Your browser is old and dusty. Try Google Chrome!

Details for slr1407

ORF slr1407
Accession NP_440957.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -321 -335 7.47274 0.102
NP_441061.1_2 Forward -199 -185 2.5562 0.174
NP_441061.1_2 Reverse -192 -206 -1.8687 0.274
NP_440557.1_1 Forward -199 -180 -2.26216 0.286
NP_440795.1_7 Forward -328 -321 14.6904 0.0123
NP_440795.1_7 Reverse -321 -328 14.6904 0.0123
NP_440694.1_7 Forward -202 -183 15.7324 0.279
NP_441418.1_6 Reverse -320 -339 -1.7705 0.0154
NP_441418.1_6 Forward -329 -310 -29.3032 0.221
NP_440815.1_2 Reverse -286 -300 14.4536 0.234
NP_440897.1_6 Reverse -320 -339 -0.689632 0.185
NP_440897.1_6 Forward -329 -310 -1.96793 0.2
NP_441453.1_1 Forward -336 -318 10.1465 0.138
NP_441453.1_4 Reverse -320 -328 16.539 0.00633
NP_441453.1_4 Forward -329 -321 16.539 0.00633
NP_441453.1_4 Reverse -191 -199 14.7691 0.0119
NP_441453.1_4 Forward -200 -192 6.80426 0.121
NP_441453.1_4 Forward -19 -11 3.95266 0.275
NP_441453.1_7 Forward -351 -344 13.4121 0.23
NP_441453.1_7 Forward -336 -329 12.1338 0.295
NP_441623.1_1 Forward -336 -318 -4.99573 0.282
NP_441960.1_7 Forward -75 -56 12.6841 0.235
NP_442151.1_6 Forward -329 -315 14.4542 0.0349
NP_442151.1_6 Reverse -320 -334 10.4227 0.123
NP_441818.1_1 Reverse -321 -332 11.4645 0.177
NP_441818.1_6 Forward -207 -193 11.8976 0.253
NP_440226.1_1 Reverse -191 -210 13.4708 0.0356
NP_440226.1_1 Forward -200 -181 11.6025 0.0519
NP_441630.1_3 Reverse -312 -331 1.86774 0.236
NP_440996.1_5 Reverse -101 -110 15.4627 0.195
NP_442173.1_1 Forward -328 -320 15.4574 0.00633
NP_442173.1_1 Reverse -321 -329 15.4574 0.00633
NP_442173.1_1 Forward -199 -191 12.0158 0.0316
NP_442173.1_1 Reverse -192 -200 12.0158 0.0316
NP_442752.1_4 Forward -329 -322 13.8055 0.0199
NP_442752.1_4 Reverse -320 -327 13.8055 0.0199
NP_442752.1_4 Forward -200 -193 13.8055 0.0199
NP_443027.1_4 Forward -21 -11 10.1081 0.144
NP_443027.1_4 Forward -331 -321 6.46988 0.275
NP_441812.1_3 Forward -201 -187 6.98109 0.287
NP_442975.1_10 Reverse -187 -201 4.42388 0.245
NP_442975.1_10 Forward -333 -319 3.04726 0.263
NP_440784.1_7 Forward -328 -321 15.9687 0.0123
NP_440784.1_7 Reverse -321 -328 15.9687 0.0123
NP_440784.1_7 Forward -199 -192 6.23397 0.241
NP_440784.1_7 Reverse -192 -199 6.13563 0.241
NP_442909.1_7 Forward -361 -347 13.5686 0.12
NP_442909.1_7 Reverse -192 -206 11.012 0.131
NP_440061.1_9 Reverse -189 -203 11.4053 0.111
NP_440061.1_9 Reverse -318 -332 10.6187 0.124
NP_440110.1_4 Forward -340 -321 2.3594 0.255
NP_442062.1_8 Forward -329 -319 17.6796 0.00193
NP_442062.1_8 Reverse -320 -330 17.6796 0.00193
NP_442062.1_8 Forward -200 -190 10.0098 0.0527
NP_442062.1_8 Reverse -191 -201 9.61647 0.0587
NP_442062.1_8 Forward -19 -9 8.4365 0.075
NP_441859.1_3 Reverse -190 -209 14.4533 0.0704
NP_441859.1_3 Reverse -319 -338 3.9319 0.23
NP_440304.1_4 Forward -331 -321 17.9746 0.00654
NP_440304.1_4 Reverse -318 -328 9.91146 0.051
NP_442242.1_4 Forward -328 -321 14.3954 0.0124
NP_442242.1_4 Reverse -321 -328 14.3954 0.0124
NP_440044.1_8 Reverse -321 -340 -3.73712 0.29
NP_441492.1_1 Reverse -144 -163 8.75091 0.258
NP_439918.1_2 Forward -256 -237 -3.93378 0.263
NP_441594.1_6 Reverse -353 -372 3.44104 0.23
NP_440132.1_1 Reverse -318 -336 10.9339 0.218
NP_442726.1_7 Forward -336 -318 3.46073 0.215
NP_440856.1_4 Forward -324 -305 -2.95047 0.226
NP_440856.1_4 Forward -336 -317 -3.14714 0.226
NP_441083.1_5 Forward -329 -319 19.3512 0.000718
NP_441083.1_5 Reverse -320 -330 19.3512 0.000718
NP_441083.1_5 Reverse -191 -201 10.1081 0.0208
NP_441083.1_5 Forward -200 -190 8.82982 0.03
NP_442827.1_8 Forward -208 -189 4.42355 0.135
NP_442827.1_8 Forward -337 -318 3.04693 0.152
NP_442827.1_8 Reverse -312 -331 -2.16459 0.27
NP_442827.1_8 Reverse -183 -202 -2.8529 0.29
NP_441434.1_7 Forward -198 -184 6.09611 0.225
NP_441434.1_7 Reverse -193 -207 5.40779 0.225
NP_441738.1_2 Forward -327 -320 15.28 0.0102
NP_441738.1_2 Reverse -322 -329 15.28 0.0102
NP_441738.1_2 Reverse -193 -200 15.28 0.0102
NP_441558.1_5 Forward -331 -312 10.5209 0.0968
NP_440209.1_1 Reverse -320 -328 18.1123 0.00295
NP_440209.1_1 Forward -329 -321 18.1123 0.00295
NP_440209.1_1 Forward -200 -192 8.57422 0.0425
NP_440209.1_1 Reverse -191 -199 8.47588 0.0457
NP_442889.1_8 Forward -332 -318 9.34041 0.1
NP_442889.1_8 Forward -22 -8 5.89884 0.211
NP_440447.1_6 Reverse -312 -330 14.4738 0.0722
NP_440447.1_6 Forward -337 -319 1.19912 0.267
NP_441770.1_4 Forward -177 -158 -7.96535 0.238
NP_441770.1_4 Reverse -329 -348 -8.35868 0.243
NP_440178.1_7 Forward -201 -182 -14.6519 0.156
NP_442570.1_3 Reverse -304 -323 -9.24366 0.296
NP_441792.1_2 Forward -379 -366 17.2272 0.288
NP_441716.1_1 Reverse -320 -334 7.9644 0.153
NP_441716.1_2 Reverse -376 -395 0.00601367 0.266
NP_442111.1_4 Reverse -319 -333 18.6825 0.00603
NP_442111.1_4 Forward -330 -316 7.47274 0.0949
NP_441163.1_4 Forward -362 -343 12.7268 0.278
NP_440906.1_5 Forward -328 -321 15.8704 0.0124
NP_440906.1_5 Reverse -321 -328 15.8704 0.0124
NP_440906.1_5 Forward -199 -192 6.23397 0.234
NP_440906.1_5 Reverse -192 -199 6.13563 0.241
NP_440747.1_10 Reverse -317 -329 5.44718 0.0137
NP_440747.1_10 Forward -332 -320 -2.02597 0.0196
NP_440747.1_10 Forward -203 -191 -11.7607 0.142
NP_440747.1_10 Reverse -188 -200 -11.8591 0.161
NP_441130.1_10 Reverse -189 -203 17.9942 0.0144
NP_441486.1_1 Reverse -188 -202 2.06454 0.0918
NP_441486.1_1 Forward -203 -189 0.589577 0.132
NP_441486.1_1 Forward -332 -318 -2.16369 0.175
NP_441486.1_1 Reverse -317 -331 -2.85201 0.175
NP_442330.1_4 Forward -232 -213 12.4087 0.286
NP_442634.1_4 Forward -331 -317 -4.81863 0.22
NP_442634.1_4 Reverse -318 -332 -4.91696 0.223
NP_441265.1_3 Forward -335 -321 5.1128 0.181
NP_440403.1_4 Forward -338 -319 0.294447 0.144
NP_440842.1_6 Reverse -318 -337 14.9449 0.15
NP_440842.1_10 Forward -332 -318 11.996 0.251
NP_440842.1_10 Reverse -270 -284 5.01447 0.251
NP_441014.1_5 Reverse -345 -363 11.2289 0.261
NP_442848.1_1 Forward -335 -321 -2.16369 0.263
NP_442848.1_1 Forward -206 -192 -3.34366 0.265
NP_442848.1_1 Reverse -185 -199 -3.93365 0.275
