Your browser is old and dusty. Try Google Chrome!

Details for slr1416

ORF slr1416
Accession NP_440065.1
Symbol
Category similar to MorR protein
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -395 -388 14.6904 0.0123
NP_440795.1_7 Reverse -388 -395 14.6904 0.0123
NP_441418.1_6 Reverse -188 -207 -21.535 0.153
NP_441418.1_6 Forward -396 -377 -23.01 0.19
NP_442291.1_7 Reverse -306 -320 15.6342 0.211
NP_442291.1_7 Forward -317 -303 11.3077 0.217
NP_441453.1_4 Reverse -387 -395 16.539 0.00633
NP_441453.1_4 Forward -396 -388 16.539 0.00633
NP_441960.1_3 Forward -298 -279 14.4648 0.243
NP_442151.1_6 Forward -396 -382 14.1593 0.0395
NP_441818.1_1 Forward -395 -384 14.0211 0.0577
NP_441818.1_1 Reverse -388 -399 9.59626 0.232
NP_440226.1_1 Forward -396 -377 10.0292 0.0665
NP_441465.1_8 Forward -346 -328 7.88563 0.235
NP_441098.1_3 Forward -126 -107 -3.53503 0.28
NP_441721.1_6 Forward -33 -14 7.66927 0.281
NP_442173.1_1 Forward -395 -387 15.4574 0.00633
NP_442173.1_1 Reverse -388 -396 15.4574 0.00633
NP_442173.1_1 Reverse -290 -298 4.93597 0.241
NP_442173.1_5 Forward -372 -362 15.0538 0.287
NP_442752.1_4 Forward -396 -389 13.8055 0.0199
NP_442752.1_4 Reverse -387 -394 13.8055 0.0199
NP_443027.1_4 Forward -398 -388 16.2046 0.0437
NP_443027.1_4 Forward -41 -31 6.46988 0.275
NP_443027.1_4 Reverse -385 -395 6.46988 0.275
NP_441812.1_3 Forward -40 -26 16.7159 0.0666
NP_441812.1_3 Reverse -386 -400 11.5043 0.21
NP_442975.1_10 Forward -400 -386 12.782 0.0459
NP_442975.1_10 Reverse -383 -397 3.04726 0.263
NP_440074.1_6 Reverse -200 -219 11.6017 0.268
NP_440784.1_7 Forward -395 -388 15.9687 0.0123
NP_440784.1_7 Reverse -388 -395 15.9687 0.0123
NP_442909.1_7 Forward -395 -381 11.012 0.131
NP_442118.1_2 Reverse -107 -126 16.3215 0.242
NP_440061.1_9 Forward -398 -384 21.1401 0.00242
NP_440061.1_9 Forward -315 -301 5.50552 0.283
NP_441054.1_2 Reverse -180 -199 10.4225 0.284
NP_441054.1_4 Reverse -377 -395 8.86894 0.0758
NP_442062.1_3 Forward -129 -110 -2.16383 0.269
NP_442062.1_8 Forward -396 -386 17.6796 0.00193
NP_442062.1_8 Reverse -387 -397 10.3048 0.0493
NP_442062.1_8 Forward -73 -63 9.02648 0.069
NP_441859.1_3 Forward -397 -378 6.1935 0.182
NP_441802.1_1 Reverse -358 -377 8.84924 0.22
NP_440304.1_4 Forward -398 -388 19.9412 0.00364
NP_440304.1_4 Reverse -385 -395 17.9746 0.00654
NP_440304.1_4 Forward -300 -290 5.28991 0.218
NP_442242.1_4 Forward -395 -388 14.3954 0.0124
NP_442242.1_4 Reverse -388 -395 14.3954 0.0124
NP_442762.1_10 Reverse -299 -318 7.57094 0.0698
NP_440916.1_1 Forward -325 -311 10.0294 0.216
NP_442602.1_3 Forward -269 -250 -0.39387 0.22
NP_441200.1_4 Forward -307 -288 7.07928 0.272
NP_441208.1_9 Reverse -384 -398 16.3225 0.0671
NP_441208.1_9 Reverse -186 -200 7.07942 0.227
NP_441594.1_6 Forward -292 -273 2.45773 0.251
NP_440370.1_10 Reverse -378 -397 18.879 0.0513
NP_440300.1_5 Reverse -108 -126 14.0393 0.271
NP_441925.1_4 Forward -197 -178 -15.0459 0.263
NP_441083.1_5 Forward -396 -386 19.3512 0.000718
NP_441083.1_5 Reverse -387 -397 11.2881 0.0159
NP_442827.1_8 Reverse -379 -398 18.1898 0.0295
NP_441738.1_2 Forward -394 -387 15.28 0.0102
NP_441738.1_2 Reverse -389 -396 15.28 0.0102
NP_441558.1_5 Forward -398 -379 20.944 0.00412
NP_440209.1_1 Reverse -387 -395 18.1123 0.00295
NP_440209.1_1 Forward -396 -388 18.1123 0.00295
NP_442889.1_1 Reverse -303 -322 -14.7502 0.283
NP_440447.1_1 Forward -312 -294 8.86894 0.194
NP_440447.1_5 Reverse -298 -308 13.943 0.277
NP_440447.1_6 Reverse -379 -397 8.27895 0.14
NP_441713.1_1 Reverse -381 -400 -1.67217 0.113
NP_441770.1_4 Forward -297 -278 -8.26035 0.243
NP_441770.1_4 Reverse -37 -56 -10.0303 0.263
NP_440178.1_7 Forward -397 -378 -9.93197 0.072
NP_442570.1_3 Reverse -301 -320 -3.54046 0.222
NP_442445.1_1 Reverse -3 -22 11.6025 0.271
NP_441716.1_1 Forward -396 -382 11.8976 0.0888
NP_442111.1_1 Forward -53 -34 22.123 0.0968
NP_442111.1_3 Reverse -14 -27 13.3352 0.261
NP_442111.1_4 Forward -397 -383 7.76774 0.0867
NP_440906.1_5 Forward -395 -388 15.8704 0.0124
NP_440906.1_5 Reverse -388 -395 15.8704 0.0124
NP_440747.1_10 Reverse -384 -396 -1.92764 0.0192
NP_440747.1_10 Forward -399 -387 -1.92764 0.0192
NP_441130.1_10 Forward -398 -384 11.6026 0.106
NP_441130.1_10 Reverse -385 -399 6.58777 0.183
NP_441486.1_1 Forward -399 -385 5.50613 0.0365
NP_441486.1_1 Reverse -384 -398 -4.7203 0.205
NP_442634.1_4 Reverse -385 -399 13.6676 0.0249
NP_442634.1_4 Forward -398 -384 -3.63866 0.161
NP_441667.1_1 Reverse -19 -34 14.303 0.284
