Your browser is old and dusty. Try Google Chrome!

Details for slr1421

ORF slr1421
Accession NP_442818.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -22 -8 3.53951 0.163
NP_440557.1_1 Reverse -15 -34 -0.197208 0.267
NP_440795.1_7 Forward -22 -15 14.6904 0.0123
NP_440795.1_7 Reverse -15 -22 14.6904 0.0123
NP_441453.1_4 Reverse -14 -22 16.539 0.00633
NP_441453.1_4 Forward -23 -15 16.539 0.00633
NP_442151.1_6 Forward -23 -9 15.9292 0.0192
NP_442151.1_6 Reverse -14 -28 13.4709 0.0512
NP_440226.1_1 Reverse -14 -33 22.9106 0.00565
NP_442169.1_1 Forward -115 -96 11.7992 0.226
NP_441630.1_3 Reverse -133 -152 -0.000545616 0.285
NP_441630.1_3 Reverse -6 -25 -0.39387 0.287
NP_440348.1_6 Forward -110 -91 2.45773 0.288
NP_440996.1_3 Forward -361 -343 9.16393 0.281
NP_442744.1_8 Forward -23 -4 0.392778 0.231
NP_442173.1_1 Forward -22 -14 15.4574 0.00633
NP_442173.1_1 Reverse -15 -23 15.4574 0.00633
NP_442752.1_4 Forward -23 -16 13.8055 0.0199
NP_442752.1_4 Reverse -14 -21 13.8055 0.0199
NP_443027.1_4 Forward -25 -15 15.3197 0.0437
NP_441812.1_3 Reverse -13 -27 17.8958 0.0479
NP_442975.1_10 Forward -27 -13 20.3534 0.00216
NP_440784.1_7 Forward -22 -15 15.9687 0.0123
NP_440784.1_7 Reverse -15 -22 15.9687 0.0123
NP_440061.1_9 Reverse -371 -385 9.83206 0.137
NP_441054.1_2 Reverse -329 -348 10.9142 0.277
NP_442062.1_8 Forward -23 -13 17.3846 0.00193
NP_442062.1_8 Reverse -14 -24 10.3048 0.0493
NP_441900.1_2 Reverse -313 -331 -3.22649 0.279
NP_441859.1_3 Forward -24 -5 6.1935 0.182
NP_440304.1_4 Forward -25 -15 18.9579 0.00406
NP_440304.1_4 Reverse -12 -22 1.84832 0.299
NP_442242.1_4 Forward -22 -15 14.3954 0.0124
NP_442242.1_4 Reverse -15 -22 14.3954 0.0124
NP_440044.1_8 Reverse -86 -105 -3.3438 0.282
NP_439918.1_2 Reverse -193 -212 -5.01543 0.295
NP_441208.1_1 Forward -385 -366 3.6377 0.207
NP_441208.1_9 Reverse -11 -25 18.2892 0.0647
NP_442110.1_7 Reverse -14 -28 9.14437 0.0755
NP_441082.1_10 Forward -390 -377 20.7671 0.0272
NP_441083.1_5 Forward -23 -13 20.3345 0.00053
NP_441083.1_5 Reverse -14 -24 11.2881 0.0159
NP_441434.1_7 Reverse -16 -30 5.99778 0.225
NP_441738.1_2 Forward -21 -14 15.28 0.0102
NP_441738.1_2 Reverse -16 -23 15.28 0.0102
NP_441558.1_5 Forward -25 -6 4.12936 0.29
NP_441558.1_5 Reverse -12 -31 3.73603 0.299
NP_441942.1_5 Forward -120 -101 12.5858 0.237
NP_440209.1_1 Reverse -14 -22 18.1123 0.00295
NP_440209.1_1 Forward -23 -15 18.1123 0.00295
NP_442889.1_8 Forward -26 -12 18.7801 0.0097
NP_440056.1_1 Reverse -120 -139 15.5357 0.126
NP_441713.1_1 Reverse -8 -27 -12.7836 0.248
NP_441770.1_5 Forward -31 -12 1.67108 0.238
NP_440178.1_7 Reverse -13 -32 6.4893 0.0145
NP_442570.1_3 Forward -120 -101 -8.16202 0.281
NP_441716.1_1 Forward -23 -9 4.81781 0.248
NP_441598.1_1 Reverse -373 -392 9.0459 0.274
NP_442111.1_3 Forward -104 -91 12.0938 0.294
NP_442111.1_4 Reverse -13 -27 3.8345 0.229
NP_440343.1_3 Reverse -370 -388 3.55831 0.274
NP_440906.1_5 Forward -22 -15 15.8704 0.0124
NP_440906.1_5 Reverse -15 -22 15.8704 0.0124
NP_440906.1_5 Reverse -86 -93 5.64398 0.292
NP_440747.1_10 Reverse -11 -23 24.7201 0.00036
NP_440747.1_10 Forward -26 -14 -1.92764 0.0192
NP_441130.1_10 Reverse -12 -26 6.6861 0.181
NP_441486.1_1 Forward -26 -12 6.29277 0.0344
NP_441486.1_1 Reverse -11 -25 -2.55701 0.175
NP_442634.1_4 Forward -25 -11 6.29277 0.0508
NP_442634.1_4 Reverse -12 -26 -3.34366 0.161
NP_440842.1_10 Forward -386 -372 4.03116 0.254