NP_442848.1_9 Forward -244 -225 -0.983855 0.282
NP_441012.1_4 Reverse -193 -206 8.27909 0.272
NP_443018.1_3 Forward -328 -321 14.8871 0.0123
NP_443018.1_3 Reverse -321 -328 14.8871 0.0123
NP_443018.1_3 Reverse -192 -199 11.7405 0.0655
NP_443018.1_3 Forward -18 -11 11.3472 0.0846
NP_443018.1_3 Forward -199 -192 5.44732 0.193
NP_443018.1_3 Reverse -11 -18 4.16902 0.278
NP_441316.1_7 Forward -331 -316 2.04485 0.156
NP_441316.1_7 Reverse -189 -204 -3.65835 0.286
NP_441634.1_8 Reverse -189 -203 3.04785 0.157
NP_440376.1_1 Forward -329 -320 19.4693 0.000692
NP_440376.1_1 Reverse -320 -329 19.4693 0.000692
NP_440376.1_1 Forward -200 -191 15.7327 0.00625
NP_440376.1_1 Reverse -191 -200 9.63616 0.0385
NP_441588.1_4 Forward -327 -317 6.96153 0.178
NP_442687.1_7 Forward -330 -320 18.5646 0.0028
NP_442687.1_7 Reverse -319 -329 18.5646 0.0028
NP_442687.1_7 Forward -201 -191 13.5497 0.0466
NP_442687.1_7 Reverse -97 -107 9.51814 0.0994
NP_442687.1_7 Reverse -190 -200 5.97822 0.179
NP_442687.1_7 Reverse -307 -317 3.61828 0.299
NP_441846.1_10 Forward -218 -199 -23.305 0.282
NP_440642.1_10 Forward -283 -269 9.34041 0.193
NP_440642.1_10 Forward -103 -89 1.27731 0.296
NP_441013.1_2 Forward -357 -339 -4.8974 0.299
NP_440042.1_2 Reverse -310 -329 0.196116 0.213
NP_441422.1_7 Reverse -189 -206 11.9369 0.0565
NP_440533.1_6 Forward -362 -343 19.764 0.0764
NP_440667.1_2 Reverse -300 -319 9.63589 0.189
NP_440360.1_10 Reverse -193 -207 7.9644 0.227
NP_440360.1_10 Forward -327 -313 3.8345 0.227
NP_442658.1_1 Forward -331 -321 17.6791 0.00565
NP_442658.1_1 Reverse -318 -328 14.8275 0.0188
NP_442658.1_1 Forward -202 -192 9.02601 0.169
NP_442658.1_1 Reverse -189 -199 6.27276 0.234
NP_440141.1_8 Forward -209 -190 7.7676 0.236
NP_441855.2_4 Forward -337 -318 21.7667 0.00802
NP_442205.1_9 Forward -206 -190 -3.08806 0.278
NP_441414.1_9 Forward -329 -310 13.6675 0.0137
NP_440720.1_1 Forward -340 -321 4.03102 0.26
NP_442937.1_5 Forward -334 -315 6.29264 0.282
NP_441958.1_5 Forward -330 -320 20.5312 0.000966
NP_441958.1_5 Reverse -319 -329 20.5312 0.000966
NP_441958.1_5 Forward -201 -191 10.0098 0.0167
NP_441958.1_5 Reverse -190 -200 2.43831 0.0422
NP_441127.1_1 Reverse -233 -247 7.76774 0.3
NP_439905.1_1 Reverse -192 -205 19.2922 0.0177
NP_439905.1_1 Forward -328 -315 7.00078 0.269
NP_440984.1_7 Reverse -315 -329 10.6193 0.122
NP_439990.1_5 Reverse -315 -328 7.78743 0.186
NP_442690.1_1 Reverse -26 -45 -11.3086 0.228
NP_442690.1_1 Reverse -125 -144 -16.2252 0.285
NP_442911.1_2 Forward -210 -191 9.0459 0.0185
NP_442911.1_2 Reverse -310 -329 6.39097 0.0289
NP_442911.1_2 Forward -339 -320 5.211 0.0344
NP_441580.1_6 Reverse -180 -199 -7.96535 0.25
NP_440153.1_5 Reverse -49 -63 2.45787 0.223
NP_440153.1_8 Reverse -272 -285 -3.61896 0.296
NP_441591.1_10 Forward -202 -183 7.47261 0.275
NP_442064.1_1 Reverse -43 -62 -13.1769 0.285
NP_442236.1_3 Forward -299 -280 11.2092 0.189
NP_440993.1_2 Forward -334 -318 3.40179 0.259
NP_440993.1_3 Forward -339 -320 4.22689 0.167
NP_440934.1_1 Reverse -306 -325 4.71934 0.25
NP_440827.1_3 Reverse -282 -301 10.6192 0.298
NP_440138.1_6 Reverse -321 -340 0.883656 0.291
NP_441099.1_5 Forward -339 -320 4.81767 0.0479
NP_441099.1_5 Reverse -310 -329 -11.6036 0.287
NP_442002.1_9 Forward -330 -323 14.1004 0.074
NP_442002.1_9 Reverse -319 -326 14.1004 0.074
NP_442002.1_9 Forward -201 -194 10.7572 0.185
NP_440809.1_9 Reverse -311 -329 -7.94566 0.225
NP_441646.1_1 Forward -207 -188 0.392778 0.251
NP_442438.1_10 Reverse -300 -314 8.55439 0.0769
NP_442438.1_10 Forward -205 -191 5.40779 0.134
NP_442438.1_10 Reverse -186 -200 1.08123 0.206
NP_441000.1_6 Forward -201 -187 3.53951 0.111
NP_441000.1_6 Forward -357 -343 2.16287 0.148
NP_441000.1_6 Reverse -190 -204 1.86788 0.159
NP_442771.1_1 Reverse -318 -336 2.77242 0.0672
NP_442771.1_1 Forward -331 -313 -4.20908 0.166
NP_440147.1_4 Reverse -318 -331 22.9304 0.00117
NP_440147.1_4 Forward -331 -318 4.34585 0.164
NP_440147.1_4 Reverse -189 -202 1.69091 0.222
NP_440147.1_4 Forward -202 -189 0.314277 0.257
NP_441550.1_8 Forward -331 -321 19.8424 0.00352
NP_441550.1_8 Reverse -318 -328 17.6791 0.00754
NP_441550.1_8 Forward -202 -192 9.22267 0.103
NP_441550.1_8 Forward -358 -348 6.96107 0.183
NP_441550.1_8 Reverse -189 -199 5.09279 0.267
NP_441331.1_1 Reverse -315 -334 -10.1286 0.297
NP_441916.1_7 Reverse -320 -330 16.893 0.00407
NP_441916.1_7 Forward -329 -319 16.893 0.00407
NP_441916.1_7 Reverse -191 -201 8.82982 0.0409
NP_441916.1_7 Forward -200 -190 8.73149 0.042
NP_441916.1_7 Reverse -10 -20 2.63497 0.246
NP_441041.1_4 Forward -329 -310 -9.63698 0.219
NP_441041.1_7 Forward -332 -320 12.4708 0.0611
NP_441041.1_7 Reverse -317 -329 11.8878 0.0689
NP_441041.1_7 Forward -203 -191 6.64018 0.2
NP_442396.1_5 Reverse -316 -329 11.9173 0.0913
NP_442996.1_1 Reverse -3 -22 4.91741 0.251
NP_440703.1_3 Forward -201 -182 15.7856 0.297
NP_441725.1_4 Forward -334 -320 9.04542 0.178
NP_441725.1_5 Reverse -321 -331 18.7612 0.0119
NP_441725.1_5 Forward -328 -318 11.7798 0.0247
NP_441725.1_5 Forward -199 -189 1.55333 0.133
NP_441725.1_5 Reverse -192 -202 -0.806614 0.271
NP_439966.1_7 Reverse -189 -199 17.4824 0.00636
NP_439966.1_7 Forward -331 -321 8.14104 0.14
NP_439966.1_7 Forward -202 -192 7.74772 0.15
NP_439966.1_9 Forward -202 -193 10.7178 0.0863
NP_439966.1_9 Forward -331 -322 0.983037 0.253
NP_442941.1_3 Forward -328 -318 2.53664 0.14
NP_442941.1_3 Reverse -321 -331 2.43831 0.14
NP_442941.1_3 Forward -199 -189 1.74999 0.147
NP_440289.1_2 Forward -332 -319 14.2773 0.0116
NP_440289.1_2 Reverse -317 -330 7.19745 0.0579
NP_440289.1_2 Reverse -188 -201 4.8375 0.0644
NP_440260.1_8 Forward -291 -273 -6.96235 0.295
NP_442281.1_1 Reverse -186 -200 17.1085 0.00656
NP_442281.1_1 Forward -334 -320 10.3237 0.0595
NP_442281.1_1 Reverse -315 -329 3.63724 0.224
NP_441079.1_7 Reverse -3 -22 -3.24622 0.233
NP_442575.1_8 Reverse -86 -105 -5.60541 0.269
NP_440177.1_9 Reverse -2 -21 13.7658 0.226
NP_442256.1_2 Forward -331 -313 1.29745 0.107
NP_440437.1_1 Reverse -185 -204 -0.4922 0.181
NP_440437.1_1 Reverse -328 -347 -5.70374 0.292
NP_442012.1_1 Forward -335 -316 5.40766 0.153