NP_441014.1_5 Reverse -300 -318 14.4738 0.2
NP_441014.1_8 Forward -197 -178 -6.78538 0.276
NP_442848.1_1 Reverse -381 -395 -1.77037 0.263
NP_442848.1_4 Reverse -241 -255 8.16106 0.282
NP_441012.1_4 Reverse -282 -295 6.50913 0.278
NP_443018.1_3 Forward -395 -388 14.8871 0.0123
NP_443018.1_3 Reverse -388 -395 14.8871 0.0123
NP_443018.1_3 Reverse -290 -297 10.7572 0.0907
NP_443018.1_3 Reverse -165 -172 8.39725 0.147
NP_443018.1_3 Forward -297 -290 4.56234 0.241
NP_441316.1_7 Forward -398 -383 4.79811 0.121
NP_441634.1_8 Forward -398 -384 3.14618 0.155
NP_441634.1_9 Reverse -299 -318 9.63507 0.275
NP_440376.1_1 Forward -396 -387 19.4693 0.000692
NP_440376.1_1 Reverse -387 -396 19.4693 0.000692
NP_440376.1_1 Forward -73 -64 4.32629 0.163
NP_441857.1_5 Reverse -380 -398 7.78729 0.185
NP_441588.1_4 Reverse -389 -399 6.66654 0.185
NP_442687.1_7 Reverse -386 -396 18.5646 0.0028
NP_442687.1_7 Forward -397 -387 9.02648 0.0994
NP_441797.1_9 Reverse -47 -66 15.3391 0.253
NP_441846.1_10 Reverse -169 -188 -12.9802 0.197
NP_441846.1_10 Reverse -170 -189 -22.6167 0.264
NP_441846.1_10 Reverse -178 -197 -23.2067 0.279
NP_440642.1_10 Forward -19 -5 3.14559 0.277
NP_441013.1_2 Forward -318 -300 2.77242 0.236
NP_442658.1_1 Reverse -385 -395 17.6791 0.00565
NP_442658.1_1 Forward -398 -388 13.0576 0.04
NP_442658.1_1 Forward -300 -290 12.5659 0.0526
NP_442658.1_1 Forward -220 -210 6.37109 0.231
NP_442205.1_9 Reverse -381 -397 5.76173 0.128
NP_440656.1_8 Forward -309 -290 -0.295539 0.151
NP_441414.1_9 Forward -396 -377 4.52268 0.0536
NP_443061.1_4 Forward -281 -262 6.4893 0.205
NP_441487.1_6 Reverse -180 -199 -1.96717 0.286
NP_441317.1_4 Forward -24 -10 11.1828 0.259
NP_441958.1_2 Reverse -378 -397 11.4058 0.227
NP_441958.1_5 Forward -397 -387 21.2195 0.000805
NP_441958.1_5 Reverse -386 -396 20.5312 0.000966
NP_442836.1_5 Reverse -381 -400 20.944 0.0181
NP_440203.1_5 Forward -42 -32 12.4676 0.147
NP_440203.1_5 Forward -393 -383 10.4026 0.225
NP_442816.1_7 Forward -94 -75 11.5064 0.213
NP_439905.1_1 Forward -395 -382 17.8172 0.0359
NP_439905.1_5 Reverse -18 -32 21.9274 0.0281
NP_440984.1_7 Reverse -382 -396 12.1926 0.122
NP_440984.1_7 Forward -195 -181 5.21113 0.265
NP_442690.1_1 Forward -63 -44 -4.72043 0.156
NP_442690.1_1 Forward -129 -110 -11.6036 0.232
NP_442911.1_2 Reverse -377 -396 18.584 0.00604
NP_440993.1_2 Forward -303 -287 8.61333 0.141
NP_441099.1_5 Reverse -377 -396 -7.76869 0.18
NP_441099.1_8 Forward -36 -18 16.2429 0.141
NP_442002.1_9 Reverse -386 -393 14.1004 0.074
NP_442002.1_9 Reverse -250 -257 11.3472 0.185
NP_441294.1_7 Forward -400 -386 11.0744 0.157
NP_442885.1_4 Forward -111 -98 16.0225 0.264
NP_441000.1_6 Reverse -386 -400 4.42448 0.0953
NP_442771.1_1 Reverse -346 -364 -10.6989 0.279
NP_440147.1_4 Forward -398 -385 13.3923 0.0326
NP_440147.1_4 Reverse -385 -398 3.36254 0.188
NP_441550.1_8 Reverse -385 -395 19.8424 0.00352
NP_441550.1_8 Forward -398 -388 13.0576 0.0273
NP_441916.1_7 Reverse -387 -397 18.9579 0.00144
NP_441916.1_7 Forward -396 -386 16.893 0.00407
NP_441041.1_7 Reverse -384 -396 12.568 0.0611
NP_441041.1_7 Forward -399 -387 9.65268 0.108
NP_441041.1_7 Forward -338 -326 7.90349 0.154
NP_442004.1_6 Forward -396 -382 8.06273 0.149
NP_441725.1_5 Forward -395 -385 18.7612 0.0119
NP_441725.1_5 Reverse -388 -398 11.1898 0.0247
NP_439966.1_7 Forward -398 -388 14.8275 0.0177
NP_439966.1_7 Reverse -385 -395 8.14104 0.14
NP_439966.1_7 Reverse -287 -297 4.69947 0.263
NP_439966.1_9 Reverse -287 -296 6.98123 0.253
NP_439966.1_9 Reverse -385 -394 0.983037 0.253
NP_442941.1_3 Reverse -388 -398 19.9412 0.00262
NP_442941.1_3 Forward -395 -385 2.43831 0.14
NP_440289.1_2 Forward -399 -386 16.2439 0.00946
NP_440289.1_2 Reverse -384 -397 4.73917 0.0649
NP_440983.1_5 Reverse -274 -293 -2.16383 0.231
NP_440983.1_5 Forward -319 -300 -2.75381 0.231
NP_440983.1_5 Forward -325 -306 -8.65367 0.295
NP_441079.1_7 Forward -36 -17 9.7334 0.0968
NP_442012.1_5 Reverse -303 -322 5.80098 0.256
NP_439983.1_7 Reverse -185 -203 10.7372 0.277
NP_441457.1_7 Forward -300 -281 7.07928 0.168
NP_441556.1_7 Forward -277 -258 1.27698 0.287
NP_441556.1_10 Reverse -382 -396 13.7259 0.178
NP_441644.1_6 Reverse -387 -397 19.0557 0.000803
NP_441644.1_6 Forward -396 -386 15.7125 0.0048
NP_442501.1_2 Reverse -287 -306 -3.14714 0.255
NP_442215.1_2 Forward -285 -269 -2.98973 0.207
NP_442215.1_2 Forward -321 -305 -3.67804 0.22
NP_442215.1_2 Forward -75 -59 -6.82463 0.28
NP_440929.1_8 Forward -396 -387 19.2726 0.000701
