_442578.1_7 Reverse -388 -395 14.5921 0.026
NP_442578.1_7 Reverse -193 -200 6.62729 0.18
NP_440710.1_1 Reverse -379 -397 9.0656 0.0983
NP_440220.1_4 Reverse -146 -165 -3.04956 0.285
NP_441462.1_2 Forward -396 -386 20.2362 0.000805
NP_441462.1_2 Reverse -387 -397 11.5831 0.00406
NP_441621.1_7 Forward -398 -384 -5.21195 0.248
NP_441621.1_7 Reverse -262 -276 -5.80194 0.263
NP_443062.1_1 Forward -396 -378 19.5642 0.0208
NP_443062.1_1 Forward -168 -150 3.86557 0.282
NP_442204.1_1 Reverse -383 -394 11.3667 0.0565
NP_442204.1_6 Forward -394 -375 14.9458 0.1
NP_442872.1_1 Reverse -35 -54 -12.6852 0.255
NP_440516.1_8 Forward -396 -387 16.9127 0.00442
NP_440516.1_8 Reverse -387 -396 16.9127 0.00442
NP_442080.1_7 Reverse -342 -361 3.04771 0.169
NP_442428.1_5 Forward -395 -388 15.8704 0.0124
NP_442428.1_5 Reverse -388 -395 15.8704 0.0124
NP_440673.1_3 Forward -394 -387 12.4288 0.0426
NP_440673.1_3 Reverse -389 -396 12.4288 0.0426
NP_441052.1_2 Reverse -387 -397 19.9412 0.00106
NP_441052.1_2 Forward -396 -386 10.4031 0.0285
NP_441052.1_2 Forward -29 -19 1.16001 0.25
NP_442219.1_9 Reverse -388 -397 17.7976 0.00718
NP_442219.1_9 Forward -395 -386 8.25953 0.0681
NP_440436.1_4 Reverse -388 -397 17.2072 0.00233
NP_440436.1_4 Forward -395 -386 9.24241 0.0871
NP_441884.1_8 Forward -397 -378 -9.73531 0.268
NP_441884.1_9 Forward -361 -342 -21.83 0.266
NP_440648.1_1 Forward -396 -377 22.7139 0.015
NP_439982.1_10 Reverse -130 -149 13.1758 0.263
NP_441719.1_4 Forward -395 -388 16.3621 0.0124
NP_441719.1_4 Reverse -388 -395 16.3621 0.0124
NP_441004.1_1 Forward -201 -182 -10.1286 0.218
NP_441004.1_1 Reverse -229 -248 -16.4218 0.284
NP_442366.1_5 Forward -399 -389 14.0409 0.0497
NP_440328.1_4 Reverse -381 -400 13.3725 0.0451
NP_443054.1_2 Reverse -385 -399 -0.393733 0.294
NP_442430.1_10 Reverse -377 -396 19.8614 0.0391
NP_441851.1_10 Forward -397 -387 15.8113 0.00552
NP_441851.1_10 Reverse -386 -396 8.53483 0.114
NP_441851.1_10 Reverse -245 -255 5.48657 0.211
NP_442622.1_8 Forward -396 -378 -18.7621 0.268
NP_442011.1_1 Reverse -164 -183 -2.85214 0.283
NP_442515.1_1 Reverse -372 -386 7.17775 0.0939
NP_442515.1_1 Forward -397 -383 3.04785 0.125
NP_442515.1_1 Reverse -386 -400 -4.52363 0.298
NP_441349.1_10 Reverse -377 -396 -0.885524 0.0967
NP_440874.1_3 Reverse -378 -396 12.9988 0.114
NP_440432.1_9 Forward -395 -380 14.3362 0.0148
NP_440432.1_9 Forward -250 -235 -6.01829 0.28
NP_442843.1_1 Reverse -166 -185 -6.78538 0.245
NP_442843.1_1 Reverse -247 -266 -11.0136 0.285
NP_442843.1_1 Forward -45 -26 -11.0136 0.285
NP_439960.1_10 Forward -392 -374 -2.73412 0.258
NP_439960.1_10 Reverse -339 -357 -3.32411 0.27
NP_442450.1_5 Forward -398 -388 7.55152 0.13
NP_442006.1_2 Forward -100 -83 -7.92597 0.189