NP_442848.1_1 Forward -29 -15 5.30946 0.0854
NP_443018.1_3 Forward -22 -15 14.8871 0.0123
NP_443018.1_3 Reverse -15 -22 14.8871 0.0123
NP_441316.1_7 Forward -25 -10 9.61633 0.0782
NP_441634.1_8 Reverse -12 -26 5.1128 0.114
NP_440376.1_1 Forward -23 -14 19.4693 0.000692
NP_440376.1_1 Reverse -14 -23 19.4693 0.000692
NP_440376.1_1 Forward -384 -375 -1.18024 0.294
NP_441588.1_4 Forward -21 -11 9.02648 0.14
NP_441588.1_4 Reverse -16 -26 6.66654 0.185
NP_442687.1_7 Forward -24 -14 9.02648 0.0994
NP_442687.1_7 Reverse -13 -23 8.92815 0.0994
NP_442687.1_7 Forward -104 -94 4.0116 0.271
NP_441846.1_6 Reverse -349 -368 8.65258 0.205
NP_441846.1_10 Forward -394 -375 -23.2067 0.279
NP_441080.1_5 Forward -57 -44 23.0287 0.0118
NP_441422.1_7 Reverse -12 -29 -3.5994 0.235
NP_441746.1_4 Reverse -73 -92 17.6982 0.199
NP_442720.1_3 Forward -56 -37 20.7301 0.125
NP_442658.1_1 Forward -25 -15 15.9091 0.00966
NP_442658.1_1 Reverse -12 -22 6.76441 0.214
NP_442205.1_9 Forward -29 -13 14.9065 0.0333
NP_441414.1_9 Forward -23 -4 4.52268 0.0536
NP_440720.1_9 Reverse -246 -265 15.3631 0.3
NP_442937.1_5 Forward -28 -9 8.35759 0.225
NP_441958.1_5 Forward -24 -14 21.2195 0.000805
NP_441958.1_5 Reverse -13 -23 12.2714 0.00183
NP_441127.1_1 Reverse -327 -341 11.5043 0.22
NP_440203.1_5 Forward -20 -10 11.8776 0.171
NP_440203.1_5 Reverse -252 -262 9.71433 0.245
NP_440984.1_7 Reverse -9 -23 8.94771 0.133
NP_440984.1_7 Forward -28 -14 6.98109 0.192
NP_439990.1_5 Reverse -9 -22 17.4239 0.0249
NP_442911.1_2 Reverse -4 -23 -3.14714 0.109
NP_442911.1_2 Forward -33 -14 -3.83545 0.119
NP_440153.1_5 Reverse -15 -29 3.93283 0.199
NP_442064.1_1 Reverse -9 -28 -2.26216 0.146
NP_440993.1_2 Forward -28 -12 1.82849 0.276
NP_440496.1_9 Reverse -374 -393 -2.55715 0.247
NP_440138.1_6 Reverse -104 -123 1.17865 0.289
NP_441294.1_7 Forward -27 -13 16.1618 0.0171
NP_441646.1_1 Reverse -7 -26 1.17943 0.235
NP_442438.1_10 Forward -28 -14 2.85119 0.168
NP_441000.1_5 Forward -199 -180 4.52188 0.284
NP_441000.1_6 Reverse -13 -27 -4.81863 0.252
NP_440484.1_3 Forward -25 -11 8.94771 0.279
NP_440147.1_4 Reverse -12 -25 20.1771 0.00228
NP_440147.1_4 Forward -25 -12 3.75586 0.181
NP_441550.1_8 Forward -25 -15 17.4824 0.00754
NP_441550.1_8 Reverse -12 -22 14.6309 0.0132
NP_441916.1_7 Reverse -14 -24 18.9579 0.00144
NP_441916.1_7 Forward -23 -13 10.3048 0.0261
NP_441916.1_10 Forward -31 -12 2.3594 0.249
NP_441041.1_3 Reverse -374 -392 19.3364 0.111
NP_441041.1_4 Forward -23 -4 -13.8652 0.297
NP_441041.1_7 Forward -26 -14 18.3015 0.00558
NP_441041.1_7 Reverse -11 -23 8.58373 0.133
NP_442642.1_9 Forward -30 -13 6.33202 0.192
NP_442396.1_5 Reverse -10 -23 11.6223 0.0913
NP_442004.1_4 Forward -346 -327 12.3883 0.299
NP_442004.1_6 Forward -23 -9 4.52282 0.211
NP_441725.1_5 Reverse -15 -25 8.92815 0.0553
NP_441725.1_5 Forward -22 -12 2.04498 0.115
NP_439966.1_7 Forward -25 -15 13.8442 0.0234
NP_439966.1_7 Reverse -12 -22 7.25606 0.15
NP_439966.1_9 Forward -25 -16 0.983037 0.253
NP_442941.1_3 Forward -22 -12 11.0914 0.0116
NP_442941.1_3 Reverse -15 -25 10.9931 0.0116
NP_440289.1_2 Forward -26 -13 11.7207 0.018
NP_442281.1_1 Forward -28 -14 13.9619 0.0224
NP_442281.1_1 Reverse -9 -23 8.94708 0.0747
NP_441164.1_1 Forward -359 -340 8.75091 0.0599
NP_441556.1_10 Reverse -9 -23 13.8233 0.178
NP_442982.1_5 Forward -33 -14 -2.16383 0.286
NP_441644.1_6 Reverse -14 -24 19.0557 0.000803
NP_441644.1_6 Forward -23 -13 17.3841 0.00127