NP_442012.1_1 Reverse -314 -333 3.73603 0.179
NP_441556.1_10 Forward -205 -191 11.6819 0.219
NP_441644.1_6 Forward -329 -319 15.7125 0.0048
NP_441644.1_6 Reverse -320 -330 15.7125 0.0048
NP_441644.1_6 Reverse -191 -201 9.81266 0.0678
NP_440867.1_6 Reverse -194 -213 15.1416 0.221
NP_440867.1_10 Forward -312 -293 3.24438 0.283
NP_442215.1_2 Forward -103 -87 1.33684 0.136
NP_442215.1_2 Forward -373 -357 -2.39974 0.197
NP_442215.1_2 Forward -331 -315 -4.56302 0.235
NP_442029.1_6 Forward -235 -216 5.11266 0.255
NP_442247.1_8 Reverse -318 -332 12.7826 0.247
NP_440253.1_2 Reverse -320 -338 6.50899 0.0792
NP_440929.1_8 Forward -329 -320 19.2726 0.000701
NP_440929.1_8 Reverse -320 -329 19.2726 0.000701
NP_440929.1_8 Reverse -191 -200 16.5193 0.00413
NP_440929.1_8 Forward -200 -191 9.53783 0.0296
NP_441346.1_4 Forward -330 -311 13.1758 0.26
NP_442933.1_10 Forward -329 -320 17.601 0.00325
NP_442933.1_10 Reverse -320 -329 17.601 0.00325
NP_442933.1_10 Reverse -191 -200 8.06287 0.0885
NP_442933.1_10 Forward -200 -191 7.96454 0.0937
NP_441751.2_8 Reverse -321 -335 -3.63866 0.152
NP_441751.2_8 Forward -328 -314 -5.40861 0.206
NP_442926.1_3 Reverse -345 -364 3.04771 0.293
NP_442926.1_5 Forward -205 -186 11.7264 0.198
NP_442554.1_8 Reverse -321 -331 16.9913 0.0065
NP_442554.1_8 Forward -328 -318 14.238 0.0144
NP_442554.1_8 Forward -199 -189 11.4848 0.0355
NP_442554.1_8 Reverse -192 -202 6.17489 0.125
NP_442554.1_8 Reverse -273 -283 4.10993 0.198
NP_442554.1_8 Forward -18 -8 2.04498 0.285
NP_441762.1_7 Reverse -190 -202 11.7404 0.0142
NP_441762.1_7 Reverse -319 -331 11.1504 0.0142
NP_441762.1_7 Forward -330 -318 8.88877 0.0143
NP_441762.1_7 Forward -201 -189 2.30059 0.0676
NP_442142.1_4 Reverse -188 -201 9.85179 0.0854
NP_442292.1_1 Forward -328 -319 9.53783 0.0183
NP_442292.1_1 Reverse -321 -330 9.53783 0.0183
NP_442292.1_1 Forward -18 -9 5.21127 0.152
NP_442292.1_1 Forward -199 -190 -0.0986038 0.239
NP_442292.1_1 Reverse -192 -201 -0.196935 0.239
NP_442292.1_2 Reverse -30 -44 19.6216 0.179
NP_440039.1_9 Reverse -180 -199 11.2092 0.284
NP_442476.1_6 Reverse -192 -206 12.0943 0.0525
NP_442476.1_6 Reverse -321 -335 1.08123 0.231
NP_440895.1_10 Forward -201 -184 2.30045 0.164
NP_443009.1_5 Forward -330 -319 18.0527 0.00334
NP_443009.1_5 Reverse -319 -330 18.0527 0.00334
NP_441865.1_3 Forward -386 -368 12.9005 0.269
NP_442408.2_1 Reverse -320 -339 -2.95047 0.241
NP_441715.1_4 Forward -199 -189 6.56821 0.138
NP_440357.1_3 Forward -331 -312 7.7676 0.206
NP_440881.1_3 Reverse -192 -211 15.1416 0.276
NP_441198.1_8 Forward -331 -321 15.2245 0.0427
NP_441198.1_8 Reverse -318 -328 12.5877 0.12
NP_441468.1_1 Forward -328 -321 15.8704 0.0124
NP_441468.1_1 Reverse -321 -328 15.8704 0.0124
NP_441468.1_1 Forward -199 -192 6.13563 0.209
NP_441468.1_1 Reverse -192 -199 6.0373 0.223
NP_441468.1_1 Reverse -11 -18 3.97235 0.277
NP_441020.2_6 Reverse -318 -335 19.8034 0.00707
NP_441020.2_6 Forward -202 -185 15.3785 0.0411
NP_441020.2_6 Forward -331 -314 15.2801 0.0424
NP_441673.1_1 Forward -329 -320 20.8459 0.000698
NP_441673.1_1 Reverse -320 -329 20.8459 0.000698
NP_441673.1_1 Forward -200 -191 11.1111 0.0121
NP_441673.1_1 Reverse -191 -200 11.0128 0.018
NP_441876.1_9 Forward -360 -350 11.2876 0.278
NP_441826.1_2 Forward -335 -321 3.34284 0.111
NP_441637.1_9 Reverse -312 -330 -2.3408 0.292
NP_442490.1_9 Forward -341 -322 8.06259 0.127
NP_442490.1_9 Reverse -308 -327 2.65439 0.165
NP_441764.1_4 Forward -44 -27 14.6607 0.132
NP_442868.1_6 Forward -331 -321 16.7946 0.0131
NP_442868.1_6 Reverse -318 -328 9.12481 0.0539
NP_442719.1_2 Reverse -154 -172 -0.374908 0.162
NP_442227.1_2 Forward -363 -344 0.392778 0.252
NP_442427.1_8 Reverse -311 -330 10.1275 0.168
NP_442808.1_1 Reverse -190 -200 19.0557 0.00201
NP_442808.1_1 Reverse -319 -329 8.73102 0.0481
NP_442808.1_1 Forward -330 -320 8.73102 0.0481
NP_442808.1_1 Forward -201 -191 8.73102 0.0481
NP_442808.1_1 Reverse -183 -193 4.20782 0.203
NP_442542.1_2 Forward -331 -318 13.294 0.114
NP_442542.1_2 Forward -202 -189 11.4257 0.114
NP_442542.1_10 Reverse -192 -206 18.1908 0.219
NP_442050.1_5 Forward -331 -321 14.9258 0.0175
NP_442050.1_5 Reverse -318 -328 6.96107 0.27
NP_442050.1_5 Reverse -189 -199 6.96107 0.27
NP_442342.1_9 Forward -331 -315 9.89163 0.149
NP_442342.1_9 Forward -311 -295 6.54838 0.218
NP_440558.1_2 Reverse -352 -371 -7.37537 0.293
NP_442789.1_4 Reverse -360 -379 -3.54046 0.25
NP_442789.1_4 Reverse -210 -229 -4.03212 0.258
NP_441518.1_3 Reverse -181 -200 -6.49039 0.138
NP_441518.1_3 Forward -339 -320 -10.6203 0.248
NP_441878.1_6 Forward -330 -320 20.2362 0.0046
NP_441878.1_6 Reverse -319 -329 20.2362 0.0046
NP_441878.1_6 Forward -201 -191 0.668351 0.139
NP_441878.1_6 Reverse -190 -200 0.57002 0.14
NP_441036.1_8 Forward -201 -191 16.4996 0.00407
NP_441036.1_8 Forward -330 -320 8.4365 0.174
NP_441036.1_8 Reverse -319 -329 8.4365 0.174
NP_441036.1_8 Reverse -190 -200 8.4365 0.174
NP_441557.1_5 Forward -329 -320 19.9609 0.000699
NP_441557.1_5 Reverse -320 -329 19.9609 0.000699
NP_441557.1_5 Forward -200 -191 10.2261 0.0144
NP_441557.1_5 Reverse -191 -200 10.1278 0.0188
NP_441445.1_1 Reverse -182 -201 10.2259 0.0968
NP_441445.1_1 Forward -209 -190 7.07928 0.138
NP_441445.1_1 Reverse -311 -330 2.55606 0.233
NP_442419.1_2 Forward -205 -186 1.17943 0.238
NP_440738.1_5 Forward -325 -306 5.30933 0.246
NP_440101.1_3 Forward -205 -186 13.0775 0.0777
NP_441458.1_10 Reverse -182 -201 5.70265 0.212
NP_441564.1_10 Forward -325 -306 1.76941 0.287
NP_442183.1_1 Reverse -320 -334 20.0591 0.00507
NP_442183.1_1 Forward -200 -186 13.5693 0.0423
NP_442183.1_1 Reverse -191 -205 7.9644 0.127
NP_442183.1_1 Forward -329 -315 4.03116 0.282
NP_441459.1_8 Reverse -313 -326 18.5055 0.286
NP_441574.1_1 Reverse -308 -327 -5.21209 0.26
NP_442347.1_2 Reverse -192 -201 8.94785 0.0718
NP_442347.1_2 Forward -328 -319 3.34298 0.284
NP_442347.1_2 Reverse -321 -330 3.34298 0.284
NP_442888.1_8 Forward -363 -344 10.7175 0.221
NP_441037.1_4 Forward -331 -321 18.9151 0.00351
NP_441037.1_4 Reverse -318 -328 17.3558 0.0127
NP_441037.1_4 Forward -202 -192 7.22024 0.237