NP_440929.1_8 Reverse -387 -396 19.2726 0.000701
NP_442933.1_10 Forward -396 -387 17.601 0.00325
NP_442933.1_10 Reverse -387 -396 17.601 0.00325
NP_441751.2_8 Forward -395 -381 1.76955 0.0968
NP_442554.1_8 Forward -395 -385 16.9913 0.0065
NP_442554.1_8 Reverse -388 -398 16.9913 0.0065
NP_442554.1_9 Reverse -191 -210 14.599 0.246
NP_441762.1_7 Forward -397 -385 2.69391 0.0676
NP_441762.1_7 Reverse -386 -398 1.61227 0.0736
NP_441762.1_7 Forward -299 -287 -3.10761 0.0911
NP_442142.1_4 Forward -399 -386 6.90188 0.153
NP_442142.1_4 Reverse -384 -397 4.64028 0.214
NP_442142.1_4 Reverse -286 -299 3.95196 0.239
NP_442142.1_4 Forward -48 -35 3.46031 0.255
NP_442142.1_4 Reverse -301 -314 2.28034 0.295
NP_442292.1_1 Reverse -388 -397 17.5026 0.00435
NP_442292.1_1 Forward -395 -386 9.53783 0.0183
NP_442476.1_6 Forward -395 -381 11.8976 0.0525
NP_443009.1_5 Forward -397 -386 17.0694 0.00659
NP_443009.1_5 Reverse -386 -397 16.7744 0.00677
NP_442301.1_2 Reverse -89 -108 3.53858 0.293
NP_441715.1_4 Reverse -388 -398 14.238 0.0295
NP_440183.1_9 Forward -274 -255 -12.6852 0.26
NP_441198.1_8 Reverse -385 -395 15.2245 0.0427
NP_441198.1_8 Forward -398 -388 13.2713 0.108
NP_441198.1_8 Forward -300 -290 12.9783 0.116
NP_441468.1_1 Forward -395 -388 15.8704 0.0124
NP_441468.1_1 Reverse -388 -395 15.8704 0.0124
NP_441468.1_1 Forward -297 -290 4.07068 0.263
NP_441015.1_8 Forward -313 -294 2.75272 0.272
NP_441015.1_10 Reverse -299 -318 -3.63879 0.19
NP_441015.1_10 Reverse -176 -195 -4.42544 0.203
NP_441673.1_1 Forward -396 -387 20.8459 0.000698
NP_441673.1_1 Reverse -387 -396 20.8459 0.000698
NP_441673.1_1 Reverse -64 -73 -8.06341 0.254
NP_441826.1_2 Reverse -381 -395 1.76955 0.142
NP_441826.1_2 Reverse -283 -297 -4.7203 0.299
NP_441637.1_9 Forward -32 -14 0.117479 0.292
NP_442868.1_6 Reverse -385 -395 16.7946 0.0131
NP_442868.1_6 Forward -398 -388 1.06167 0.205
NP_442227.1_2 Forward -195 -176 0.294447 0.252
NP_442427.1_5 Forward -198 -179 2.45773 0.286
NP_442808.1_1 Reverse -386 -396 8.73102 0.0481
NP_442808.1_1 Forward -397 -387 8.73102 0.0481
NP_441101.1_4 Reverse -213 -232 9.53756 0.191
NP_442718.1_2 Forward -298 -279 9.43923 0.0855
NP_442542.1_2 Reverse -186 -199 16.7355 0.0565
NP_442542.1_2 Reverse -385 -398 13.884 0.114
NP_442113.1_10 Reverse -285 -304 -6.39206 0.261
NP_442113.1_10 Forward -201 -182 -8.65367 0.282
NP_442050.1_5 Forward -398 -388 18.0724 0.00365
NP_442050.1_5 Reverse -385 -395 14.9258 0.0175
NP_440558.1_2 Forward -54 -35 0.0977854 0.194
NP_440558.1_2 Reverse -295 -314 -4.32711 0.244
NP_440558.1_2 Reverse -286 -305 -6.98204 0.284
NP_440558.1_2 Forward -316 -297 -7.67036 0.298
NP_441878.1_6 Reverse -386 -396 20.2362 0.0046
NP_441878.1_6 Forward -397 -387 10.5014 0.0176
NP_441878.1_6 Reverse -309 -319 -6.60814 0.193
NP_441878.1_6 Reverse -63 -73 -7.19813 0.21
NP_441878.1_6 Forward -74 -64 -7.78811 0.266
NP_441036.1_8 Forward -397 -387 15.713 0.00724
NP_441036.1_8 Reverse -386 -396 8.4365 0.174
NP_441557.1_5 Forward -396 -387 19.9609 0.000699
NP_441557.1_5 Reverse -387 -396 19.9609 0.000699
NP_441590.1_4 Forward -204 -185 8.84842 0.249
NP_442066.2_4 Forward -371 -352 -9.047 0.296
NP_441433.1_8 Reverse -305 -324 -3.54046 0.283
NP_441433.1_8 Reverse -93 -112 -4.42544 0.294
NP_441308.1_8 Forward -398 -388 13.353 0.218
NP_440101.1_10 Reverse -283 -302 2.16274 0.261
NP_442183.1_1 Forward -396 -382 9.73436 0.094
NP_442347.1_2 Forward -395 -386 3.34298 0.284
NP_442347.1_2 Reverse -388 -397 3.34298 0.284
NP_442347.1_10 Forward -16 -2 19.3701 0.0669
NP_441597.1_2 Reverse -183 -202 21.0423 0.0954
NP_442645.1_2 Forward -81 -62 -18.7818 0.279
NP_442888.1_6 Reverse -53 -72 12.0942 0.148
NP_441037.1_4 Reverse -385 -395 18.9151 0.00351
NP_441037.1_4 Forward -398 -388 7.31769 0.237
NP_442594.1_8 Reverse -185 -204 2.75272 0.293
NP_442047.1_4 Forward -183 -171 20.3929 0.155
NP_441633.1_3 Forward -398 -385 6.01747 0.0481
NP_440136.1_2 Forward -395 -388 15.9687 0.0123
NP_440136.1_2 Reverse -388 -395 15.9687 0.0123
NP_442590.1_9 Reverse -179 -198 9.24257 0.23
NP_442998.1_5 Reverse -14 -24 11.1898 0.191
NP_442998.1_10 Forward -394 -387 15.5754 0.0102
NP_442998.1_10 Reverse -389 -396 15.5754 0.0102
NP_440299.1_1 Reverse -383 -396 6.50855 0.139
NP_440299.1_1 Forward -43 -30 6.31189 0.146
NP_441799.1_1 Reverse -383 -397 18.2885 0.00852
NP_441799.1_1 Forward -302 -288 5.40719 0.21
NP_441799.1_1 Forward -400 -386 4.62054 0.242
NP_442504.1_4 Reverse -15 -34 1.33103 0.247