NP_441570.1_1 Forward -396 -378 8.37728 0.0138
NP_441570.1_1 Forward -201 -183 -2.73412 0.0673
NP_441078.1_4 Forward -396 -387 19.6659 0.0007
NP_441078.1_4 Reverse -387 -396 19.6659 0.0007
NP_441663.1_8 Reverse -381 -400 21.0423 0.028
NP_440707.1_6 Reverse -379 -398 20.1564 0.0398
NP_440526.1_3 Reverse -388 -399 8.02298 0.126
NP_440526.1_3 Forward -281 -270 3.8931 0.267
NP_441432.1_8 Reverse -386 -395 16.8143 0.00595
NP_441432.1_8 Forward -397 -388 16.8143 0.00595
NP_441432.1_8 Reverse -164 -173 8.55452 0.0755
NP_441732.1_2 Reverse -383 -399 -6.7263 0.0495
NP_441732.1_2 Forward -400 -384 -17.346 0.253
NP_441030.1_6 Forward -398 -379 15.3545 0.184
NP_440760.1_9 Reverse -37 -56 8.35759 0.281
NP_442797.1_6 Reverse -330 -349 9.58243 0.243
NP_440913.1_1 Forward -398 -380 4.83737 0.254
NP_442489.1_7 Forward -396 -387 20.1576 0.000695
NP_442489.1_7 Reverse -387 -396 20.1576 0.000695
NP_440559.1_1 Reverse -388 -397 17.4043 0.00658
NP_440559.1_1 Forward -395 -386 8.65285 0.0586
NP_441659.2_8 Forward -396 -386 20.9245 0.000805
NP_441659.2_8 Reverse -387 -397 18.1713 0.00133
NP_442913.1_10 Reverse -378 -397 9.83255 0.0434
NP_441040.1_5 Forward -260 -241 8.45592 0.226
NP_442008.1_2 Forward -399 -380 5.30933 0.226
NP_440708.1_4 Reverse -122 -141 7.96426 0.221
NP_441800.1_7 Reverse -368 -386 3.85406 0.198
NP_442776.1_1 Reverse -376 -395 5.89931 0.24
NP_442346.1_5 Forward -397 -387 16.6963 0.00248
NP_442346.1_5 Reverse -386 -396 16.303 0.00248
NP_442346.1_5 Forward -202 -192 4.69992 0.276
NP_440545.1_3 Forward -400 -383 3.77542 0.079
NP_440545.1_3 Reverse -383 -400 -2.12444 0.179
NP_441856.1_3 Forward -399 -380 -1.18052 0.235
NP_441629.1_3 Reverse -380 -399 2.26028 0.218
NP_441923.1_6 Forward -194 -180 18.1908 0.109
NP_441888.1_7 Forward -360 -346 0.88457 0.276
NP_441050.1_5 Reverse -238 -256 -1.84914 0.271
NP_441833.1_4 Forward -395 -388 15.9687 0.0124
NP_441833.1_4 Reverse -388 -395 15.9687 0.0124
NP_442799.1_2 Reverse -88 -107 -0.197208 0.28
NP_441112.1_6 Reverse -377 -396 -2.75381 0.296
NP_442162.1_9 Forward -395 -388 16.2637 0.0124
NP_442162.1_9 Reverse -388 -395 16.2637 0.0124
NP_440671.1_4 Reverse -159 -173 5.40779 0.283
NP_440671.1_4 Reverse -102 -116 5.40779 0.283
NP_442199.1_5 Reverse -379 -398 -0.787193 0.177
NP_442199.1_8 Forward -391 -372 13.3725 0.105
NP_442140.1_3 Reverse -388 -398 12.2714 0.0632
NP_442140.1_3 Forward -395 -385 4.69992 0.238
NP_440875.1_9 Forward -394 -384 16.5483 0.0145
NP_441813.1_5 Reverse -385 -395 18.1713 0.00743
NP_441813.1_5 Forward -398 -388 8.63316 0.0367
NP_440594.1_10 Reverse -331 -345 16.7152 0.263
NP_440590.1_4 Forward -395 -382 -5.38892 0.277
NP_440567.1_1 Forward -395 -381 0.294584 0.25
NP_442497.1_10 Forward -395 -386 17.601 0.00813