NP_442215.1_2 Forward -25 -9 1.14018 0.14
NP_440253.1_2 Reverse -14 -32 -3.32411 0.291
NP_440929.1_8 Forward -23 -14 19.2726 0.000701
NP_440929.1_8 Reverse -14 -23 19.2726 0.000701
NP_442933.1_10 Forward -23 -14 17.601 0.00325
NP_442933.1_10 Reverse -14 -23 17.601 0.00325
NP_441751.2_8 Forward -22 -8 14.5526 0.0122
NP_441751.2_8 Reverse -15 -29 2.75286 0.0759
NP_442554.1_8 Reverse -15 -25 19.1546 0.00369
NP_442554.1_8 Forward -22 -12 15.3197 0.00882
NP_441762.1_7 Reverse -13 -25 2.59558 0.0676
NP_441762.1_7 Forward -24 -12 0.530633 0.0747
NP_442142.1_4 Reverse -11 -24 12.8017 0.0409
NP_442142.1_4 Forward -26 -13 11.6217 0.054
NP_442292.1_1 Forward -22 -13 18.486 0.00229
NP_442292.1_1 Reverse -15 -24 17.5026 0.00435
NP_440895.1_6 Reverse -8 -21 21.8488 0.0131
NP_443009.1_5 Reverse -13 -24 14.5128 0.02
NP_443009.1_5 Forward -24 -13 10.1862 0.0792
NP_441715.1_4 Forward -22 -12 7.94484 0.107
NP_441715.1_4 Reverse -15 -25 7.25653 0.108
NP_440730.1_9 Reverse -126 -144 -0.865831 0.262
NP_441198.1_8 Forward -25 -15 15.4199 0.0427
NP_440464.1_10 Forward -22 -12 13.0082 0.169
NP_441468.1_1 Forward -22 -15 15.8704 0.0124
NP_441468.1_1 Reverse -15 -22 15.8704 0.0124
NP_441020.2_6 Reverse -12 -29 8.69197 0.191
NP_441015.1_10 Forward -28 -9 -5.31042 0.221
NP_441673.1_1 Forward -23 -14 20.8459 0.000698
NP_441673.1_1 Reverse -14 -23 20.8459 0.000698
NP_441731.1_3 Reverse -6 -25 -5.9004 0.29
NP_441826.1_2 Reverse -8 -22 -2.65535 0.273
NP_441826.1_2 Forward -29 -15 -4.13031 0.292
NP_441764.1_8 Reverse -334 -344 11.3107 0.284
NP_442868.1_6 Reverse -12 -22 9.81313 0.038
NP_442868.1_6 Forward -25 -15 8.63316 0.0555
NP_442719.1_2 Reverse -330 -348 -11.9779 0.299
NP_441612.1_2 Forward -163 -153 9.03335 0.21
NP_441612.1_2 Forward -23 -13 8.54929 0.21
NP_441612.1_2 Forward -157 -147 7.48435 0.253
NP_443058.1_7 Reverse -345 -364 1.86774 0.294
NP_442427.1_8 Forward -32 -13 17.404 0.0497
NP_442808.1_1 Forward -24 -14 8.73102 0.0481
NP_442808.1_1 Reverse -13 -23 8.63269 0.0481
NP_440145.1_3 Forward -33 -14 10.4225 0.04
NP_442050.1_5 Forward -25 -15 17.1874 0.00812
NP_442050.1_5 Reverse -12 -22 7.64939 0.243
NP_440079.1_6 Forward -203 -184 17.6982 0.226
NP_441878.1_6 Forward -24 -14 10.5014 0.0176
NP_441878.1_6 Reverse -13 -23 10.4031 0.0176
NP_441036.1_8 Forward -24 -14 15.713 0.00724
NP_441036.1_8 Reverse -13 -23 8.33817 0.174
NP_441557.1_5 Forward -23 -14 19.9609 0.000699
NP_441557.1_5 Reverse -14 -23 19.9609 0.000699
NP_442356.1_1 Reverse -120 -139 7.07928 0.282
NP_441445.1_1 Reverse -5 -24 10.7175 0.0942
NP_441445.1_1 Forward -32 -13 3.73603 0.208
NP_442066.2_9 Forward -27 -14 9.95071 0.158
NP_441768.1_5 Reverse -340 -359 13.5691 0.0587
NP_441308.1_8 Forward -25 -15 12.4681 0.218
NP_442183.1_1 Reverse -14 -28 15.7325 0.0187
NP_442183.1_9 Forward -388 -378 18.5646 0.206
NP_441116.1_9 Reverse -336 -350 14.5526 0.229
NP_442444.1_6 Forward -147 -129 12.5337 0.272
NP_440829.1_4 Forward -226 -209 19.9009 0.242
NP_441549.1_9 Reverse -10 -28 -5.88071 0.198
NP_442347.1_2 Forward -22 -13 12.4878 0.056
NP_442347.1_2 Reverse -15 -24 3.34298 0.284
NP_442645.1_2 Forward -31 -12 -11.3086 0.144
NP_441037.1_4 Forward -25 -15 16.5761 0.0168
NP_441037.1_4 Reverse -12 -22 7.9999 0.237
NP_442317.1_6 Reverse -9 -28 17.994 0.0832
NP_441633.1_3 Reverse -12 -25 10.8357 0.0286
NP_440136.1_2 Forward -22 -15 15.9687 0.0123
NP_440136.1_2 Reverse -15 -22 15.9687 0.0123
