Your browser is old and dusty. Try Google Chrome!

Details for slr1385

ORF slr1385
Accession NP_440514.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -182 -168 11.3077 0.0531
NP_441061.1_2 Forward -238 -224 -2.26202 0.287
NP_440795.1_7 Forward -188 -181 14.6904 0.0123
NP_440795.1_7 Reverse -181 -188 14.6904 0.0123
NP_441418.1_6 Forward -189 -170 -21.6334 0.156
NP_441418.1_6 Reverse -168 -187 -29.1065 0.216
NP_442291.1_5 Forward -190 -174 10.5799 0.0434
NP_440897.1_6 Forward -336 -317 -2.75457 0.221
NP_441453.1_4 Reverse -180 -188 16.539 0.00633
NP_441453.1_4 Forward -189 -181 16.539 0.00633
NP_442151.1_6 Reverse -180 -194 11.0127 0.109
NP_442151.1_6 Forward -189 -175 8.75105 0.164
NP_442151.1_6 Forward -132 -118 5.89945 0.256
NP_441818.1_1 Forward -188 -177 9.79292 0.232
NP_441818.1_1 Reverse -181 -192 9.79292 0.232
NP_440226.1_1 Forward -189 -170 6.68596 0.122
NP_442623.1_1 Reverse -324 -343 -17.7001 0.287
NP_440150.1_6 Reverse -177 -196 4.03102 0.245
NP_440150.1_6 Forward -192 -173 0.786102 0.296
NP_442744.1_8 Reverse -180 -199 -6.58872 0.297
NP_442173.1_1 Forward -188 -180 15.4574 0.00633
NP_442173.1_1 Reverse -181 -189 15.4574 0.00633
NP_442752.1_4 Forward -189 -182 13.8055 0.0199
NP_442752.1_4 Reverse -180 -187 13.8055 0.0199
NP_442752.1_4 Reverse -202 -209 9.47889 0.109
NP_443027.1_4 Forward -191 -181 11.0914 0.107
NP_441812.1_3 Reverse -266 -280 7.17775 0.286
NP_442975.1_10 Reverse -176 -190 1.76896 0.291
NP_440784.1_7 Forward -188 -181 15.9687 0.0123
NP_440784.1_7 Reverse -181 -188 15.9687 0.0123
NP_440784.1_7 Reverse -268 -275 10.2655 0.0801
NP_442909.1_7 Forward -188 -174 10.0287 0.14
NP_441250.1_3 Reverse -148 -167 9.14423 0.197
NP_440061.1_9 Reverse -178 -192 19.6651 0.00478
NP_440061.1_9 Forward -191 -177 13.9619 0.0735
NP_440061.1_9 Forward -213 -199 10.9137 0.121
NP_440110.1_4 Forward -200 -181 5.89931 0.162
NP_441476.1_5 Reverse -256 -275 -2.0655 0.216
NP_439979.1_9 Forward -275 -257 15.7521 0.22
NP_442062.1_8 Forward -189 -179 17.3846 0.00193
NP_442062.1_8 Reverse -180 -190 17.3846 0.00193
NP_440304.1_4 Forward -278 -268 5.5849 0.201
NP_440304.1_4 Forward -191 -181 1.84832 0.299
NP_440304.1_4 Reverse -178 -188 1.84832 0.299
NP_442242.1_4 Forward -188 -181 14.3954 0.0124
NP_442242.1_4 Reverse -181 -188 14.3954 0.0124
NP_440044.1_8 Forward -188 -169 -4.03212 0.298
NP_441781.1_7 Forward -189 -170 -2.65548 0.289
NP_441581.1_6 Reverse -181 -200 9.0016 0.297
NP_441208.1_9 Reverse -48 -62 8.25939 0.219
NP_441208.1_9 Reverse -177 -191 6.78443 0.229
NP_442110.1_7 Reverse -180 -194 1.76955 0.222
NP_440330.1_2 Reverse -359 -378 9.53756 0.297
NP_441083.1_5 Forward -189 -179 20.3345 0.00053
NP_441083.1_5 Reverse -180 -190 20.3345 0.00053
NP_441738.1_2 Forward -187 -180 15.28 0.0102
NP_441738.1_2 Reverse -182 -189 15.28 0.0102
NP_441738.1_2 Forward -318 -311 8.29857 0.176
NP_441738.1_2 Forward -58 -51 8.29857 0.176
NP_441558.1_5 Forward -191 -172 13.3725 0.0595
NP_440209.1_1 Reverse -180 -188 18.1123 0.00295
NP_440209.1_1 Forward -189 -181 18.1123 0.00295
NP_442136.1_4 Reverse -161 -180 7.07848 0.295
NP_442889.1_8 Forward -192 -178 5.40719 0.227
NP_440447.1_5 Forward -195 -185 12.1731 0.291
NP_440447.1_6 Forward -197 -179 4.05072 0.181
NP_441713.1_1 Forward -195 -176 12.6841 0.0339
NP_441716.1_1 Reverse -180 -194 19.9608 0.00829
NP_441716.1_1 Forward -189 -175 16.3225 0.0392