NP_441007.1_10 Reverse -382 -395 11.7207 0.0599
NP_441559.1_8 Reverse -382 -396 -6.68692 0.279
NP_440915.1_6 Reverse -383 -397 6.88276 0.0779
NP_440915.1_6 Forward -400 -386 2.75286 0.112
NP_440915.1_6 Forward -339 -325 -0.0987402 0.182
NP_442785.1_7 Forward -398 -384 11.406 0.228
NP_440329.1_3 Reverse -14 -33 14.5352 0.247
NP_442866.1_1 Reverse -183 -202 -3.24547 0.219
NP_441464.1_8 Forward -396 -382 18.9775 0.0644
NP_440306.1_3 Reverse -262 -281 4.62101 0.295
NP_441494.1_6 Reverse -382 -395 10.5407 0.225
NP_442386.1_9 Reverse -288 -297 6.68581 0.219
NP_442386.1_9 Forward -397 -388 6.39082 0.219
NP_442386.1_9 Reverse -386 -395 6.39082 0.219
NP_442386.1_9 Reverse -63 -72 5.9975 0.23
NP_441750.1_7 Reverse -188 -198 14.7297 0.254
NP_441340.1_5 Forward -395 -388 15.6737 0.0124
NP_441340.1_5 Reverse -388 -395 15.6737 0.0124
NP_441340.1_5 Reverse -290 -297 3.97235 0.274
NP_440327.1_6 Reverse -170 -189 2.45773 0.296
NP_441134.1_10 Reverse -287 -305 13.9821 0.221
NP_440586.1_8 Forward -395 -388 13.2151 0.026
NP_440586.1_8 Reverse -388 -395 13.2151 0.026
NP_440586.1_8 Forward -38 -31 10.7568 0.128
NP_440586.1_8 Reverse -165 -172 7.21693 0.27
NP_442251.1_6 Forward -395 -388 15.2804 0.0124
NP_442251.1_6 Reverse -388 -395 15.2804 0.0124
NP_442959.1_4 Forward -295 -276 12.8808 0.207
NP_441262.1_3 Reverse -387 -394 14.7888 0.0223
NP_441262.1_3 Forward -396 -389 14.7888 0.0223
NP_440027.1_8 Forward -322 -303 4.62021 0.287
NP_443051.1_1 Forward -397 -388 19.5676 0.00335
NP_443051.1_1 Reverse -386 -395 18.0926 0.00402
NP_439984.1_3 Reverse -380 -394 14.3553 0.192
NP_439937.1_9 Forward -397 -380 -4.78005 0.157
NP_439937.1_9 Forward -291 -274 -13.8265 0.287
NP_440439.1_1 Forward -399 -386 11.0324 0.0339
NP_440439.1_1 Reverse -384 -397 10.639 0.0362
NP_440439.1_1 Reverse -181 -194 -0.964025 0.244
NP_440372.1_2 Forward -395 -388 16.3621 0.0124
NP_440372.1_2 Reverse -388 -395 16.3621 0.0124
NP_441138.1_5 Forward -89 -76 3.97694 0.297
NP_440819.1_5 Reverse -13 -21 7.68924 0.266
NP_440316.1_10 Reverse -309 -319 7.45319 0.251
NP_440316.1_10 Reverse -187 -197 6.56821 0.257
NP_440316.1_10 Forward -299 -289 5.48657 0.295
NP_442384.1_10 Forward -396 -383 11.6223 0.0341
NP_442384.1_10 Reverse -64 -77 1.9859 0.24
NP_442235.1_3 Forward -400 -381 2.45773 0.293
NP_441018.1_7 Reverse -300 -319 11.1109 0.192
NP_441018.1_7 Reverse -247 -266 10.0292 0.218
NP_441018.1_7 Reverse -180 -199 6.09597 0.299
NP_442262.1_10 Forward -395 -388 14.1988 0.0123
NP_442262.1_10 Reverse -388 -395 14.1988 0.0123
NP_442262.1_10 Reverse -165 -172 10.7572 0.124
NP_442262.1_10 Reverse -290 -297 9.87221 0.164
NP_441689.1_5 Forward -398 -388 17.8758 0.0158
NP_441689.1_5 Forward -175 -165 5.38779 0.265
NP_440163.1_9 Reverse -168 -187 11.1109 0.285
NP_441965.1_10 Reverse -139 -155 3.00846 0.277
NP_440297.1_9 Forward -395 -385 9.51814 0.0917
NP_440297.1_9 Reverse -388 -398 9.22315 0.0917
NP_440297.1_9 Reverse -37 -47 0.766681 0.282
NP_440350.1_5 Forward -33 -14 -6.68705 0.297
NP_442280.1_10 Reverse -294 -312 15.9737 0.107
NP_441896.1_3 Reverse -378 -397 7.07928 0.0974
NP_440894.1_7 Reverse -244 -263 7.96345 0.297
NP_441778.1_10 Forward -35 -17 13.5482 0.294
NP_440999.1_9 Reverse -383 -397 6.3911 0.0979
NP_440888.1_2 Forward -396 -382 7.47213 0.194
NP_440888.1_2 Reverse -289 -303 7.07881 0.208
NP_442277.1_7 Reverse -75 -91 -0.375166 0.224
NP_442033.1_10 Forward -398 -379 -13.6686 0.287
NP_442818.1_3 Reverse -263 -280 -4.68105 0.249
NP_441759.1_2 Forward -306 -287 -0.000545616 0.249
NP_441543.1_2 Reverse -388 -397 15.9293 0.00518
NP_441543.1_2 Forward -395 -386 9.34117 0.0818
NP_441543.1_2 Forward -38 -29 5.70292 0.181
NP_442845.1_2 Forward -179 -165 6.6861 0.205
NP_441551.1_5 Reverse -383 -399 17.954 0.0388
NP_441551.1_5 Reverse -285 -301 8.5143 0.238
NP_441469.1_8 Reverse -386 -395 13.3727 0.073
NP_441469.1_8 Forward -397 -388 6.5879 0.227
NP_443064.1_6 Forward -396 -386 13.8273 0.0796
NP_443064.1_6 Reverse -387 -397 10.8217 0.13
NP_442337.1_8 Reverse -256 -275 6.88262 0.199
NP_442337.1_8 Reverse -297 -316 -0.4922 0.274
NP_442337.1_8 Reverse -298 -317 -0.590531 0.276
NP_442578.1_7 Forward -395 -388 14.5921 0.026
NP_442578.1_7 Reverse -388 -395 14.5921 0.026
NP_440220.1_4 Forward -68 -49 -3.93454 0.298
NP_441462.1_2 Reverse -387 -397 20.2362 0.000805
NP_441462.1_2 Forward -396 -386 20.1379 0.000967
NP_441621.1_7 Reverse -385 -399 2.5562 0.123
NP_441621.1_7 Reverse -287 -301 -4.91696 0.248
NP_443062.1_1 Reverse -164 -182 7.27833 0.18