NP_442998.1_10 Forward -21 -14 15.5754 0.0102
NP_442998.1_10 Reverse -16 -23 15.5754 0.0102
NP_440899.1_1 Forward -179 -160 7.52912 0.254
NP_440299.1_1 Reverse -10 -23 12.605 0.0362
NP_440299.1_1 Reverse -67 -80 6.11523 0.152
NP_441799.1_1 Reverse -10 -24 18.6818 0.00832
NP_441799.1_1 Forward -27 -13 11.5037 0.0575
NP_441007.1_10 Forward -28 -15 14.4739 0.0499
NP_441007.1_10 Reverse -9 -22 1.59258 0.203
NP_442333.2_5 Forward -161 -142 -10.1286 0.246
NP_440256.1_1 Reverse -11 -30 5.50599 0.0359
NP_441559.1_8 Reverse -90 -104 -6.88358 0.281
NP_441559.1_8 Reverse -9 -23 -6.88358 0.281
NP_441270.1_5 Forward -395 -376 15.4341 0.191
NP_440915.1_6 Forward -27 -13 4.52282 0.0953
NP_440915.1_6 Reverse -10 -24 3.14618 0.107
NP_440915.1_6 Forward -61 -47 -3.24533 0.292
NP_442785.1_2 Forward -68 -49 23.9922 0.0297
NP_441866.1_6 Forward -210 -191 12.1917 0.176
NP_440243.1_2 Reverse -249 -263 19.9827 0.235
NP_441464.1_8 Reverse -14 -28 10.4227 0.178
NP_441464.1_10 Reverse -190 -204 9.2427 0.262
NP_441939.1_3 Reverse -15 -34 18.9773 0.0134
NP_442993.1_1 Reverse -14 -30 -2.00642 0.105
NP_442993.1_1 Forward -23 -7 -9.18458 0.179
NP_442386.1_9 Reverse -13 -22 13.8639 0.0289
NP_442386.1_9 Forward -24 -15 6.39082 0.219
NP_441750.1_7 Forward -385 -375 13.7464 0.258
NP_441340.1_5 Forward -22 -15 15.6737 0.0124
NP_441340.1_5 Reverse -15 -22 15.6737 0.0124
NP_440194.1_3 Forward -104 -85 2.16274 0.271
NP_439976.1_5 Reverse -339 -353 11.4053 0.268
NP_441160.1_6 Reverse -57 -76 1.27776 0.283
NP_440586.1_8 Forward -22 -15 13.2151 0.026
NP_440586.1_8 Reverse -15 -22 13.2151 0.026
NP_442251.1_6 Forward -22 -15 15.2804 0.0124
NP_442251.1_6 Reverse -15 -22 15.2804 0.0124
NP_440684.1_9 Reverse -8 -22 10.4227 0.198
NP_441262.1_3 Reverse -14 -21 14.7888 0.0223
NP_441262.1_3 Forward -23 -16 14.7888 0.0223
NP_443051.1_1 Forward -24 -15 19.5676 0.00335
NP_443051.1_1 Reverse -13 -22 10.4228 0.00754
NP_439984.1_3 Reverse -7 -21 18.3868 0.0685
NP_440408.1_7 Forward -23 -4 6.78429 0.299
NP_440408.1_10 Forward -308 -289 11.7992 0.167
NP_440439.1_1 Forward -26 -13 3.16588 0.119
NP_440439.1_1 Reverse -11 -24 0.0192843 0.203
NP_440372.1_2 Forward -22 -15 16.3621 0.0124
NP_440372.1_2 Reverse -15 -22 16.3621 0.0124
NP_440139.1_1 Reverse -135 -154 10.2251 0.0935
NP_442384.1_10 Forward -23 -10 15.5556 0.00986
NP_442339.1_1 Reverse -348 -367 16.1249 0.14
NP_442790.1_4 Reverse -5 -24 -1.08219 0.0997
NP_442262.1_10 Forward -22 -15 14.1988 0.0123
NP_442262.1_10 Reverse -15 -22 14.1988 0.0123
NP_441689.1_5 Forward -25 -15 8.43603 0.132
NP_441689.1_5 Reverse -12 -22 5.78111 0.197
NP_440344.1_10 Forward -30 -13 -7.33598 0.116
NP_440562.1_1 Reverse -75 -94 13.8633 0.235
NP_441965.1_10 Forward -26 -10 22.0847 0.0148
NP_442750.1_6 Forward -386 -367 14.7491 0.285
NP_442102.1_4 Reverse -186 -205 13.7658 0.222
NP_440297.1_9 Forward -22 -12 -0.118297 0.282
NP_440297.1_9 Reverse -15 -25 -0.314959 0.282
NP_440350.1_1 Forward -344 -325 1.47442 0.21
NP_440350.1_1 Forward -400 -381 -0.4922 0.23
NP_441592.1_4 Forward -23 -4 -2.16383 0.261
NP_440990.1_10 Forward -70 -51 15.1424 0.261
NP_440999.1_9 Forward -27 -13 4.42448 0.116
NP_440999.1_9 Reverse -385 -399 3.14618 0.135
NP_440999.1_9 Reverse -10 -24 -2.36035 0.268
NP_440888.1_2 Reverse -14 -28 15.5352 0.0102
NP_440888.1_2 Reverse -376 -390 7.27547 0.202
NP_440888.1_2 Forward -23 -9 5.40719 0.28
NP_441123.1_1 Forward -310 -291 15.7324 0.178