NP_442317.1_6 Reverse -315 -334 6.29264 0.238
NP_441633.1_3 Reverse -318 -331 13.1956 0.018
NP_441633.1_3 Reverse -189 -202 3.5592 0.0699
NP_441633.1_3 Forward -331 -318 -3.71729 0.177
NP_441633.1_3 Forward -202 -189 -6.17557 0.238
NP_440136.1_1 Reverse -304 -320 9.89093 0.238
NP_440136.1_2 Forward -328 -321 15.9687 0.0123
NP_440136.1_2 Reverse -321 -328 15.9687 0.0123
NP_440136.1_2 Forward -199 -192 6.23397 0.171
NP_440136.1_2 Reverse -192 -199 6.13563 0.193
NP_442590.1_10 Forward -206 -187 5.70265 0.258
NP_442998.1_5 Forward -346 -336 10.0098 0.231
NP_442998.1_10 Forward -327 -320 15.5754 0.0102
NP_442998.1_10 Reverse -322 -329 15.5754 0.0102
NP_442998.1_10 Reverse -193 -200 15.5754 0.0102
NP_442998.1_10 Forward -198 -191 5.84064 0.235
NP_440899.1_8 Reverse -40 -59 -9.047 0.258
NP_440299.1_1 Forward -333 -320 18.9965 0.00298
NP_440299.1_1 Reverse -316 -329 9.75346 0.0661
NP_441799.1_1 Reverse -316 -330 10.2254 0.0778
NP_441799.1_1 Forward -360 -346 8.16044 0.122
NP_441799.1_1 Forward -204 -190 7.86545 0.13
NP_441799.1_1 Reverse -187 -201 7.47213 0.141
NP_441007.1_10 Forward -334 -321 8.86907 0.108
NP_441007.1_10 Forward -205 -192 4.24752 0.182
NP_441007.1_10 Reverse -315 -328 1.59258 0.203
NP_442334.1_1 Forward -341 -322 6.09597 0.109
NP_442334.1_2 Reverse -352 -369 -6.64766 0.264
NP_442201.1_10 Forward -340 -321 -8.94866 0.233
NP_442333.2_5 Reverse -180 -199 -4.81876 0.214
NP_440256.1_1 Forward -203 -184 -1.37718 0.103
NP_440256.1_1 Reverse -317 -336 -10.1286 0.295
NP_442961.1_7 Reverse -192 -211 15.0441 0.194
NP_440915.1_6 Forward -333 -319 22.714 0.00202
NP_440915.1_6 Reverse -343 -357 3.73617 0.1
NP_440915.1_6 Reverse -316 -330 3.44117 0.101
NP_440915.1_6 Forward -204 -190 -2.16369 0.26
NP_440717.1_3 Forward -314 -300 10.2254 0.231
NP_442069.1_6 Reverse -283 -302 4.42435 0.3
NP_442866.1_1 Forward -205 -186 -2.95047 0.216
NP_441464.1_8 Forward -329 -315 13.3726 0.146
NP_441464.1_8 Reverse -320 -334 7.9644 0.204
NP_440695.1_5 Forward -329 -310 -0.590531 0.284
NP_441939.1_3 Reverse -321 -340 9.14423 0.153
NP_442993.1_1 Forward -200 -184 7.92501 0.0292
NP_442993.1_1 Forward -94 -78 -10.0696 0.206
NP_440677.1_1 Reverse -311 -330 18.7807 0.0629
NP_440677.1_1 Forward -338 -319 9.63589 0.183
NP_442386.1_9 Reverse -190 -199 11.8973 0.0799
NP_442386.1_9 Forward -330 -321 6.39082 0.219
NP_442386.1_9 Reverse -319 -328 6.39082 0.219
NP_442386.1_9 Forward -201 -192 5.9975 0.23
NP_441750.1_1 Reverse -264 -283 -8.752 0.3
NP_441750.1_1 Reverse -294 -313 -12.9802 0.3
NP_441340.1_5 Forward -328 -321 15.6737 0.0124
NP_441340.1_5 Reverse -321 -328 15.6737 0.0124
NP_441340.1_5 Forward -199 -192 13.5105 0.0314
NP_441340.1_5 Reverse -192 -199 5.84064 0.208
NP_441340.1_5 Forward -18 -11 4.07068 0.239
NP_441271.1_1 Forward -206 -188 10.6381 0.275
NP_441271.1_3 Forward -364 -346 10.6381 0.285
NP_442484.1_2 Forward -307 -288 2.0644 0.226
NP_442791.1_1 Reverse -183 -202 8.06259 0.25
NP_442791.1_5 Reverse -183 -202 -0.000545616 0.21
NP_440168.1_9 Reverse -318 -337 4.62101 0.227
NP_440146.1_8 Reverse -111 -129 14.6013 0.277
NP_442240.1_1 Forward -298 -279 2.85027 0.299
NP_440161.1_3 Forward -331 -312 15.3391 0.117
NP_442714.1_3 Forward -203 -184 14.4533 0.232
NP_442714.1_7 Forward -328 -309 0.196116 0.239
NP_440586.1_1 Forward -300 -281 -6.29373 0.299
NP_440586.1_8 Forward -328 -321 13.2151 0.026
NP_440586.1_8 Reverse -321 -328 13.2151 0.026
NP_440586.1_8 Forward -18 -11 12.8218 0.0395
NP_440586.1_8 Reverse -192 -199 9.47853 0.146
NP_440586.1_8 Forward -199 -192 5.74197 0.283
NP_442251.1_6 Forward -328 -321 15.2804 0.0124
NP_442251.1_6 Reverse -321 -328 15.2804 0.0124
NP_441262.1_3 Reverse -320 -327 14.7888 0.0223
NP_441262.1_3 Forward -329 -322 14.7888 0.0223
NP_441262.1_3 Forward -200 -193 14.7888 0.0223
NP_440027.1_3 Reverse -272 -290 9.94979 0.179
NP_440027.1_3 Reverse -181 -199 5.03327 0.249
NP_443051.1_1 Reverse -319 -328 18.0926 0.00402
NP_443051.1_1 Forward -330 -321 18.0926 0.00402
NP_443051.1_1 Forward -201 -192 7.47288 0.0571
NP_443051.1_1 Reverse -190 -199 0.589713 0.143
NP_439937.1_8 Reverse -189 -208 -4.72043 0.286
NP_439937.1_9 Reverse -190 -207 0.431468 0.0979
NP_439937.1_9 Forward -330 -313 -5.2717 0.157
NP_439937.1_9 Reverse -319 -336 -6.74666 0.157
NP_441595.1_5 Reverse -313 -331 6.80398 0.222
NP_440439.1_1 Forward -203 -190 16.8339 0.0117
NP_440439.1_1 Reverse -188 -201 6.1158 0.0818
NP_440439.1_1 Forward -332 -319 3.36254 0.116
NP_440372.1_2 Forward -328 -321 16.3621 0.0124
NP_440372.1_2 Reverse -321 -328 16.3621 0.0124
NP_440372.1_2 Forward -199 -192 13.8055 0.0214
NP_440372.1_2 Reverse -192 -199 6.52896 0.188
NP_441138.1_5 Reverse -32 -45 9.13351 0.238
NP_441181.1_10 Forward -96 -77 14.4541 0.291
NP_441789.1_7 Reverse -199 -218 -4.32786 0.28
NP_440316.1_10 Reverse -299 -309 6.66654 0.256
NP_439977.1_5 Reverse -314 -333 5.30933 0.15
NP_442384.1_10 Forward -329 -316 16.4406 0.00838
NP_442384.1_10 Reverse -320 -333 12.2123 0.0296
NP_442384.1_10 Reverse -191 -204 6.21414 0.108
NP_442114.1_2 Reverse -119 -138 1.0811 0.262
NP_441877.1_5 Reverse -1 -20 0.392778 0.276
NP_441877.1_9 Reverse -369 -386 3.87375 0.284
NP_442235.1_3 Reverse -187 -206 8.06259 0.172
NP_441018.1_7 Forward -204 -185 7.96426 0.259
NP_442790.1_4 Forward -338 -319 1.76941 0.0765
NP_442790.1_4 Forward -209 -190 -9.24366 0.182
NP_442262.1_10 Forward -328 -321 14.1988 0.0123
NP_442262.1_10 Reverse -321 -328 14.1988 0.0123
NP_442262.1_10 Reverse -192 -199 13.2155 0.0213
NP_442262.1_10 Forward -18 -11 10.3639 0.153
NP_441689.1_5 Reverse -189 -199 6.27276 0.197
NP_440344.1_10 Forward -336 -319 4.46374 0.0247
NP_440344.1_10 Reverse -184 -201 -0.747806 0.0454
NP_440344.1_10 Reverse -313 -330 -2.81276 0.074
NP_440344.1_10 Forward -207 -190 -9.79426 0.156
NP_442910.1_1 Forward -336 -317 4.32602 0.118
NP_440189.1_2 Reverse -183 -202 8.94757 0.25
NP_441965.1_10 Forward -332 -316 5.27008 0.213
NP_442065.1_7 Reverse -182 -200 2.87075 0.215
NP_442529.1_4 Reverse -311 -330 8.65258 0.27
NP_440297.1_9 Forward -328 -318 9.61647 0.0917
NP_440297.1_9 Reverse -321 -331 9.51814 0.0917