NP_443062.1_6 Reverse -28 -47 7.7676 0.161
NP_443062.1_6 Reverse -379 -398 5.11266 0.209
NP_442204.1_1 Forward -311 -300 9.59678 0.0736
NP_442204.1_1 Forward -400 -389 0.157002 0.283
NP_440255.1_3 Reverse -54 -64 13.9631 0.298
NP_440516.1_8 Forward -396 -387 16.9127 0.00442
NP_440516.1_8 Reverse -387 -396 16.9127 0.00442
NP_440516.1_8 Forward -335 -326 -0.295266 0.232
NP_442428.1_5 Forward -395 -388 15.8704 0.0124
NP_442428.1_5 Reverse -388 -395 15.8704 0.0124
NP_442428.1_5 Forward -297 -290 4.46401 0.267
NP_441443.1_1 Reverse -185 -204 -2.95047 0.278
NP_440673.1_2 Reverse -199 -218 7.85324 0.288
NP_440673.1_3 Forward -394 -387 12.4288 0.0426
NP_440673.1_3 Reverse -389 -396 12.4288 0.0426
NP_440673.1_3 Reverse -291 -298 10.5605 0.123
NP_440673.1_3 Forward -43 -36 8.98723 0.203
NP_441052.1_2 Forward -396 -386 10.4031 0.0285
NP_441052.1_2 Reverse -387 -397 10.4031 0.0285
NP_442219.1_9 Forward -395 -386 8.25953 0.0681
NP_442219.1_9 Reverse -388 -397 8.25953 0.0681
NP_440436.1_4 Forward -395 -386 15.9289 0.00508
NP_440436.1_4 Reverse -388 -397 9.24241 0.0871
NP_440436.1_4 Forward -44 -35 7.76745 0.124
NP_441884.1_9 Forward -399 -380 -23.305 0.284
NP_440314.1_9 Forward -395 -376 -10.4236 0.298
NP_442414.1_9 Reverse -283 -302 11.6025 0.282
NP_442907.1_9 Forward -150 -131 -3.63879 0.269
NP_442577.1_9 Reverse -60 -74 11.4053 0.253
NP_441719.1_2 Reverse -218 -232 13.2523 0.286
NP_441719.1_4 Forward -395 -388 16.3621 0.0124
NP_441719.1_4 Reverse -388 -395 16.3621 0.0124
NP_441719.1_6 Forward -159 -140 6.88182 0.269
NP_441733.1_10 Forward -399 -386 6.60746 0.179
NP_441004.1_1 Reverse -356 -375 -14.4552 0.268
NP_441004.1_1 Forward -307 -288 -17.9951 0.296
NP_443029.1_8 Forward -377 -358 12.8808 0.293
NP_441115.1_4 Forward -397 -379 13.883 0.067
NP_443054.1_2 Forward -398 -384 9.93102 0.0832
NP_442308.1_7 Forward -75 -56 15.395 0.27
NP_441851.1_7 Reverse -293 -312 8.06259 0.286
NP_441851.1_9 Forward -310 -291 6.78429 0.291
NP_441851.1_10 Reverse -386 -396 17.4829 0.0027
NP_441851.1_10 Forward -397 -387 8.53483 0.114
NP_441157.1_1 Reverse -114 -128 6.48882 0.203
NP_442001.1_4 Forward -206 -187 13.0766 0.189
NP_442622.1_1 Reverse -288 -307 -12.9802 0.282
NP_442515.1_1 Forward -397 -383 14.5526 0.0276
NP_442515.1_1 Forward -213 -199 8.94771 0.0689
NP_442515.1_1 Reverse -386 -400 2.5562 0.133
NP_442515.1_1 Reverse -63 -77 -0.393733 0.222
NP_440593.1_10 Reverse -27 -46 25.2705 0.0128
NP_440463.1_8 Reverse -288 -307 11.7597 0.203
NP_441046.1_2 Reverse -25 -44 11.4058 0.191
NP_441046.1_2 Reverse -376 -395 11.1109 0.191
NP_441046.1_2 Reverse -53 -72 10.8159 0.191
NP_442689.1_8 Forward -59 -42 -8.81095 0.298
NP_441409.1_6 Reverse -381 -400 10.1275 0.024
NP_441409.1_8 Reverse -74 -93 10.4871 0.22
NP_440432.1_9 Forward -395 -380 -2.08505 0.167
NP_440432.1_9 Reverse -290 -305 -5.7233 0.263
NP_441062.1_6 Forward -31 -13 14.0797 0.246
NP_442843.1_1 Forward -306 -287 -7.57203 0.249
NP_439960.1_3 Reverse -64 -83 8.84924 0.202
NP_440474.1_8 Forward -297 -283 5.1122 0.257
NP_441124.1_5 Reverse -50 -60 13.9631 0.215
NP_440431.1_3 Reverse -364 -383 -8.35868 0.232
NP_440431.1_3 Forward -74 -55 -9.44032 0.246
NP_440431.1_4 Reverse -12 -31 -4.4408 0.226
NP_442450.1_5 Reverse -385 -395 10.1081 0.115
NP_442450.1_5 Forward -398 -388 9.41981 0.115
NP_442168.1_6 Forward -42 -23 6.19431 0.29
NP_440588.1_5 Reverse -19 -33 18.0845 0.174
NP_440943.1_6 Forward -305 -286 16.8141 0.202
NP_442006.1_2 Forward -307 -290 -7.53264 0.176
NP_441003.1_9 Forward -322 -303 11.7008 0.213
NP_441078.1_4 Forward -396 -387 19.6659 0.0007
NP_441078.1_4 Reverse -387 -396 19.6659 0.0007
NP_441078.1_4 Reverse -64 -73 -1.27858 0.246
NP_442729.1_8 Reverse -383 -396 10.344 0.125
NP_442388.1_3 Forward -301 -282 7.47261 0.282
NP_440539.1_9 Reverse -269 -288 -6.88371 0.293
NP_440707.1_9 Forward -378 -359 6.09597 0.235
NP_442443.1_1 Forward -378 -359 5.01433 0.157
NP_442443.1_1 Reverse -358 -377 -5.80207 0.285
NP_442443.1_1 Reverse -302 -321 -6.29373 0.294
NP_440526.1_3 Forward -395 -384 11.3662 0.0646
NP_440526.1_3 Forward -202 -191 3.8931 0.267
NP_440526.1_3 Reverse -388 -399 1.82816 0.267
NP_441432.1_8 Forward -397 -388 16.8143 0.00595
NP_441432.1_8 Reverse -386 -395 8.35786 0.0755
NP_441432.1_8 Reverse -63 -72 5.60459 0.147
NP_441432.1_8 Reverse -35 -44 5.40793 0.158
NP_441432.1_8 Forward -299 -290 5.3096 0.17
NP_441432.1_9 Forward -31 -18 11.0223 0.235
NP_442344.1_10 Forward -399 -380 17.6007 0.23
NP_441732.1_2 Forward -400 -384 3.00846 0.0141