NP_442818.1_1 Forward -208 -189 31.7594 0.0000981
NP_442818.1_2 Forward -62 -43 30.4821 0.000146
NP_442818.1_3 Forward -352 -335 29.0465 0.000798
NP_442818.1_4 Forward -102 -84 27.7485 0.000726
NP_442818.1_5 Forward -317 -298 29.2038 0.000297
NP_440105.1_3 Reverse -374 -388 19.2718 0.228
NP_441543.1_2 Forward -22 -13 16.9127 0.00359
NP_441543.1_2 Reverse -15 -24 15.9293 0.00518
NP_442845.1_2 Reverse -8 -22 14.8476 0.0774
NP_442845.1_2 Forward -29 -15 4.32615 0.261
NP_441834.1_7 Forward -35 -16 13.6675 0.291
NP_441469.1_8 Forward -24 -15 6.5879 0.227
NP_441469.1_8 Reverse -13 -22 6.48957 0.227
NP_443064.1_6 Forward -23 -13 12.5669 0.0796
NP_443064.1_6 Reverse -14 -24 10.8217 0.13
NP_442578.1_7 Forward -22 -15 14.5921 0.026
NP_442578.1_7 Reverse -15 -22 14.5921 0.026
NP_440220.1_4 Reverse -344 -363 3.24359 0.226
NP_441462.1_2 Reverse -14 -24 20.2362 0.000805
NP_441462.1_2 Forward -23 -13 11.5831 0.00406
NP_441621.1_7 Forward -25 -11 -2.75368 0.188
NP_441621.1_7 Reverse -12 -26 -5.31028 0.25
NP_443062.1_1 Forward -23 -5 11.6662 0.0955
NP_443062.1_1 Reverse -14 -32 3.96308 0.279
NP_443062.1_6 Reverse -6 -25 7.27595 0.171
NP_440516.1_2 Reverse -8 -26 -0.865831 0.266
NP_440516.1_8 Forward -23 -14 16.9127 0.00442
NP_440516.1_8 Reverse -14 -23 16.9127 0.00442
NP_442428.1_5 Forward -22 -15 15.8704 0.0124
NP_442428.1_5 Reverse -15 -22 15.8704 0.0124
NP_440673.1_3 Forward -21 -14 12.4288 0.0426
NP_440673.1_3 Reverse -16 -23 12.4288 0.0426
NP_440865.1_9 Forward -29 -10 -5.60541 0.215
NP_441052.1_2 Forward -23 -13 19.9412 0.00106
NP_441052.1_2 Reverse -14 -24 10.4031 0.0285
NP_442219.1_8 Reverse -61 -80 8.07047 0.257
NP_442219.1_9 Forward -22 -13 17.7976 0.00718
NP_442219.1_9 Reverse -15 -24 8.25953 0.0681
NP_440436.1_4 Forward -22 -13 17.2072 0.00233
NP_440436.1_4 Reverse -15 -24 9.24241 0.0871
NP_440436.1_4 Reverse -49 -58 5.50585 0.195
NP_441884.1_9 Forward -26 -7 -23.4033 0.284
NP_440314.1_9 Forward -22 -3 -9.047 0.258
NP_441719.1_4 Forward -22 -15 16.3621 0.0124
NP_441719.1_4 Reverse -15 -22 16.3621 0.0124
NP_441733.1_10 Forward -26 -13 8.77074 0.135
NP_441004.1_2 Forward -114 -95 4.71934 0.195
NP_442366.1_3 Forward -24 -6 6.50899 0.0776
NP_442366.1_5 Reverse -11 -21 14.0409 0.0497
NP_440296.1_6 Reverse -237 -255 11.9385 0.295
NP_441115.1_4 Forward -24 -6 10.7364 0.168
NP_442694.1_4 Reverse -313 -322 12.2911 0.253
NP_440328.1_4 Reverse -8 -27 4.62101 0.162
NP_443054.1_2 Reverse -12 -26 2.94952 0.24
NP_441851.1_10 Reverse -13 -23 15.8113 0.00552
NP_441851.1_10 Forward -24 -14 8.53483 0.114
NP_441851.1_10 Forward -260 -250 4.60159 0.259
NP_441668.1_4 Reverse -4 -23 5.89931 0.164
NP_441668.1_4 Forward -268 -249 4.71934 0.173
NP_442515.1_1 Reverse -13 -27 5.21113 0.107
NP_442515.1_1 Forward -163 -149 -3.147 0.287
NP_442515.1_1 Reverse -217 -231 -4.52363 0.298
NP_442515.1_1 Forward -24 -10 -4.52363 0.298
NP_441349.1_10 Reverse -4 -23 8.06259 0.0283
NP_441409.1_6 Reverse -8 -27 10.0292 0.024
NP_440432.1_9 Reverse -15 -30 14.5329 0.014
NP_442843.1_4 Forward -303 -285 16.8337 0.162
NP_440474.1_8 Reverse -15 -29 10.0287 0.149
NP_440431.1_3 Forward -24 -5 2.26107 0.0969
NP_440431.1_4 Forward -255 -236 -8.92892 0.275
NP_442450.1_5 Reverse -12 -22 7.55152 0.13
NP_440588.1_2 Reverse -5 -24 6.58763 0.0543
NP_440195.1_5 Forward -29 -10 4.12936 0.273
NP_442006.1_2 Forward -74 -57 -14.8091 0.21
NP_441570.1_1 Reverse -14 -32 -9.91228 0.153