NP_440297.1_9 Forward -18 -8 0.176696 0.282
NP_440297.1_9 Forward -199 -189 -0.41329 0.283
NP_440350.1_5 Forward -264 -245 -1.86883 0.212
NP_440350.1_5 Reverse -31 -50 -5.60541 0.292
NP_441896.1_3 Forward -209 -190 8.16093 0.0915
NP_441896.1_3 Forward -338 -319 6.68596 0.1
NP_440894.1_4 Forward -308 -289 2.3594 0.224
NP_440894.1_10 Reverse -315 -334 5.01433 0.24
NP_443036.1_10 Reverse -225 -244 12.2908 0.183
NP_440999.1_9 Forward -333 -319 2.85119 0.142
NP_440999.1_9 Forward -204 -190 -0.0987402 0.199
NP_440999.1_9 Reverse -190 -204 -0.885388 0.22
NP_440888.1_2 Reverse -191 -205 13.2736 0.0307
NP_440888.1_2 Reverse -320 -334 10.8154 0.0842
NP_440888.1_2 Forward -309 -295 5.99717 0.254
NP_440888.1_2 Forward -200 -186 5.70218 0.267
NP_440491.1_1 Reverse -160 -179 10.328 0.191
NP_441748.1_7 Reverse -209 -228 16.5025 0.151
NP_442277.1_4 Forward -338 -319 14.7483 0.0423
NP_441123.1_6 Reverse -272 -290 12.4089 0.14
NP_441543.1_2 Forward -328 -319 9.34117 0.0818
NP_441543.1_2 Reverse -321 -330 9.34117 0.0818
NP_441543.1_2 Forward -199 -190 9.14451 0.0856
NP_441543.1_2 Reverse -192 -201 8.65285 0.0968
NP_442845.1_2 Reverse -294 -308 4.12949 0.267
NP_441834.1_7 Forward -212 -193 14.4541 0.263
NP_441469.1_8 Reverse -319 -328 13.3727 0.073
NP_441469.1_8 Forward -330 -321 13.3727 0.073
NP_441469.1_8 Forward -201 -192 6.39124 0.227
NP_441469.1_8 Reverse -190 -199 6.29291 0.227
NP_443064.1_6 Forward -329 -319 13.8273 0.0796
NP_443064.1_6 Reverse -320 -330 13.8273 0.0796
NP_443064.1_6 Forward -237 -227 12.8578 0.0796
NP_443064.1_6 Forward -186 -176 10.6277 0.141
NP_442337.1_8 Forward -376 -357 -1.7705 0.29
NP_442578.1_7 Forward -328 -321 14.5921 0.026
NP_442578.1_7 Reverse -321 -328 14.5921 0.026
NP_442578.1_7 Forward -199 -192 6.0373 0.18
NP_440710.1_1 Forward -337 -319 -8.24065 0.261
NP_441462.1_2 Forward -329 -319 20.1379 0.000967
NP_441462.1_2 Reverse -320 -330 20.1379 0.000967
NP_441462.1_2 Forward -200 -190 9.81313 0.0143
NP_441462.1_2 Reverse -191 -201 1.74999 0.0811
NP_441621.1_7 Forward -202 -188 -3.73699 0.193
NP_441621.1_7 Reverse -189 -203 -3.73699 0.193
NP_441621.1_7 Forward -331 -317 -4.81863 0.246
NP_441621.1_7 Reverse -318 -332 -4.91696 0.248
NP_441929.1_6 Reverse -282 -301 5.211 0.294
NP_443062.1_1 Reverse -10 -28 5.32818 0.231
NP_443062.1_1 Forward -329 -311 3.57305 0.293
NP_443062.1_6 Reverse -312 -331 15.2408 0.077
NP_442204.1_5 Forward -210 -191 7.57094 0.128
NP_441560.1_3 Reverse -273 -291 6.31233 0.28
NP_440454.1_2 Forward -45 -31 17.1047 0.148
NP_440516.1_8 Forward -329 -320 16.9127 0.00442
NP_440516.1_8 Reverse -320 -329 16.9127 0.00442
NP_440516.1_8 Forward -200 -191 16.9127 0.00442
NP_440516.1_8 Reverse -191 -200 14.8477 0.00685
NP_442428.1_5 Forward -328 -321 15.8704 0.0124
NP_442428.1_5 Reverse -321 -328 15.8704 0.0124
NP_442428.1_5 Forward -199 -192 6.13563 0.209
NP_442428.1_5 Reverse -192 -199 6.0373 0.212
NP_442428.1_5 Reverse -11 -18 4.36568 0.271
NP_442859.1_2 Forward -199 -180 4.03102 0.227
NP_440673.1_2 Forward -339 -320 10.0969 0.224
NP_440673.1_3 Forward -327 -320 12.4288 0.0426
NP_440673.1_3 Reverse -322 -329 12.4288 0.0426
NP_440673.1_3 Reverse -193 -200 12.4288 0.0426
NP_441052.1_2 Forward -329 -319 10.4031 0.0285
NP_441052.1_2 Reverse -320 -330 10.4031 0.0285
NP_441052.1_2 Forward -200 -190 0.963343 0.255
NP_441052.1_2 Reverse -191 -201 0.668351 0.256
NP_442219.1_8 Reverse -159 -178 10.7762 0.199
NP_442219.1_9 Forward -328 -319 8.25953 0.0681
NP_442219.1_9 Reverse -321 -330 8.25953 0.0681
NP_440436.1_4 Forward -328 -319 15.9289 0.00508
NP_440436.1_4 Reverse -321 -330 15.9289 0.00508
NP_440436.1_4 Forward -199 -190 8.65242 0.0997
NP_440436.1_4 Reverse -192 -201 8.55409 0.0997
NP_441884.1_8 Forward -201 -182 -7.27704 0.248
NP_441884.1_9 Reverse -317 -336 -5.70374 0.0594
NP_441884.1_9 Reverse -188 -207 -23.895 0.284
NP_441884.1_9 Forward -332 -313 -24.485 0.288
NP_440314.1_9 Reverse -321 -340 -6.58872 0.23
NP_440314.1_9 Forward -328 -309 -7.17871 0.237
NP_440314.1_9 Reverse -273 -292 -9.24366 0.262
NP_440648.1_1 Forward -329 -310 8.06259 0.189
NP_441719.1_2 Reverse -131 -145 13.4445 0.286
NP_441719.1_4 Forward -328 -321 16.3621 0.0124
NP_441719.1_4 Reverse -321 -328 16.3621 0.0124
NP_441719.1_4 Forward -199 -192 6.82395 0.0855
NP_441719.1_4 Reverse -192 -199 6.52896 0.188
NP_441733.1_10 Forward -332 -319 14.8673 0.0666
NP_441733.1_10 Forward -203 -190 9.36073 0.119
NP_441733.1_10 Reverse -317 -330 5.03416 0.231
NP_442366.1_3 Forward -201 -183 -4.20908 0.266
NP_442366.1_5 Reverse -317 -327 15.4175 0.0374
NP_440129.1_4 Forward -326 -308 20.4712 0.0701
NP_440296.1_10 Reverse -344 -363 -14.1602 0.269
NP_440296.1_10 Forward -332 -313 -14.6519 0.27
NP_442206.1_1 Forward -329 -310 -11.1119 0.219
NP_443054.1_2 Reverse -189 -203 11.5043 0.0761
NP_443054.1_2 Reverse -318 -332 2.65453 0.242
NP_443054.1_2 Forward -331 -317 1.47456 0.245
NP_441851.1_10 Forward -330 -320 17.4829 0.0027
NP_441851.1_10 Reverse -319 -329 17.4829 0.0027
NP_441851.1_10 Forward -201 -191 6.37155 0.172
NP_441851.1_10 Reverse -190 -200 6.17489 0.182
NP_441851.1_10 Reverse -9 -19 4.10993 0.287
NP_442622.1_5 Forward -202 -183 -4.72043 0.206
NP_441668.1_4 Reverse -310 -329 -1.7705 0.28
NP_441273.1_9 Forward -134 -115 13.5003 0.268
NP_442515.1_1 Reverse -319 -333 16.4209 0.0227
NP_442515.1_1 Forward -330 -316 16.1259 0.0227
NP_442515.1_1 Reverse -190 -204 -4.91696 0.298
NP_441982.1_8 Forward -224 -210 19.2682 0.084
NP_441046.1_2 Forward -214 -195 1.17943 0.26
NP_441046.1_2 Reverse -216 -235 -0.39387 0.28
NP_440338.1_4 Forward -81 -62 6.39016 0.29
NP_442689.1_8 Reverse -30 -47 -2.81276 0.235
NP_440432.1_9 Reverse -321 -336 18.8594 0.00961
NP_442843.1_1 Forward -199 -180 -9.34199 0.265
NP_440431.1_3 Forward -330 -311 -4.81876 0.18
NP_442450.1_5 Reverse -318 -328 17.3846 0.0267
NP_442450.1_5 Forward -331 -321 10.1081 0.115
NP_440588.1_2 Reverse -311 -330 -2.26216 0.163
NP_440588.1_2 Forward -66 -47 -3.83545 0.197
NP_442006.1_2 Reverse -320 -337 -17.1691 0.27
NP_443047.1_7 Forward -199 -180 7.37428 0.22
NP_440483.1_1 Reverse -295 -314 -3.14714 0.213