NP_442497.1_10 Reverse -388 -397 10.4228 0.0087
NP_440821.1_4 Forward -398 -388 9.41981 0.0286
NP_440821.1_4 Reverse -385 -395 2.24165 0.131
NP_441239.1_9 Reverse -385 -397 13.0187 0.0389
NP_441239.1_9 Forward -398 -386 3.38223 0.285
NP_441892.1_1 Reverse -378 -395 -0.354483 0.182
NP_440665.1_1 Forward -282 -263 -14.9469 0.264
NP_440604.1_6 Forward -396 -377 6.78429 0.107
NP_442270.1_9 Reverse -92 -111 -11.1119 0.266
NP_442643.1_3 Forward -55 -36 -7.4737 0.277
NP_441769.1_3 Reverse -31 -50 -0.29631 0.221
NP_442138.1_1 Reverse -184 -203 0.686995 0.278
NP_440546.1_4 Forward -396 -386 13.5365 0.0459
NP_440546.1_4 Reverse -387 -397 10.046 0.109
NP_440546.1_6 Forward -191 -172 6.98095 0.282
NP_442041.1_5 Reverse -253 -272 1.76941 0.257
NP_440462.1_6 Reverse -385 -395 18.7612 0.00454
NP_440462.1_6 Forward -398 -388 1.35667 0.294
NP_442611.1_1 Forward -396 -377 -0.688862 0.268
NP_442592.1_3 Reverse -250 -269 7.96426 0.298
NP_440868.1_4 Forward -400 -388 15.1819 0.0164
NP_440868.1_4 Reverse -383 -395 14.7886 0.0169
NP_442499.1_1 Forward -308 -289 3.6377 0.252
NP_441474.1_1 Reverse -377 -396 -0.0996487 0.255
NP_442402.1_4 Forward -363 -344 -6.3928 0.257
NP_441084.1_6 Forward -132 -118 9.05325 0.295
NP_439942.1_7 Reverse -333 -352 1.0811 0.21
NP_440696.1_3 Forward -396 -378 -2.83245 0.279
NP_442039.1_4 Forward -395 -388 15.1821 0.0124
NP_442039.1_4 Reverse -388 -395 15.1821 0.0124
NP_441811.1_1 Reverse -372 -391 3.93269 0.299
NP_441926.1_3 Forward -396 -380 6.05672 0.17
NP_440825.1_6 Reverse -265 -284 16.0274 0.218
NP_440825.1_7 Reverse -388 -398 12.9096 0.152
NP_442837.1_3 Forward -395 -388 15.7721 0.0124
NP_442837.1_3 Reverse -388 -395 15.7721 0.0124
NP_442053.1_1 Forward -396 -387 18.3876 0.0007
NP_442053.1_1 Reverse -387 -396 18.3876 0.0007
NP_440505.1_3 Reverse -385 -395 17.188 0.00332
NP_440505.1_3 Forward -398 -388 9.22315 0.122
NP_440505.1_7 Forward -389 -370 1.0811 0.25
NP_440351.1_8 Reverse -155 -173 6.50899 0.26
NP_440914.1_1 Reverse -387 -397 17.5935 0.000537
NP_440914.1_1 Forward -396 -386 16.3248 0.00196
NP_440914.1_1 Forward -282 -272 8.12715 0.207
NP_440914.1_1 Reverse -64 -74 7.5416 0.232
NP_441011.1_8 Forward -395 -386 16.6177 0.00602
NP_441011.1_8 Reverse -388 -397 8.25953 0.144
NP_441011.1_8 Forward -364 -355 7.86621 0.165
NP_442101.1_10 Reverse -379 -398 2.94938 0.0714
NP_440724.1_6 Forward -400 -381 9.24257 0.249
NP_442533.1_6 Forward -396 -387 17.2076 0.00137
NP_442533.1_6 Reverse -387 -396 17.2076 0.00137
NP_442232.1_3 Reverse -238 -257 -15.0452 0.288
NP_442322.1_4 Forward -257 -240 -2.32179 0.23
NP_443016.1_1 Reverse -381 -400 -6.78538 0.263
NP_441482.1_7 Reverse -381 -395 -2.85201 0.1
NP_439944.1_9 Reverse -388 -398 10.5014 0.0887