NP_440078.1_10 Forward -23 -4 13.4708 0.155
NP_441078.1_4 Forward -23 -14 19.6659 0.0007
NP_441078.1_4 Reverse -14 -23 19.6659 0.0007
NP_440707.1_9 Forward -64 -45 0.786102 0.293
NP_441091.1_5 Forward -27 -8 2.0644 0.29
NP_440526.1_3 Reverse -15 -26 11.6612 0.0646
NP_440526.1_3 Forward -22 -11 8.02298 0.126
NP_440526.1_3 Forward -243 -232 6.44969 0.201
NP_440526.1_3 Reverse -86 -97 4.18809 0.267
NP_440526.1_3 Reverse -49 -60 0.156538 0.297
NP_441432.1_8 Reverse -13 -22 16.8143 0.00595
NP_441432.1_8 Forward -24 -15 16.8143 0.00595
NP_442320.1_8 Forward -29 -15 7.37441 0.0195
NP_442344.1_7 Forward -22 -3 0.294447 0.0975
NP_441732.1_2 Reverse -10 -26 -7.70961 0.0885
NP_441732.1_2 Forward -27 -11 -15.3794 0.145
NP_440760.1_1 Reverse -14 -33 -4.13045 0.0392
NP_440760.1_1 Forward -23 -4 -15.7335 0.154
NP_440913.1_1 Reverse -12 -30 8.67227 0.183
NP_441072.1_2 Reverse -3 -22 12.6841 0.173
NP_440713.1_4 Reverse -4 -23 4.52268 0.226
NP_442489.1_2 Reverse -3 -22 1.96607 0.278
NP_442489.1_7 Forward -23 -14 20.1576 0.000695
NP_442489.1_7 Reverse -14 -23 20.1576 0.000695
NP_440757.1_7 Forward -388 -370 -4.30741 0.293
NP_440559.1_1 Forward -22 -13 17.4043 0.00658
NP_440559.1_1 Reverse -15 -24 8.65285 0.0586
NP_441659.2_8 Reverse -14 -24 20.9245 0.000805
NP_441659.2_8 Forward -23 -13 18.1713 0.00133
NP_442913.1_10 Forward -32 -13 8.65258 0.0464
NP_441040.1_2 Forward -393 -374 -5.60541 0.181
NP_442776.1_1 Reverse -375 -394 2.94938 0.294
NP_442776.1_6 Forward -25 -6 14.9458 0.11
NP_440779.1_5 Reverse -14 -31 -13.9242 0.234
NP_442346.1_5 Reverse -13 -23 16.6963 0.00248
NP_442346.1_5 Forward -24 -14 16.303 0.00248
NP_440545.1_3 Forward -27 -10 -1.0428 0.162
NP_440545.1_3 Reverse -10 -27 -2.61609 0.189
NP_440545.1_5 Forward -388 -371 3.57876 0.289
NP_442603.1_7 Forward -23 -9 8.45543 0.174
NP_441585.1_5 Reverse -329 -348 2.16195 0.279
NP_441050.1_5 Reverse -231 -249 -0.669169 0.256
NP_441833.1_4 Forward -22 -15 15.9687 0.0124
NP_441833.1_4 Reverse -15 -22 15.9687 0.0124
NP_441329.1_1 Reverse -169 -188 7.87766 0.236
NP_442162.1_9 Forward -22 -15 16.2637 0.0124
NP_442162.1_9 Reverse -15 -22 16.2637 0.0124
NP_440671.1_4 Forward -29 -15 4.91614 0.3
NP_440671.1_6 Reverse -373 -392 13.9616 0.221
NP_442199.1_5 Forward -31 -12 -3.54046 0.208
NP_442140.1_3 Forward -22 -12 12.2714 0.0632
NP_442140.1_3 Reverse -15 -25 7.94484 0.124
NP_440875.1_9 Reverse -16 -26 16.8403 0.0145
NP_441813.1_5 Forward -25 -15 8.73149 0.0367
NP_441813.1_5 Reverse -12 -22 8.63316 0.0367
NP_441813.1_7 Reverse -376 -390 17.4035 0.144
NP_440590.1_4 Forward -22 -9 3.16588 0.0756
NP_440590.1_4 Reverse -15 -28 2.87088 0.0788
NP_440567.1_1 Forward -22 -8 3.8345 0.135
NP_440567.1_1 Reverse -15 -29 3.14618 0.151
NP_442497.1_10 Reverse -15 -24 17.601 0.00813
NP_442497.1_10 Forward -22 -13 10.4228 0.0087
NP_440821.1_4 Forward -25 -15 10.7964 0.0146
NP_440821.1_4 Reverse -12 -22 9.41981 0.0286
NP_441239.1_9 Forward -25 -13 14.887 0.0247
NP_441239.1_9 Reverse -12 -24 3.38223 0.285
NP_442897.1_7 Forward -148 -129 17.994 0.218
NP_441892.1_1 Forward -32 -15 3.97208 0.117
NP_442044.1_1 Forward -28 -9 -3.73712 0.176
NP_441017.1_6 Forward -154 -140 14.3553 0.155
NP_442629.1_3 Forward -393 -374 -0.885524 0.3
NP_441617.1_6 Reverse -339 -358 -4.72043 0.268
NP_440546.1_4 Reverse -14 -24 13.5365 0.0459
NP_440546.1_4 Forward -23 -13 10.046 0.109
NP_441230.1_5 Forward -28 -9 13.1758 0.0635