NP_442003.1_9 Reverse -1 -20 9.0459 0.219
NP_440760.1_1 Forward -396 -377 7.07928 0.0115
NP_440199.1_10 Forward -399 -389 14.238 0.0861
NP_443011.1_4 Reverse -35 -54 6.58763 0.277
NP_442489.1_7 Forward -396 -387 20.1576 0.000695
NP_442489.1_7 Reverse -387 -396 20.1576 0.000695
NP_442489.1_7 Reverse -64 -73 -1.27858 0.185
NP_442489.1_7 Forward -73 -64 -1.77023 0.247
NP_441830.1_2 Reverse -295 -314 10.4225 0.08
NP_442079.1_7 Forward -395 -376 3.6377 0.211
NP_440559.1_1 Forward -395 -386 17.306 0.00658
NP_440559.1_1 Reverse -388 -397 8.65285 0.0586
NP_441659.2_8 Reverse -387 -397 20.9245 0.000805
NP_441659.2_8 Forward -396 -386 19.3512 0.000966
NP_441659.2_8 Forward -319 -309 1.455 0.24
NP_441022.1_1 Forward -63 -54 10.8747 0.284
NP_442913.1_10 Reverse -378 -397 6.88262 0.0577
NP_440708.1_6 Reverse -300 -319 -6.88371 0.24
NP_441800.1_7 Reverse -284 -302 -2.63579 0.264
NP_442346.1_1 Reverse -169 -188 15.8307 0.247
NP_442346.1_2 Reverse -376 -395 3.73603 0.293
NP_442346.1_5 Reverse -386 -396 17.9746 0.00128
NP_442346.1_5 Forward -397 -387 16.303 0.00248
NP_442346.1_5 Reverse -35 -45 10.5014 0.0934
NP_442346.1_10 Reverse -287 -306 7.7676 0.168
NP_440545.1_3 Forward -400 -383 7.61033 0.0489
NP_440545.1_3 Reverse -383 -400 -0.0594896 0.147
NP_440545.1_3 Forward -323 -306 -4.28772 0.223
NP_440545.1_5 Reverse -273 -290 3.97208 0.276
NP_441856.1_3 Forward -399 -380 -0.787193 0.228
NP_440831.1_3 Forward -292 -273 6.9696 0.268
NP_441629.1_3 Forward -197 -178 -3.24622 0.277
NP_440459.1_2 Reverse -55 -72 7.70866 0.283
NP_440010.1_3 Forward -310 -291 -8.16202 0.294
NP_441943.1_9 Forward -24 -10 21.2384 0.125
NP_442603.1_7 Forward -396 -382 16.5185 0.0304
NP_441888.1_7 Reverse -284 -298 0.982901 0.272
NP_441050.1_5 Reverse -180 -198 -2.53746 0.283
NP_440449.1_6 Reverse -379 -397 8.74215 0.194
NP_441833.1_4 Forward -395 -388 15.9687 0.0124
NP_441833.1_4 Reverse -388 -395 15.9687 0.0124
NP_441112.1_6 Forward -254 -235 0.294447 0.278
NP_442162.1_9 Forward -395 -388 16.2637 0.0124
NP_442162.1_9 Reverse -388 -395 16.2637 0.0124
NP_440772.1_6 Forward -306 -287 7.27595 0.292
NP_442140.1_3 Forward -395 -385 14.828 0.0433
NP_442140.1_3 Forward -297 -287 8.63316 0.119
NP_442021.1_4 Reverse -1 -20 24.0905 0.0257
NP_440875.1_9 Reverse -389 -399 7.59334 0.255
NP_440875.1_9 Forward -310 -300 6.81464 0.297
NP_441813.1_5 Forward -398 -388 15.9097 0.01
NP_441813.1_5 Reverse -385 -395 8.92815 0.0347
NP_440594.1_8 Forward -395 -382 18.8982 0.0537
NP_440594.1_10 Forward -27 -13 20.5501 0.0318
NP_440590.1_4 Forward -395 -382 5.23083 0.0585
NP_440567.1_1 Forward -395 -381 2.16287 0.182
NP_440567.1_1 Reverse -290 -304 -0.492064 0.287
NP_442497.1_10 Forward -395 -386 19.8626 0.00532
NP_442497.1_10 Reverse -388 -397 17.601 0.00813
NP_440821.1_4 Reverse -385 -395 19.5479 0.00399
NP_440821.1_4 Forward -398 -388 11.0914 0.0146
NP_441239.1_9 Forward -398 -386 15.6736 0.0186
NP_441239.1_9 Reverse -385 -397 14.4936 0.0272
NP_441239.1_9 Reverse -296 -308 5.84051 0.206
NP_441239.1_9 Forward -300 -288 3.97222 0.269
NP_441239.1_9 Reverse -287 -299 3.18557 0.292
NP_440400.1_1 Forward -269 -250 -2.65624 0.285
NP_441017.1_6 Forward -400 -386 12.6836 0.217
NP_440833.1_6 Forward -262 -248 6.98048 0.292
NP_440354.1_7 Reverse -203 -221 6.70565 0.278
NP_440546.1_4 Reverse -387 -397 13.5365 0.0459
NP_440546.1_4 Forward -396 -386 12.8578 0.0572
NP_439974.1_4 Forward -309 -290 8.45592 0.282
NP_440675.1_1 Reverse -200 -219 8.16093 0.195
NP_440675.1_4 Reverse -247 -266 14.1591 0.225
NP_440462.1_6 Forward -398 -388 16.893 0.00853
NP_440462.1_6 Reverse -385 -395 10.4031 0.0396
NP_442565.1_6 Reverse -11 -25 15.3392 0.28
NP_440868.1_4 Reverse -383 -395 12.3303 0.0242
NP_440868.1_4 Forward -400 -388 5.93884 0.0879
NP_440868.1_4 Reverse -285 -297 0.923956 0.196
NP_442479.1_9 Forward -62 -43 0.687771 0.191
NP_442402.1_4 Forward -30 -11 -4.72118 0.229
NP_442402.1_4 Reverse -207 -226 -10.326 0.299
NP_441848.1_4 Reverse -44 -60 11.0839 0.232
NP_441848.1_6 Forward -196 -177 13.6666 0.288
NP_441084.1_6 Forward -232 -218 10.5076 0.238
NP_442039.1_4 Forward -395 -388 15.1821 0.0124
NP_442039.1_4 Reverse -388 -395 15.1821 0.0124
NP_442039.1_7 Forward -216 -206 14.0414 0.211
NP_442039.1_7 Forward -296 -286 13.7464 0.211
NP_441811.1_8 Reverse -381 -395 18.2892 0.0563
NP_441180.1_2 Reverse -22 -41 11.1627 0.287
NP_442679.1_1 Reverse -11 -30 -0.688862 0.223
NP_440825.1_6 Reverse -186 -205 13.8641 0.244