NP_441570.1_1 Forward -200 -182 1.00246 0.034
NP_441570.1_1 Reverse -320 -338 -16.3038 0.242
NP_441078.1_4 Forward -329 -320 19.6659 0.0007
NP_441078.1_4 Reverse -320 -329 19.6659 0.0007
NP_441078.1_4 Forward -200 -191 9.93116 0.0203
NP_441078.1_4 Reverse -191 -200 9.83282 0.0226
NP_442729.1_8 Forward -333 -320 18.5055 0.0312
NP_442729.1_8 Reverse -316 -329 10.934 0.125
NP_440539.1_9 Forward -354 -335 -2.55715 0.286
NP_441663.1_8 Forward -335 -316 -3.73712 0.295
NP_440526.1_3 Reverse -321 -332 11.4645 0.0646
NP_440526.1_3 Forward -328 -317 1.72983 0.267
NP_441432.1_8 Reverse -319 -328 8.35786 0.0755
NP_441432.1_8 Forward -330 -321 8.35786 0.0755
NP_441432.1_8 Forward -201 -192 5.50626 0.151
NP_442320.1_8 Reverse -185 -199 5.40779 0.0386
NP_442320.1_8 Forward -335 -321 5.30946 0.0394
NP_442344.1_7 Forward -328 -309 0.392778 0.0945
NP_441732.1_2 Reverse -187 -203 -16.2644 0.165
NP_441732.1_2 Reverse -316 -332 -16.3627 0.165
NP_440497.1_2 Reverse -321 -340 11.8975 0.172
NP_440760.1_1 Reverse -320 -339 3.24438 0.0192
NP_440760.1_1 Forward -329 -310 -9.93197 0.084
NP_440760.1_1 Reverse -191 -210 -14.1602 0.125
NP_440199.1_4 Reverse -4 -22 13.9438 0.204
NP_440913.1_1 Reverse -292 -310 7.39397 0.202
NP_442727.1_1 Forward -303 -289 13.4709 0.245
NP_442489.1_7 Forward -329 -320 20.1576 0.000695
NP_442489.1_7 Reverse -320 -329 20.1576 0.000695
NP_442489.1_7 Reverse -191 -200 10.5211 0.0102
NP_442489.1_7 Forward -200 -191 10.4228 0.0151
NP_440757.1_6 Reverse -316 -335 15.1424 0.167
NP_442079.1_7 Forward -328 -309 13.9625 0.079
NP_442079.1_7 Reverse -321 -340 12.0942 0.0886
NP_442079.1_7 Reverse -11 -30 6.78429 0.152
NP_440559.1_1 Forward -328 -319 17.306 0.00658
NP_440559.1_1 Reverse -321 -330 17.306 0.00658
NP_440559.1_1 Forward -199 -190 5.99792 0.135
NP_441659.2_8 Forward -329 -319 19.3512 0.000966
NP_441659.2_8 Reverse -320 -330 19.3512 0.000966
NP_441659.2_8 Reverse -191 -201 8.82982 0.0393
NP_441659.2_8 Forward -200 -190 2.43831 0.2
NP_441659.2_8 Forward -19 -9 0.963343 0.254
NP_441040.1_2 Forward -298 -279 -16.5201 0.3
NP_442776.1_6 Forward -331 -312 19.3707 0.0877
NP_440779.1_5 Reverse -320 -337 4.26707 0.0558
NP_442346.1_5 Forward -330 -320 17.9746 0.00128
NP_442346.1_5 Reverse -319 -329 17.9746 0.00128
NP_440352.1_5 Reverse -87 -106 16.7439 0.096
NP_440545.1_3 Forward -333 -316 0.432165 0.139
NP_440545.1_3 Reverse -316 -333 0.0388413 0.146
NP_440545.1_3 Forward -362 -345 -4.68105 0.23
NP_440025.1_3 Reverse -158 -172 11.8693 0.28
NP_440831.1_3 Forward -209 -190 5.7076 0.28
NP_441786.1_10 Forward -253 -234 8.06259 0.248
NP_440743.1_8 Forward -178 -159 15.2399 0.215
NP_440459.1_2 Reverse -285 -302 10.9536 0.185
NP_440459.1_2 Reverse -83 -100 7.61033 0.285
NP_441653.1_2 Forward -340 -321 3.04645 0.277
NP_440010.1_10 Forward -349 -330 3.6377 0.25
NP_441943.1_8 Forward -339 -320 -13.3736 0.265
NP_442551.1_4 Forward -331 -316 -2.08505 0.256
NP_442551.1_4 Reverse -278 -293 -3.26502 0.287
NP_442603.1_7 Reverse -320 -334 16.3219 0.0326
NP_442603.1_7 Forward -329 -315 7.76712 0.195
NP_442828.1_2 Reverse -63 -82 12.0793 0.296
NP_441888.1_7 Forward -334 -320 2.94952 0.225
NP_441888.1_10 Reverse -242 -261 17.706 0.16
NP_440946.1_6 Reverse -344 -363 2.85105 0.294
NP_440449.1_6 Forward -337 -319 6.79689 0.24
NP_440449.1_6 Reverse -312 -330 5.62973 0.273
NP_441948.1_4 Reverse -313 -331 7.4923 0.0623
NP_441948.1_4 Reverse -184 -202 6.50899 0.0633
NP_441833.1_4 Forward -328 -321 15.9687 0.0124
NP_441833.1_4 Reverse -321 -328 15.9687 0.0124
NP_441833.1_4 Reverse -192 -199 6.52896 0.0924
NP_441833.1_4 Forward -199 -192 6.23397 0.163
NP_443040.1_1 Reverse -62 -76 10.0873 0.291
NP_441329.1_6 Forward -48 -29 5.87233 0.191
NP_441329.1_6 Forward -146 -127 -0.334645 0.274
NP_442162.1_9 Forward -328 -321 16.2637 0.0124
NP_442162.1_9 Reverse -321 -328 16.2637 0.0124
NP_442162.1_9 Forward -199 -192 12.9205 0.0282
NP_442162.1_9 Reverse -192 -199 12.9205 0.0282
NP_440671.1_4 Reverse -185 -199 14.3559 0.0632
NP_441973.1_1 Reverse -42 -57 -7.88658 0.293
NP_441044.1_4 Forward -320 -302 0.510803 0.293
NP_442199.1_5 Reverse -183 -202 -5.21209 0.24
NP_442199.1_6 Forward -210 -191 9.3409 0.274
NP_442140.1_3 Reverse -192 -202 15.418 0.0393
NP_442140.1_3 Reverse -321 -331 14.828 0.0433
NP_442140.1_3 Forward -328 -318 13.5497 0.0542
NP_440875.1_9 Reverse -193 -203 15.2829 0.0295
NP_441813.1_5 Reverse -189 -199 14.0414 0.0172
NP_441813.1_5 Forward -331 -321 8.92815 0.0347
NP_441813.1_5 Reverse -318 -328 8.82982 0.0367
NP_441813.1_5 Forward -202 -192 0.275027 0.206
NP_440594.1_8 Forward -328 -315 11.9167 0.152
NP_441259.1_8 Forward -242 -223 14.0599 0.247
NP_440590.1_4 Reverse -321 -334 4.05085 0.0642
NP_440590.1_4 Forward -199 -186 2.87088 0.0788
NP_440590.1_4 Reverse -192 -205 2.67422 0.0835
NP_440590.1_4 Forward -328 -315 1.49425 0.122
NP_440567.1_1 Reverse -321 -335 13.4709 0.0213
NP_440567.1_1 Forward -328 -314 3.8345 0.135
NP_440567.1_1 Reverse -192 -206 2.65453 0.167
NP_442497.1_4 Forward -146 -127 10.4559 0.281
NP_442497.1_10 Forward -328 -319 19.8626 0.00532
NP_442497.1_10 Reverse -321 -330 19.8626 0.00532
NP_442497.1_10 Forward -199 -190 0.688044 0.141
NP_442497.1_10 Reverse -192 -201 0.589713 0.153
NP_440821.1_4 Forward -331 -321 19.5479 0.00399
NP_440821.1_4 Reverse -318 -328 10.9931 0.0146
NP_440821.1_4 Reverse -189 -199 9.22315 0.0334
NP_440821.1_4 Forward -202 -192 9.02648 0.0364
NP_441239.1_9 Forward -331 -319 18.0335 0.0142
NP_441239.1_9 Reverse -189 -201 14.592 0.0271
NP_441239.1_9 Reverse -318 -330 14.297 0.0288
NP_441239.1_9 Forward -202 -190 8.88877 0.12
NP_441951.1_4 Forward -302 -283 1.37609 0.283
NP_440706.1_1 Forward -204 -185 -2.95047 0.258
NP_441892.1_1 Reverse -182 -199 4.3654 0.111
NP_441892.1_1 Forward -338 -321 -2.71443 0.227
NP_441892.1_1 Forward -28 -11 -4.38605 0.26
NP_441017.1_6 Forward -23 -9 15.6336 0.0983
NP_443035.1_10 Forward -363 -346 10.6586 0.273
NP_440354.1_7 Forward -206 -188 17.0304 0.167
NP_440354.1_7 Forward -335 -317 7.4923 0.265
NP_442052.1_8 Reverse -318 -328 12.7631 0.253
NP_440546.1_4 Forward -329 -319 12.8578 0.0572
NP_440546.1_4 Reverse -320 -330 12.8578 0.0572