NP_439944.1_9 Forward -395 -385 9.12481 0.1
NP_440116.1_4 Reverse -68 -87 9.24257 0.251
NP_440116.1_5 Forward -399 -382 6.52869 0.167
NP_441527.1_4 Forward -98 -79 -12.3666 0.285
NP_440115.1_6 Reverse -384 -394 14.0414 0.0615
NP_440115.1_6 Forward -399 -389 9.32148 0.115
NP_440007.1_9 Reverse -161 -175 12.8809 0.163
NP_440007.1_9 Forward -205 -191 1.76955 0.285
NP_440007.1_9 Forward -172 -158 1.37622 0.285
NP_440007.1_9 Reverse -383 -397 0.786239 0.29
NP_441059.1_10 Forward -95 -82 12.704 0.226
NP_441059.1_10 Forward -101 -88 12.3107 0.226
NP_441106.1_1 Reverse -386 -395 18.486 0.0028
NP_441106.1_1 Forward -397 -388 9.63616 0.0311
NP_440429.1_2 Reverse -247 -266 10.4225 0.267
NP_441286.1_1 Forward -397 -385 5.93884 0.0258
NP_441286.1_1 Reverse -386 -398 3.48056 0.0467
NP_440670.1_8 Forward -396 -387 18.3876 0.000699
NP_440670.1_8 Reverse -387 -396 18.3876 0.000699
NP_440886.1_7 Reverse -386 -396 8.04271 0.0805
NP_440886.1_7 Forward -397 -387 7.94438 0.0805
NP_440886.1_7 Forward -256 -246 3.32285 0.287
NP_442614.1_2 Reverse -253 -267 9.34103 0.242
NP_442072.1_9 Forward -397 -379 -20.827 0.204
NP_441753.1_10 Reverse -378 -397 4.71934 0.193
NP_440907.2_8 Forward -395 -385 9.616 0.103
NP_440907.2_8 Reverse -388 -398 7.64939 0.117
NP_441463.1_3 Reverse -377 -396 -2.95047 0.164
NP_441463.1_3 Forward -152 -133 -5.21209 0.222
NP_441626.1_2 Forward -395 -388 15.7721 0.0124
NP_441626.1_2 Reverse -388 -395 15.7721 0.0124
NP_442794.1_1 Forward -400 -388 12.1337 0.0721
NP_442467.1_4 Forward -396 -377 8.55425 0.209
NP_441962.1_4 Reverse -253 -272 -14.0619 0.282
NP_440387.1_1 Forward -396 -380 -1.71142 0.143
NP_441431.1_2 Reverse -384 -398 16.0269 0.04
NP_441431.1_3 Forward -195 -176 12.8808 0.162
NP_441993.1_1 Forward -396 -377 1.26449 0.282
NP_440358.1_8 Reverse -109 -128 2.16274 0.241
NP_440114.1_10 Forward -396 -382 10.3243 0.148
NP_440632.1_7 Forward -292 -273 5.211 0.284
NP_441237.1_9 Reverse -388 -398 14.828 0.0242
NP_441311.1_2 Forward -371 -357 12.8803 0.23
NP_442930.1_1 Reverse -140 -150 9.51767 0.286
NP_440457.1_1 Reverse -242 -254 5.54551 0.141
NP_440457.1_1 Reverse -161 -173 1.21895 0.244
NP_440457.1_1 Reverse -383 -395 0.727295 0.25
NP_440798.1_6 Forward -395 -382 10.5407 0.074
NP_441801.1_4 Reverse -32 -42 3.12662 0.231
NP_441436.1_8 Forward -397 -378 15.3391 0.215
NP_442509.1_9 Reverse -387 -397 8.14104 0.192
NP_442509.1_9 Forward -396 -386 8.04271 0.192
NP_442509.1_9 Forward -255 -245 6.17443 0.286
NP_441253.1_1 Reverse -378 -397 13.0775 0.183
NP_442514.1_5 Reverse -88 -107 -0.984623 0.194
NP_440554.1_4 Forward -395 -385 17.9746 0.0131
NP_442862.1_3 Forward -227 -210 3.97208 0.298
NP_441885.1_5 Reverse -387 -397 20.9245 0.000538
NP_441885.1_5 Forward -396 -386 11.3864 0.00668