NP_442696.1_6 Forward -266 -247 -11.6036 0.235
NP_442837.1_3 Forward -395 -388 15.7721 0.0124
NP_442837.1_3 Reverse -388 -395 15.7721 0.0124
NP_442053.1_1 Forward -396 -387 18.3876 0.0007
NP_442053.1_1 Reverse -387 -396 18.3876 0.0007
NP_440505.1_3 Forward -398 -388 15.123 0.014
NP_440505.1_3 Reverse -385 -395 7.84651 0.147
NP_440505.1_3 Reverse -34 -44 4.3066 0.3
NP_442360.1_1 Forward -36 -18 16.5388 0.278
NP_440520.1_6 Reverse -18 -37 10.8159 0.0783
NP_441252.1_6 Reverse -248 -255 14.3954 0.168
NP_441252.1_6 Forward -377 -370 11.6422 0.288
NP_442532.1_2 Reverse -17 -36 5.87233 0.204
NP_440914.1_1 Reverse -387 -397 16.3248 0.00196
NP_440914.1_1 Reverse -64 -74 11.3477 0.097
NP_440914.1_1 Forward -218 -208 9.39583 0.186
NP_440914.1_1 Forward -396 -386 8.51751 0.186
NP_441011.1_1 Forward -319 -300 11.2092 0.27
NP_441011.1_8 Reverse -388 -397 16.6177 0.00602
NP_441011.1_8 Forward -395 -386 14.356 0.0249
NP_442101.1_4 Reverse -27 -46 9.53756 0.244
NP_442533.1_1 Reverse -170 -189 -16.8151 0.277
NP_442533.1_6 Forward -396 -387 17.2076 0.00137
NP_442533.1_6 Reverse -387 -396 17.2076 0.00137
NP_442533.1_6 Reverse -304 -313 2.458 0.255
NP_442541.1_10 Forward -190 -176 1.67063 0.282
NP_442322.1_4 Forward -201 -184 -8.51661 0.286
NP_443016.1_1 Forward -325 -306 -5.60541 0.251
NP_441482.1_7 Reverse -381 -395 -8.65353 0.193
NP_441482.1_7 Forward -266 -252 -11.6035 0.275
NP_439944.1_9 Reverse -388 -398 17.6796 0.00347
NP_439944.1_9 Forward -395 -385 17.4829 0.00423
NP_441527.1_4 Reverse -16 -35 -7.78302 0.237
NP_441527.1_5 Reverse -13 -32 11.8235 0.297
NP_441527.1_7 Reverse -198 -217 7.27514 0.29
NP_440115.1_6 Reverse -384 -394 18.2696 0.0139
NP_441680.1_4 Forward -318 -299 -1.86883 0.266
NP_441961.1_4 Reverse -357 -376 3.24438 0.281
NP_440608.1_6 Forward -211 -192 3.34192 0.29
NP_441106.1_1 Forward -397 -388 18.486 0.0028
NP_441106.1_1 Reverse -386 -395 9.73449 0.0311
NP_441106.1_1 Forward -299 -290 4.71961 0.21
NP_439903.1_6 Forward -399 -380 2.6536 0.222
NP_442588.1_6 Reverse -178 -197 -0.39387 0.263
NP_442588.1_8 Reverse -373 -392 7.27595 0.238
NP_441186.1_3 Forward -189 -170 16.0265 0.197
NP_441286.1_1 Forward -397 -385 14.7886 0.00418
NP_441286.1_1 Reverse -386 -398 4.95553 0.027
NP_442674.1_1 Forward -221 -202 12.4059 0.222
NP_442674.1_3 Reverse -302 -321 2.26028 0.3
NP_440092.1_9 Forward -302 -283 16.0274 0.235
NP_440670.1_8 Forward -396 -387 18.3876 0.000699
NP_440670.1_8 Reverse -387 -396 18.3876 0.000699
NP_440670.1_8 Forward -335 -326 3.63797 0.239
NP_441705.1_3 Reverse -371 -390 5.80098 0.21
NP_441930.1_2 Reverse -309 -319 11.1898 0.298
NP_440886.1_7 Forward -397 -387 8.04271 0.0805
NP_440886.1_7 Reverse -386 -396 8.04271 0.0805
NP_442614.1_2 Forward -396 -382 16.8142 0.0658
NP_442072.1_9 Forward -397 -379 -12.3706 0.0852
NP_441753.1_10 Forward -307 -288 3.93269 0.204
NP_442022.1_4 Reverse -304 -323 6.09597 0.273
NP_440907.2_8 Forward -395 -385 19.449 0.00351
NP_440907.2_8 Reverse -388 -398 9.51767 0.103
NP_442264.1_2 Reverse -199 -216 18.1317 0.0879
NP_442264.1_2 Reverse -26 -43 10.2653 0.188
NP_442264.1_2 Reverse -32 -49 4.85706 0.292
NP_441463.1_3 Reverse -279 -298 14.2574 0.0291
NP_441463.1_6 Forward -398 -384 15.4995 0.152
NP_441626.1_2 Forward -395 -388 15.7721 0.0124
NP_441626.1_2 Reverse -388 -395 15.7721 0.0124
NP_439958.1_2 Reverse -103 -117 16.1259 0.17
NP_442365.1_5 Forward -297 -278 11.1109 0.167
NP_441460.1_2 Forward -20 -7 15.85 0.171
NP_440107.1_5 Forward -305 -286 0.58944 0.178
NP_442615.1_1 Reverse -378 -396 -5.29072 0.209
NP_441962.1_4 Forward -312 -293 -6.58872 0.18
NP_440387.1_1 Forward -396 -380 4.58176 0.0407
NP_440855.1_5 Forward -192 -173 5.2102 0.285
NP_441431.1_2 Reverse -286 -300 12.782 0.107
NP_441431.1_2 Reverse -384 -398 9.04542 0.198
NP_441521.1_5 Forward -372 -353 24.2872 0.0112
NP_440634.1_3 Forward -195 -176 19.0757 0.191
NP_441174.1_2 Forward -301 -287 16.4209 0.0763
NP_440814.1_4 Reverse -378 -397 -1.57384 0.136
NP_440114.1_10 Forward -396 -382 12.9793 0.0681
NP_440114.1_10 Forward -298 -284 7.66941 0.229
NP_440114.1_10 Reverse -289 -303 5.70279 0.296
NP_441510.2_7 Reverse -88 -102 15.9285 0.28
NP_440293.1_3 Forward -315 -296 5.50599 0.192
NP_440293.1_3 Reverse -296 -315 -6.39206 0.288
NP_440766.1_4 Forward -400 -386 4.52282 0.126
NP_441237.1_9 Forward -395 -385 17.2863 0.00348
NP_442930.1_1 Reverse -108 -118 13.1559 0.239
NP_441133.1_1 Reverse -189 -208 19.0757 0.12
NP_439910.1_2 Reverse -379 -396 -13.5308 0.162
NP_442867.1_8 Forward -391 -372 5.60432 0.276