NP_440462.1_6 Forward -25 -15 19.4496 0.00371
NP_440462.1_6 Reverse -12 -22 1.35667 0.294
NP_442465.1_6 Forward -256 -237 18.3818 0.295
NP_440868.1_4 Reverse -10 -22 15.1819 0.0164
NP_440868.1_4 Forward -27 -15 7.21714 0.0749
NP_441249.1_8 Reverse -193 -212 5.99764 0.247
NP_442039.1_4 Forward -22 -15 15.1821 0.0124
NP_442039.1_4 Reverse -15 -22 15.1821 0.0124
NP_442039.1_7 Forward -364 -354 11.5831 0.257
NP_442039.1_7 Forward -109 -99 7.55152 0.275
NP_441811.1_8 Reverse -8 -22 6.48943 0.272
NP_440008.1_9 Reverse -8 -27 8.16093 0.283
NP_441926.1_3 Reverse -14 -30 6.25339 0.17
NP_440825.1_7 Forward -22 -12 12.9096 0.152
NP_442837.1_3 Forward -22 -15 15.7721 0.0124
NP_442837.1_3 Reverse -15 -22 15.7721 0.0124
NP_440160.1_2 Forward -163 -144 -8.65367 0.286
NP_442053.1_1 Forward -23 -14 18.3876 0.0007
NP_442053.1_1 Reverse -14 -23 18.3876 0.0007
NP_440505.1_3 Forward -25 -15 15.418 0.0114
NP_440505.1_3 Reverse -12 -22 9.22315 0.122
NP_442659.1_6 Forward -68 -50 18.6037 0.165
NP_441959.1_8 Reverse -242 -255 9.38413 0.286
NP_441252.1_6 Forward -351 -344 11.6422 0.288
NP_442532.1_7 Reverse -14 -28 4.62115 0.171
NP_441408.2_7 Forward -25 -6 5.40766 0.172
NP_440914.1_1 Forward -23 -13 17.5935 0.000537
NP_440914.1_1 Reverse -14 -24 16.3248 0.00196
NP_441011.1_8 Reverse -15 -24 16.6177 0.00602
NP_441011.1_8 Forward -22 -13 8.25953 0.144
NP_442533.1_6 Forward -23 -14 17.2076 0.00137
NP_442533.1_6 Reverse -14 -23 17.2076 0.00137
NP_442229.1_1 Forward -25 -11 8.25877 0.184
NP_441219.1_6 Forward -75 -57 13.9821 0.168
NP_441482.1_7 Forward -29 -15 -0.983719 0.0612
NP_441482.1_9 Reverse -337 -350 11.3267 0.294
NP_439944.1_9 Reverse -15 -25 17.7779 0.00341
NP_439944.1_9 Forward -22 -12 10.5014 0.0887
NP_441527.1_8 Forward -28 -9 1.86774 0.279
NP_440115.1_6 Reverse -11 -21 9.32148 0.115
NP_440115.1_6 Forward -26 -16 7.84651 0.146
NP_441106.1_1 Forward -24 -15 18.486 0.0028
NP_441106.1_1 Reverse -13 -22 9.63616 0.0311
NP_441815.1_6 Reverse -369 -388 4.62021 0.197
NP_439903.1_6 Forward -26 -7 8.06178 0.144
NP_442306.1_10 Reverse -9 -28 -10.1286 0.11
NP_441286.1_1 Reverse -13 -25 14.6903 0.00418
NP_441286.1_1 Forward -24 -12 3.48056 0.0467
NP_440670.1_8 Forward -23 -14 18.3876 0.000699
NP_440670.1_8 Reverse -14 -23 18.3876 0.000699
NP_440886.1_7 Forward -24 -14 8.04271 0.0805
NP_440886.1_7 Reverse -13 -23 7.94438 0.0805
NP_442614.1_2 Forward -23 -9 17.4042 0.0588
NP_442614.1_2 Forward -385 -371 11.996 0.172
NP_442072.1_9 Reverse -13 -31 -3.6191 0.0368
NP_440907.2_8 Reverse -15 -25 19.1541 0.00362
NP_440907.2_8 Forward -22 -12 7.64939 0.117
NP_441021.1_1 Reverse -142 -161 -10.6203 0.242
NP_441463.1_3 Reverse -143 -162 -6.29373 0.243
NP_441463.1_6 Forward -82 -68 8.15534 0.25
NP_441626.1_2 Forward -22 -15 15.7721 0.0124
NP_441626.1_2 Reverse -15 -22 15.7721 0.0124
NP_442365.1_7 Reverse -10 -29 -5.80207 0.279
NP_441589.1_5 Forward -390 -371 18.5025 0.262
NP_442794.1_1 Reverse -10 -22 12.1337 0.0721
NP_442615.1_1 Reverse -5 -23 24.1102 0.00203
NP_442615.1_1 Forward -32 -14 5.23069 0.0398
NP_441962.1_4 Forward -28 -9 -10.3253 0.226
NP_440387.1_1 Reverse -14 -30 6.45005 0.0282
NP_440387.1_1 Forward -23 -7 3.50012 0.0568
NP_441431.1_2 Forward -26 -12 14.3553 0.0681
NP_441836.1_1 Reverse -3 -22 20.3628 0.019
NP_441193.1_1 Forward -209 -190 10.0284 0.277
NP_441993.1_1 Reverse -14 -33 1.26449 0.282
NP_440814.1_4 Reverse -5 -24 -13.3736 0.285
NP_440114.1_10 Reverse -14 -28 20.5508 0.00301