NP_440546.1_4 Forward -200 -190 12.8578 0.0572
NP_440546.1_4 Reverse -191 -201 9.27034 0.146
NP_441230.1_5 Forward -314 -295 5.30933 0.182
NP_441230.1_5 Reverse -186 -205 4.81767 0.185
NP_440462.1_6 Reverse -189 -199 12.4681 0.0351
NP_440462.1_6 Forward -331 -321 10.4031 0.0396
NP_440462.1_6 Forward -202 -192 8.4365 0.062
NP_440462.1_6 Forward -21 -11 3.12662 0.26
NP_440462.1_6 Reverse -318 -328 1.455 0.294
NP_441184.1_3 Forward -208 -189 3.6377 0.289
NP_440868.1_4 Forward -204 -192 19.0169 0.0123
NP_440868.1_4 Reverse -316 -328 1.41561 0.183
NP_440868.1_4 Reverse -187 -199 -0.846001 0.282
NP_442479.1_5 Forward -80 -61 11.0371 0.222
NP_441474.1_1 Reverse -198 -217 3.24359 0.242
NP_441848.1_4 Forward -144 -128 14.6171 0.164
NP_441848.1_4 Reverse -91 -107 8.12362 0.288
NP_441084.1_6 Reverse -270 -284 13.6102 0.125
NP_440696.1_3 Forward -291 -273 -2.0458 0.272
NP_440696.1_6 Reverse -308 -327 13.2741 0.207
NP_442039.1_4 Forward -328 -321 15.1821 0.0124
NP_442039.1_4 Reverse -321 -328 15.1821 0.0124
NP_442039.1_4 Forward -199 -192 11.6422 0.0747
NP_441811.1_1 Reverse -319 -338 5.60432 0.28
NP_441811.1_8 Reverse -314 -328 12.4876 0.207
NP_441811.1_8 Forward -335 -321 6.29277 0.28
NP_440825.1_7 Forward -328 -318 11.8361 0.2
NP_442837.1_3 Forward -328 -321 15.7721 0.0124
NP_442837.1_3 Reverse -321 -328 15.7721 0.0124
NP_442837.1_3 Forward -199 -192 6.0373 0.25
NP_442837.1_3 Reverse -192 -199 6.0373 0.25
NP_440160.1_1 Forward -46 -27 12.0647 0.205
NP_442053.1_1 Forward -329 -320 18.3876 0.0007
NP_442053.1_1 Reverse -320 -329 18.3876 0.0007
NP_442053.1_1 Reverse -191 -200 16.6177 0.00257
NP_442053.1_1 Forward -200 -191 8.65285 0.0741
NP_440505.1_3 Forward -202 -192 12.5664 0.0482
NP_440505.1_3 Forward -331 -321 7.84651 0.147
NP_441203.1_1 Reverse -321 -340 -12.7836 0.145
NP_442532.1_1 Forward -43 -29 15.3612 0.215
NP_442532.1_7 Reverse -191 -205 6.48943 0.171
NP_442532.1_7 Reverse -320 -334 6.29277 0.171
NP_441408.2_7 Reverse -83 -102 0.0977854 0.228
NP_440914.1_1 Forward -329 -319 8.51751 0.186
NP_440914.1_1 Reverse -320 -330 8.51751 0.186
NP_440914.1_1 Reverse -191 -201 6.66328 0.269
NP_441011.1_8 Forward -328 -319 14.356 0.0249
NP_441011.1_8 Reverse -321 -330 14.356 0.0249
NP_441011.1_8 Forward -199 -190 13.3727 0.0328
NP_441011.1_8 Reverse -192 -201 7.07956 0.179
NP_442533.1_6 Forward -329 -320 17.2076 0.00137
NP_442533.1_6 Reverse -320 -329 17.2076 0.00137
NP_442533.1_6 Reverse -191 -200 14.2577 0.0132
NP_442533.1_6 Forward -200 -191 7.47288 0.0898
NP_442533.1_6 Forward -281 -272 2.16301 0.27
NP_442232.1_3 Forward -208 -189 -4.72043 0.163
NP_441482.1_7 Forward -335 -321 6.6861 0.0269
NP_441482.1_7 Reverse -185 -199 -1.08205 0.0618
NP_441482.1_7 Reverse -314 -328 -10.8168 0.216
NP_439944.1_9 Reverse -321 -331 17.4829 0.00423
NP_439944.1_9 Forward -328 -318 8.82982 0.101
NP_440816.1_2 Forward -147 -128 5.56364 0.297
NP_440116.1_5 Reverse -317 -334 5.05372 0.176
NP_440116.1_8 Forward -328 -309 -7.27704 0.225
NP_441527.1_4 Forward -60 -41 -6.44613 0.218
NP_441527.1_4 Reverse -373 -392 -7.974 0.24
NP_441527.1_4 Forward -48 -29 -11.1252 0.278
NP_440115.1_6 Forward -332 -322 10.0098 0.115
NP_440115.1_6 Forward -203 -193 9.61647 0.115
NP_440007.1_4 Forward -391 -372 9.53756 0.274
NP_440007.1_9 Reverse -296 -310 0.88457 0.29
NP_439965.1_1 Forward -209 -190 -3.04881 0.182
NP_439965.1_1 Reverse -182 -201 -9.44032 0.288
NP_441602.1_3 Forward -205 -186 9.63589 0.117
NP_441602.1_3 Reverse -315 -334 -5.01543 0.277
NP_441972.1_5 Reverse -321 -340 6.19431 0.0843
NP_441972.1_5 Forward -328 -309 -5.50708 0.222
NP_441106.1_1 Forward -330 -321 9.73449 0.0311
NP_441106.1_1 Reverse -319 -328 9.73449 0.0311
NP_441106.1_1 Reverse -190 -199 8.55452 0.0538
NP_441106.1_1 Forward -201 -192 8.45619 0.0548
NP_440429.1_4 Reverse -201 -220 15.6341 0.249
NP_441216.1_5 Forward -313 -294 20.6481 0.177
NP_439903.1_6 Forward -312 -293 3.04693 0.213
NP_442306.1_10 Reverse -315 -334 -11.5053 0.133
NP_442306.1_10 Forward -205 -186 -19.9617 0.201
NP_441286.1_1 Reverse -319 -331 14.7886 0.00418
NP_441286.1_1 Forward -330 -318 6.03717 0.0258
NP_441286.1_1 Forward -201 -189 -4.48425 0.161
NP_441286.1_1 Reverse -190 -202 -4.58258 0.165
NP_440670.1_8 Forward -329 -320 18.3876 0.000699
NP_440670.1_8 Reverse -320 -329 18.3876 0.000699
NP_440670.1_8 Forward -200 -191 18.0926 0.00136
NP_440670.1_8 Reverse -191 -200 15.831 0.00494
NP_440886.1_7 Reverse -190 -200 16.4991 0.0104
NP_440886.1_7 Forward -201 -191 8.14104 0.0805
NP_440886.1_7 Forward -330 -320 8.04271 0.0805
NP_440886.1_7 Reverse -319 -329 8.04271 0.0805
NP_442614.1_2 Forward -329 -315 9.2427 0.242
NP_442072.1_9 Reverse -319 -337 -21.2203 0.206
NP_442022.1_4 Forward -256 -237 6.29264 0.273
NP_440907.2_8 Reverse -321 -331 19.449 0.00351
NP_440907.2_8 Forward -328 -318 16.2041 0.0161
NP_440907.2_8 Reverse -192 -202 15.7125 0.0168
NP_441021.1_1 Reverse -321 -340 5.89931 0.0704
NP_441021.1_8 Reverse -186 -204 11.6222 0.112
NP_441021.1_8 Forward -205 -187 1.98577 0.253
NP_441463.1_3 Reverse -310 -329 -5.99873 0.238
NP_441626.1_2 Forward -328 -321 15.7721 0.0124
NP_441626.1_2 Reverse -321 -328 15.7721 0.0124
NP_441626.1_2 Forward -199 -192 12.2322 0.0511
NP_441626.1_2 Reverse -192 -199 5.93897 0.231
NP_442365.1_5 Forward -328 -309 12.3892 0.133
NP_442365.1_7 Forward -275 -256 -3.83545 0.225
NP_442615.1_1 Reverse -311 -329 15.5554 0.00922
NP_442615.1_1 Forward -338 -320 -2.53746 0.145
NP_442615.1_1 Forward -209 -191 -3.52077 0.163
NP_441962.1_4 Forward -334 -315 -9.34199 0.215
NP_441962.1_4 Reverse -315 -334 -12.1936 0.253
NP_440387.1_1 Reverse -320 -336 9.10498 0.0282
NP_440387.1_1 Reverse -191 -207 2.51681 0.0784
NP_440387.1_1 Forward -329 -313 -2.5964 0.148
NP_441431.1_2 Forward -332 -318 10.6187 0.158
NP_441431.1_2 Forward -203 -189 8.55376 0.211
NP_441431.1_2 Reverse -269 -283 8.3571 0.218
NP_441488.1_2 Reverse -308 -327 17.6007 0.134
NP_441488.1_7 Reverse -314 -333 6.4893 0.141
NP_441836.1_2 Reverse -79 -98 -0.688862 0.214
NP_441836.1_2 Reverse -266 -285 -2.55715 0.23
NP_441836.1_2 Reverse -314 -333 -3.73712 0.244