NP_442341.1_7 Reverse -386 -400 3.93283 0.208
NP_442341.1_9 Reverse -385 -399 21.9267 0.00232
NP_442341.1_9 Forward -176 -162 11.2087 0.129
NP_441756.1_5 Forward -400 -381 -3.3438 0.29
NP_443000.1_7 Reverse -385 -395 20.3345 0.00223
NP_443000.1_7 Forward -398 -388 10.3048 0.0345
NP_440275.1_3 Reverse -385 -395 16.1063 0.0155
NP_440275.1_3 Forward -398 -388 8.04317 0.0602
NP_441662.1_3 Forward -223 -204 8.23655 0.264
NP_440679.1_5 Forward -154 -135 10.2259 0.29
NP_441122.1_1 Reverse -128 -143 3.02816 0.287
NP_439962.1_4 Reverse -179 -198 -6.29373 0.283
NP_439962.1_6 Reverse -312 -330 8.96727 0.23
NP_441105.1_3 Reverse -235 -254 -9.14533 0.284
NP_442373.1_2 Forward -204 -185 -9.24366 0.258
NP_440216.1_1 Forward -396 -382 24.9757 0.000528
NP_440216.1_1 Reverse -154 -168 -12.1934 0.247
NP_440216.1_9 Reverse -98 -107 6.39124 0.289
NP_440172.1_1 Forward -396 -386 17.5813 0.00421
NP_440172.1_1 Reverse -387 -397 15.0247 0.00945
NP_442015.1_10 Forward -400 -387 10.049 0.0415
NP_442015.1_10 Reverse -383 -396 3.75586 0.178
NP_441226.1_7 Forward -395 -388 14.4934 0.0123
NP_441226.1_7 Reverse -388 -395 14.4934 0.0123
NP_441226.1_7 Forward -173 -166 8.29857 0.205
NP_441226.1_7 Forward -293 -286 5.34865 0.289
NP_441111.1_7 Forward -395 -387 18.7023 0.00294
NP_441111.1_7 Reverse -388 -396 18.7023 0.00294
NP_442379.1_10 Reverse -380 -397 -0.0594896 0.223
NP_441766.1_2 Forward -396 -387 17.5026 0.00297
NP_441766.1_2 Reverse -387 -396 17.5026 0.00297
NP_442417.1_5 Forward -396 -382 4.52282 0.292
NP_440416.1_1 Forward -396 -377 -4.22878 0.128
NP_440416.1_9 Reverse -380 -399 -15.8318 0.201
NP_443052.1_8 Reverse -377 -396 -6.1954 0.141
NP_442226.1_1 Reverse -1 -20 10.6192 0.281
NP_440261.1_5 Forward -395 -382 6.60746 0.0318
NP_440261.1_5 Reverse -29 -42 -3.02898 0.108
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCTTGGCGATCGCCTGGTGGTGGATGCCACGTTTAAGTTAACGCCGGGATTCACCAGGGAAGAAATCATGGGCTGCACCACCCGTAATTTACATCAACGCAAAAGTACCCAACCCTACGACAAACCCAACTGTGGCAGCGTGTTCCGCAATCCCACGCCCCTTTATTCAGCCCGTTTAATTGAAGAATTAGGACTCAAGGGTTACCGCATTGGTGGCGCGGAAGTATCCCAACGCCATGCGAACTTCATCGTTAATATTGACAATGCTAAAGCCCAGGATGTATTCAACCTCATTTTCCATGTGCAAGGGGAAGTGGAAAAACACTACGGCATCCTCTTAGAGCCAGAAGTGAAAATGCTGGGGGAGTTTGCTCGATGAACACTATTAAACCTTTGTCAA

CDS

ATGCCTAATCCAGCCATAGGCCTCGCCCAACAATTTGGGGACTACCTCGCCCAGGGTGATTATGCTAAGGCCCACGGGCTACTGTGCTCTGCACTCCAACGCCAGTATTCACCCTCCACTCTGCGGGCCGATGTGGAAACCATGATTTACTATGGTTCTGGCCCCATCCAGAGGGCGATCGCCATGGCAGACTGCCTCCTCACCGACTGGCAATATCCCCCCATGGAAGCTAATGATCTAGCCTGGGTCTATGTTTCCCTGGAAGGGGAAGATTTTCTCGAAGCGGTGTCGGTTATCGTTCAGCAAGAGGGGAAAAAACTGGCAATTCGCTGGCTAGAATGGGGCCGACCCTGA

Protein

MPNPAIGLAQQFGDYLAQGDYAKAHGLLCSALQRQYSPSTLRADVETMIYYGSGPIQRAIAMADCLLTDWQYPPMEANDLAWVYVSLEGEDFLEAVSVIVQQEGKKLAIRWLEWGRP