NP_442698.1_10 Forward -21 -2 13.3725 0.231
NP_442698.1_10 Forward -84 -65 -0.983855 0.297
NP_442324.1_5 Reverse -5 -24 15.6332 0.135
NP_440287.1_6 Reverse -5 -24 8.45592 0.151
NP_441272.1_8 Forward -81 -63 10.2456 0.296
NP_440293.1_3 Forward -391 -372 -5.99873 0.285
NP_440293.1_9 Reverse -148 -162 9.41158 0.285
NP_440293.1_10 Forward -394 -375 6.4893 0.199
NP_441237.1_9 Forward -22 -12 14.828 0.0242
NP_439910.1_2 Forward -31 -14 -13.5308 0.162
NP_442867.1_3 Reverse -14 -33 9.83255 0.169
NP_442867.1_8 Forward -136 -117 10.2259 0.214
NP_442940.1_2 Forward -23 -4 -0.0988766 0.296
NP_440798.1_6 Reverse -15 -28 0.60927 0.254
NP_441332.1_6 Reverse -375 -385 12.4212 0.23
NP_442509.1_9 Forward -23 -13 8.14104 0.192
NP_442509.1_9 Reverse -14 -24 8.04271 0.192
NP_440554.1_4 Reverse -15 -25 15.418 0.0199
NP_441885.1_5 Forward -23 -13 20.9245 0.000538
NP_441885.1_5 Reverse -14 -24 11.3864 0.00668
NP_442341.1_7 Forward -24 -10 3.93283 0.208
NP_442341.1_7 Reverse -13 -27 3.04785 0.237
NP_442341.1_9 Forward -25 -11 12.6836 0.0984
NP_441173.1_9 Reverse -99 -107 11.3271 0.226
NP_443000.1_7 Forward -25 -15 10.7964 0.0345
NP_443000.1_7 Reverse -12 -22 10.3048 0.0345
NP_440275.1_3 Forward -25 -15 18.6629 0.0082
NP_440275.1_3 Reverse -12 -22 8.04317 0.0602
NP_440091.1_1 Forward -27 -15 10.8554 0.0429
NP_440679.1_5 Forward -20 -1 5.30933 0.292
NP_443010.1_10 Forward -26 -9 3.6405 0.252
NP_441207.1_7 Forward -258 -244 8.28727 0.29
NP_439962.1_4 Reverse -372 -391 -8.16202 0.292
NP_441105.1_3 Forward -34 -15 -2.65548 0.165
NP_441105.1_3 Reverse -3 -22 -4.22878 0.195
NP_440216.1_1 Reverse -14 -28 5.99778 0.0166
NP_440216.1_1 Forward -23 -9 -10.2268 0.145
NP_440172.1_1 Reverse -14 -24 17.5813 0.00421
NP_440172.1_1 Forward -23 -13 15.0247 0.00945
NP_442015.1_10 Reverse -10 -23 10.049 0.0415
NP_441226.1_7 Forward -22 -15 14.4934 0.0123
NP_441226.1_7 Reverse -15 -22 14.4934 0.0123
NP_441111.1_7 Forward -22 -14 18.7023 0.00294
NP_441111.1_7 Reverse -15 -23 18.7023 0.00294
NP_442379.1_10 Forward -30 -13 -1.43612 0.223
NP_441766.1_2 Forward -23 -14 17.5026 0.00297
NP_441766.1_2 Reverse -14 -23 17.5026 0.00297
NP_442969.1_4 Forward -165 -146 5.99764 0.274
NP_443052.1_8 Forward -33 -14 -7.37537 0.158
NP_440591.1_3 Reverse -178 -196 -2.73412 0.226
NP_442154.1_1 Reverse -191 -209 -10.9939 0.211
NP_442564.1_10 Reverse -327 -341 8.94771 0.296
NP_440261.1_5 Forward -22 -9 6.60746 0.0318
NP_440261.1_5 Reverse -15 -28 -10.6988 0.203
NP_440988.1_10 Forward -25 -11 6.54464 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGGTGTTTACTGCTGGGGGTGGGGCACAGAATTTAACTTGGCAAACTATTCGGCAAAATTTGCTCCAGGTTCCGGTACAAAAATCCGTTCAGTCAGAAGCGGCCTATGGTTCTGCTTGTTTAGCTAGAAGTAGTAAATCTTGGGAATGAAGATTAAATCATCGTCCCTAGATGGTTGTCTACAATATAATCAACCAAACCCTACACCCAAATTTTATGAAGCTGAAAGTATTAGTCTGGCAAGAACAAGACCAATGGTGCGCTTCTGTTCCTGCTTTGCCTGGATGTCACACTTGGGGGAATAGTTACGATCATCTGATGGAAATGGTCAAAGAAGCTGTGGAAGGATGGCTTGAAGTTGCTAGTAAATAAGAAGAGGCGATCGCCAAGAACAACAAGT

CDS

ATGAGCCACACTTTTCAGCAGATTTTACAATTGATAGAGAAACAGGAAGTTAAAATATCTGCCCATGGCTACGACGAACTGGCCAGCGATAACATTTTTGTGACGGAACTTCTGTCCAGCGTGAATCAAGCCGAGGTTATAGAAGACTATCCTGATTATCCCAAAGGAGCTTGTGTCCTTGTTTTACAAAAAGATTTACAAAATCAGCCTATCCATGCCGTTTGGGGAATACCCAAAAATTCAGATTCTCCCGCTGTTTTAATTACGGCTTATCGGCCTAGTAACAACAAATGGGAAAACGACTACAAAACAAGAAAATTATGA

Protein

MSHTFQQILQLIEKQEVKISAHGYDELASDNIFVTELLSSVNQAEVIEDYPDYPKGACVLVLQKDLQNQPIHAVWGIPKNSDSPAVLITAYRPSNNKWENDYKTRKL