NP_442867.1_8 Reverse -291 -310 5.50599 0.276
NP_442867.1_8 Reverse -237 -256 4.52268 0.281
NP_440457.1_1 Reverse -383 -395 9.97041 0.092
NP_440457.1_1 Reverse -184 -196 0.23564 0.25
NP_440457.1_1 Forward -400 -388 0.137309 0.25
NP_440457.1_5 Reverse -358 -377 21.2389 0.106
NP_440798.1_6 Forward -395 -382 3.06754 0.153
NP_442297.1_4 Reverse -337 -356 12.9187 0.255
NP_440473.1_9 Reverse -376 -395 -7.37537 0.236
NP_442509.1_9 Forward -396 -386 17.3841 0.00128
NP_442509.1_9 Reverse -387 -397 8.04271 0.192
NP_440734.1_9 Reverse -355 -374 10.8159 0.271
NP_440554.1_4 Reverse -388 -398 16.1063 0.0189
NP_440554.1_4 Forward -395 -385 6.27322 0.123
NP_440554.1_4 Reverse -290 -300 4.69992 0.181
NP_442737.1_9 Forward -297 -278 17.3149 0.199
NP_441885.1_5 Forward -396 -386 11.3864 0.00668
NP_441885.1_5 Reverse -387 -397 11.3864 0.00668
NP_441885.1_5 Reverse -310 -320 -1.78992 0.284
NP_441428.1_8 Reverse -379 -398 2.3594 0.273
NP_442341.1_7 Forward -397 -383 6.48943 0.126
NP_442341.1_7 Forward -320 -306 1.27789 0.295
NP_442341.1_9 Forward -398 -384 7.47213 0.198
NP_441756.1_5 Reverse -354 -373 -4.32711 0.294
NP_443000.1_7 Forward -398 -388 17.4829 0.00719
NP_443000.1_7 Reverse -385 -395 2.14332 0.226
NP_441842.1_1 Forward -394 -381 11.4251 0.254
NP_440275.1_3 Reverse -385 -395 19.5479 0.00756
NP_440275.1_3 Forward -398 -388 9.12481 0.055
NP_440275.1_3 Forward -337 -327 3.42162 0.229
NP_440091.1_1 Forward -400 -388 8.9871 0.0567
NP_440091.1_1 Reverse -383 -395 0.825626 0.227
NP_443060.1_5 Forward -291 -272 13.175 0.112
NP_442354.1_8 Reverse -352 -371 11.9958 0.223
NP_441902.1_3 Reverse -275 -285 12.2043 0.259
NP_440679.1_4 Forward -291 -272 9.24257 0.274
NP_443010.1_10 Forward -399 -382 18.0389 0.0367
NP_439962.1_4 Forward -306 -287 -0.295539 0.199
NP_440175.1_7 Reverse -299 -317 11.5101 0.23
NP_440149.1_8 Reverse -64 -83 -6.68705 0.258
NP_441105.1_3 Forward -324 -305 -6.39206 0.234
NP_440216.1_1 Forward -396 -382 -1.18038 0.0301
NP_440216.1_9 Forward -306 -297 7.17789 0.286
NP_440172.1_1 Reverse -387 -397 17.5813 0.00421
NP_440172.1_1 Forward -396 -386 16.303 0.00854
NP_442015.1_3 Forward -189 -170 16.1249 0.162
NP_442015.1_10 Reverse -383 -396 3.65753 0.178
NP_441226.1_7 Forward -395 -388 14.4934 0.0123
NP_441226.1_7 Reverse -388 -395 14.4934 0.0123
NP_441111.1_7 Forward -395 -387 18.7023 0.00294
NP_441111.1_7 Reverse -388 -396 18.7023 0.00294
NP_441766.1_2 Forward -396 -387 17.5026 0.00297
NP_441766.1_2 Reverse -387 -396 17.5026 0.00297
NP_440416.1_9 Reverse -287 -306 -21.83 0.297
NP_442154.1_1 Reverse -186 -204 -10.0106 0.197
NP_442154.1_1 Forward -306 -288 -14.0422 0.217
NP_440261.1_5 Forward -395 -382 24.1104 0.00402
NP_440988.1_5 Forward -330 -311 13.3483 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAAGGCGATCGCCCCCAATTTGTGGTGCAACAGTTGCTCCAGGCAGAAAGTCCTTCCCTAGAGAGACGATTGGGTAACTTGCCCACAGCCCAGGCCAGGGAAGCAATGGCGGCCTTGCTGACCAACCTTAGCCAGCCAGACAAATTGCCCAAACAGGAAGCTGACTTAAGGGTATGGTTAAAACAATGGCAACAACTACAAGCCCAACTGCCCCCCTCCAGCTCAAATCCATCGGGTAAGGTCCTCAAATCCAGTGCGGCAGAGTAACCGATTAAGTTTAAGTTAATATTTTGTGCTCGGTTCGGTGTTTTTAGGTGTTAATTTATGGCCTTTGCCAATAAATTTTGCTAGAAGTACCATTGCCATCAATTTCTTGATTTTTTCCCTTGACCAAACCCT

CDS

ATGACCCGTCCCCTGTTTAACGAACTCCGTGGCCATTTGGAAGCATTTTTGGTGGGTCAACCCCATCTCATCCAAGAATTATTGGTGGCCCTGTTGGCAGGGGGCCATGTGATCATTGAGGGGGTGCCGGGGACAGGCAAAACCCTGTTGGTGAAACTTCTAGCCCAATCAATTCAATCCCAATTTAGGCGGGTACAACTGACTCCAGATATGTTGCCCTCCGATATGGTGGGGGTAAACGTGTTTGACTTCAACCAGCAAGCCTTTAGCCTCAAACAGGGCCCTGTATTTACGGAAATTTTGCTGGCAGATGAAATTAACCGCACTCCCCCCAAAACCCAGTCCGCCCTGCTTGAAGCGATGGAAGAGCAACAGGTGACCCTCGATGGTCATACCTATGCCCTGCCGCCTTTATTCTGGGTGGTGGCCACCCAAAACCCCTTGGAATTTGAAGGTACCTATCCCTTGCCAGAAGCCCAACTAGACCGCTTTTTATTTAAGCTAGTGGTGGACTATCCTCCCCCGGCCGCGGCCAAACAAATGTTGGTCAATTTTCAGCAGGGTTTCCACGCCCAACGACAAGACCTGGAACAGTTAACCGCCATTGCCACCGTAGAAGAAATTTTGGCTAGTCGGCGATCAGTAGAAGATATTGCGGTGGATGAAAAACTATTGGATTATCTCTTGGCCCTGGTGGAAAAAACCCGCTATCATCCCGATATTCTGATTGGAGCTTCCCCTAGGGCCTCCCTCCGTTGGTTGCAAGCCGCAAAGGCCGATGCTTGGCTTAATGGCCAGGAATATTTACTGCCGGATAATCTCAAAACCGTTGCTCCGCCGTTATTGCGCCACCGTTTAATTCTAAGGCCGGAAGCCCAGCTTGATGGCATTGGCATTGATGAAGTGATCACCGCCATTCTGGAGCAGACCCCGGTGCCCCGTTGA

Protein

MTRPLFNELRGHLEAFLVGQPHLIQELLVALLAGGHVIIEGVPGTGKTLLVKLLAQSIQSQFRRVQLTPDMLPSDMVGVNVFDFNQQAFSLKQGPVFTEILLADEINRTPPKTQSALLEAMEEQQVTLDGHTYALPPLFWVVATQNPLEFEGTYPLPEAQLDRFLFKLVVDYPPPAAAKQMLVNFQQGFHAQRQDLEQLTAIATVEEILASRRSVEDIAVDEKLLDYLLALVEKTRYHPDILIGASPRASLRWLQAAKADAWLNGQEYLLPDNLKTVAPPLLRHRLILRPEAQLDGIGIDEVITAILEQTPVPR