NP_441993.1_1 Reverse -294 -313 2.33652 0.26
NP_441993.1_1 Forward -200 -181 1.94669 0.267
NP_442224.1_1 Reverse -318 -337 -3.54046 0.233
NP_440814.1_4 Reverse -311 -330 9.3409 0.0506
NP_440114.1_10 Forward -200 -186 17.6008 0.0104
NP_440114.1_10 Forward -329 -315 11.2093 0.121
NP_440114.1_10 Reverse -191 -205 10.9143 0.13
NP_441425.1_4 Forward -139 -125 16.8142 0.282
NP_440766.1_4 Forward -204 -190 10.4227 0.0871
NP_440766.1_4 Forward -333 -319 7.07942 0.097
NP_439988.1_7 Reverse -322 -336 11.602 0.292
NP_441237.1_9 Reverse -321 -331 17.2863 0.00348
NP_441237.1_9 Forward -328 -318 17.188 0.00445
NP_442743.1_4 Reverse -321 -340 -0.197208 0.174
NP_439910.1_2 Reverse -183 -200 -13.7275 0.162
NP_440457.1_1 Forward -333 -321 15.1819 0.0611
NP_440457.1_1 Forward -204 -192 2.39892 0.212
NP_440457.1_1 Reverse -316 -328 1.02229 0.248
NP_442940.1_2 Forward -329 -310 7.17762 0.183
NP_440798.1_6 Reverse -192 -205 2.57589 0.17
NP_442509.1_9 Forward -329 -319 17.3841 0.00128
NP_442509.1_9 Reverse -320 -330 17.3841 0.00128
NP_442509.1_9 Reverse -191 -201 13.4509 0.0553
NP_442509.1_9 Forward -200 -190 13.4509 0.0553
NP_442509.1_9 Reverse -184 -194 7.35439 0.225
NP_442936.1_10 Reverse -384 -398 8.97675 0.269
NP_440554.1_4 Reverse -192 -202 10.9931 0.0429
NP_440554.1_4 Reverse -321 -331 6.27322 0.123
NP_440554.1_4 Forward -199 -189 4.89658 0.171
NP_440554.1_4 Forward -355 -345 2.92996 0.248
NP_442862.1_3 Reverse -5 -22 8.20031 0.247
NP_441761.1_1 Reverse -321 -340 10.4225 0.188
NP_441885.1_5 Forward -329 -319 11.3864 0.00668
NP_441885.1_5 Reverse -320 -330 11.3864 0.00668
NP_441885.1_5 Forward -200 -190 9.22315 0.0223
NP_441885.1_5 Reverse -191 -201 1.65166 0.106
NP_440478.1_9 Forward -349 -330 7.86593 0.28
NP_442703.1_9 Reverse -102 -120 3.85406 0.269
NP_442341.1_7 Reverse -190 -204 17.8958 0.0111
NP_442341.1_7 Reverse -319 -333 16.1259 0.0186
NP_442341.1_7 Forward -330 -316 10.1277 0.0682
NP_442341.1_7 Forward -201 -187 6.58777 0.123
NP_441173.1_9 Forward -182 -174 12.0154 0.214
NP_442395.2_4 Reverse -281 -300 0.981987 0.255
NP_440423.1_6 Reverse -183 -202 -15.8318 0.229
NP_443000.1_7 Forward -331 -321 2.14332 0.226
NP_443000.1_7 Reverse -318 -328 2.04498 0.226
NP_441842.1_10 Forward -336 -322 15.3392 0.044
NP_441842.1_10 Forward -207 -193 11.5043 0.128
NP_441842.1_10 Reverse -313 -327 7.9644 0.238
NP_440275.1_3 Forward -331 -321 19.5479 0.00756
NP_440275.1_3 Forward -202 -192 15.418 0.0178
NP_440275.1_3 Reverse -318 -328 9.91146 0.046
NP_440091.1_1 Reverse -187 -199 8.88877 0.0567
NP_440091.1_1 Forward -204 -192 0.432302 0.25
NP_442451.1_2 Reverse -183 -202 -9.73531 0.259
NP_442451.1_2 Forward -208 -189 -11.0136 0.284
NP_441207.1_7 Forward -136 -122 12.4502 0.241
NP_439962.1_4 Forward -360 -341 -8.94866 0.298
NP_440175.1_7 Forward -260 -242 12.0957 0.228
NP_442495.1_4 Reverse -299 -309 14.533 0.16
NP_440149.1_8 Forward -200 -181 -2.36049 0.168
NP_441105.1_3 Forward -211 -192 -3.83545 0.185
NP_440216.1_1 Forward -329 -315 -2.36035 0.0494
NP_440216.1_1 Reverse -320 -334 -2.55701 0.0521
NP_440216.1_1 Forward -200 -186 -3.44199 0.082
NP_440216.1_1 Reverse -191 -205 -3.54032 0.0833
NP_440216.1_9 Reverse -87 -96 6.39124 0.289
NP_440172.1_1 Forward -329 -319 16.303 0.00854
NP_440172.1_1 Reverse -320 -330 16.303 0.00854
NP_440172.1_1 Reverse -191 -201 5.78156 0.132
NP_441064.1_7 Forward -178 -159 14.7221 0.209
NP_442015.1_10 Forward -333 -320 4.44418 0.169
NP_442015.1_10 Reverse -316 -329 2.2809 0.196
NP_441226.1_7 Forward -328 -321 14.4934 0.0123
NP_441226.1_7 Reverse -321 -328 14.4934 0.0123
NP_441226.1_7 Forward -199 -192 12.7234 0.0312
NP_441226.1_7 Reverse -192 -199 11.5435 0.0757
NP_441757.1_3 Forward -330 -311 0.58944 0.188
NP_441111.1_7 Forward -328 -320 18.7023 0.00294
NP_441111.1_7 Reverse -321 -329 18.7023 0.00294
NP_441111.1_7 Forward -199 -191 8.96754 0.0463
NP_441111.1_7 Reverse -192 -200 8.86921 0.0589
NP_439971.2_5 Forward -246 -227 13.7658 0.194
NP_441177.1_7 Reverse -180 -199 9.24175 0.298
NP_441766.1_2 Forward -329 -320 17.5026 0.00297
NP_441766.1_2 Reverse -320 -329 17.5026 0.00297
NP_441766.1_2 Reverse -191 -200 13.9627 0.0114
NP_441766.1_2 Forward -200 -191 7.76787 0.0714
NP_443052.1_9 Forward -307 -288 -6.78538 0.289
NP_440885.1_6 Forward -173 -154 12.8009 0.183
NP_440261.1_5 Forward -328 -315 7.00078 0.0316
NP_440261.1_5 Reverse -321 -334 -0.669033 0.0655
NP_440261.1_5 Reverse -192 -205 -3.02898 0.108
NP_440261.1_5 Reverse -348 -361 -4.89726 0.178
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCGAAAATAGTTTTTATAAAGCCTTTACTTTGATTACCCTGGGCCCCATCACTGGGCAAGATTCCACTGGGGCGATCGCCCAAAAGATGACCCCAGCTCCTTTGCCTGTGGGTTCTGTGCCCTTGGCTCCCAATCCTATTACTGGTCTTAGTTTTAGCACCGGCGGCTCAGCCATTAAAGTGGGAGACCAATTAGTGGCGGCGATCGGCGTTTCTGGTTCACCCAATGGTAATTTAGACCAAACCTGTGGTCTGAAAGGTATTGAAAAAATTAAATCCCGTTTAGTGCCTTAAACTTTTACCCTTGTCCATGGTTGGTAACCCTTAAGCTTTTTTTACGGAAGACGATCAAGCGAAATATAAAGAAAAGTATCTCACTAAAGCCATCGAAATATTTTCC

CDS

ATGAAACAGGTTAATTTTTTAGCTGGATTTTTGTCTAATTCCCTTATTACTTTAGTTATTATCTTTGTTGTCACTGTTGCCACCGTTACCACCTTACAAACAGCTAAAGCCGTTGCAACTTTAGATAATCAAAATATCTATACACCATCGGCGAGCAATATTCGAGGCATTCAGGAACGAATTGTTTATGATTTTCCCGATACGGGTTTGAAATTAACCATGCCCAGATTTCTTAAAGATCCTGTGGCTTTCGAAACTCCAGGCAAAGACGTATTAATTATGTTGAGAACACCGGCTGATACCTGTGGCTTGTATCAAATGGCGGAGGCTATCTTAACCCCTAATGCTGGTCCGCCGCCCCATTTTCATTACGCTTCCGATGAGTGGTTTTTTTCTACGGAACCATCCCAAGTTCGGCTTTATAGTTCTCAGGAATTTCAGGCCCCGTTACAAGTCGGTCAAATTCCTGGGATTAATGTTGACCCCATTAAAGTTGGTTCCGTTCTCGAAGATCAAGGGGAAATAATTTTTTCTCCTAGGGGGATGGTGCATTATTTTCGTAATGAAACTCCGGGGAAAGCGGAAGTCCGGGGTTTTTATAATGTTTGGGCTCCTGGCTATGGCATTTCCGAACGATTTGAAGGAATTGATAACCTTGATGGATCCAACAGCAACCAGTCCATCCCCTTGGCACAGAAAGAGTTTTTACAAACAGCCCTTTGGGGAATTCCCCACGATATCACCGGCGGCTTTGTGGGAACTAAGGATTATTACAATGAGCGGGGTTCTGTTTTTATTCATCCCGATAACATCGAGGAACTCCAAGCCCTGTTCGACCAGGGGGAAGCTTGCTATCCCAATGAAGGATAA

Protein

MKQVNFLAGFLSNSLITLVIIFVVTVATVTTLQTAKAVATLDNQNIYTPSASNIRGIQERIVYDFPDTGLKLTMPRFLKDPVAFETPGKDVLIMLRTPADTCGLYQMAEAILTPNAGPPPHFHYASDEWFFSTEPSQVRLYSSQEFQAPLQVGQIPGINVDPIKVGSVLEDQGEIIFSPRGMVHYFRNETPGKAEVRGFYNVWAPGYGISERFEGIDNLDGSNSNQSIPLAQKEFLQTALWGIPHDITGGFVGTKDYYNERGSVFIHPDNIEELQALFDQGEACYPNEG