NP_441716.1_1 Forward -398 -384 4.42448 0.256
NP_442111.1_4 Reverse -179 -193 14.3559 0.0307
NP_442111.1_4 Forward -190 -176 8.06273 0.081
NP_441163.1_1 Forward -328 -311 8.00291 0.233
NP_441163.1_1 Forward -184 -167 3.87303 0.299
NP_440906.1_5 Forward -188 -181 15.8704 0.0124
NP_440906.1_5 Reverse -181 -188 15.8704 0.0124
NP_440747.1_10 Forward -192 -180 26.5883 0.000317
NP_440747.1_10 Reverse -177 -189 14.9853 0.00221
NP_441130.1_10 Forward -191 -177 6.3911 0.19
NP_441486.1_1 Reverse -177 -191 14.5526 0.00628
NP_441486.1_1 Forward -192 -178 6.3911 0.0344
NP_441486.1_1 Reverse -264 -278 -0.688726 0.16
NP_441880.2_10 Forward -279 -261 8.86894 0.264
NP_440944.1_2 Reverse -168 -187 7.47261 0.158
NP_442634.1_2 Reverse -185 -204 -0.885524 0.298
NP_441265.1_3 Forward -195 -181 3.04785 0.181
NP_440403.1_4 Reverse -321 -340 -6.98204 0.236
NP_440057.1_4 Forward -368 -349 15.0641 0.188
NP_442848.1_1 Reverse -261 -275 -0.885388 0.263
NP_442848.1_1 Reverse -174 -188 -2.36035 0.263
NP_441012.1_4 Forward -124 -111 7.09911 0.272
NP_443018.1_3 Forward -188 -181 14.8871 0.0123
NP_443018.1_3 Reverse -181 -188 14.8871 0.0123
NP_443018.1_3 Forward -275 -268 4.26735 0.267
NP_443018.1_3 Reverse -268 -275 4.16902 0.278
NP_441634.1_8 Forward -191 -177 5.80112 0.114
NP_441634.1_8 Forward -400 -386 -4.7203 0.295
NP_440376.1_1 Forward -189 -180 19.4693 0.000692
NP_440376.1_1 Reverse -180 -189 19.4693 0.000692
NP_441588.1_4 Forward -187 -177 8.92815 0.14
NP_442687.1_7 Forward -190 -180 8.92815 0.0994
NP_442687.1_7 Reverse -179 -189 8.92815 0.0994
NP_442485.1_3 Forward -173 -154 0.491109 0.24
NP_442485.1_3 Reverse -163 -182 -0.295539 0.252
NP_442485.1_3 Reverse -256 -275 -5.60541 0.293
NP_440781.1_1 Reverse -317 -331 10.521 0.296
NP_442958.1_3 Forward -200 -181 8.94757 0.142
NP_442958.1_3 Forward -287 -268 -0.983855 0.268
NP_440642.1_8 Reverse -273 -292 13.0226 0.282
NP_441682.1_2 Forward -275 -256 13.6675 0.1
NP_441422.1_7 Forward -191 -174 -5.76269 0.247
NP_440533.1_9 Reverse -180 -199 17.699 0.0669
NP_442296.1_9 Forward -188 -169 15.0441 0.0808
NP_442658.1_1 Forward -278 -268 9.02601 0.169
NP_442658.1_1 Forward -191 -181 7.94438 0.199
NP_442658.1_1 Reverse -178 -188 6.76441 0.214
NP_440141.1_3 Forward -341 -322 1.86774 0.274
NP_440141.1_8 Reverse -371 -390 13.4708 0.156
NP_442782.1_2 Reverse -230 -244 6.58777 0.222
NP_442782.1_2 Forward -380 -366 5.60446 0.239
NP_442782.1_2 Reverse -321 -335 5.40779 0.244
NP_442782.1_2 Forward -182 -168 1.17956 0.282
NP_442205.1_9 Reverse -174 -190 -2.98973 0.277
NP_441414.1_9 Reverse -159 -178 -6.68705 0.201
NP_441414.1_9 Forward -189 -170 -7.86702 0.227
NP_440800.1_7 Forward -91 -77 12.7826 0.241
NP_442937.1_5 Forward -194 -175 7.37428 0.254
NP_441958.1_5 Forward -190 -180 12.2714 0.00183
NP_441958.1_5 Reverse -179 -189 12.2714 0.00183
NP_441127.1_1 Reverse -159 -173 16.8142 0.1
NP_442486.1_6 Forward -342 -323 -6.09707 0.28
NP_440203.1_5 Forward -186 -176 9.71433 0.245
NP_440203.1_5 Forward -57 -47 8.82935 0.283
NP_442260.1_9 Reverse -240 -259 17.404 0.289
NP_439905.1_1 Forward -176 -163 12.409 0.199
NP_439905.1_1 Forward -397 -384 9.95071 0.216
NP_440984.1_7 Reverse -225 -239 5.60446 0.248
NP_439990.1_5 Forward -194 -181 23.3237 0.000299
NP_441338.2_5 Reverse -159 -178 6.68596 0.275
NP_442376.1_2 Reverse -175 -194 -12.6852 0.286
NP_442911.1_2 Reverse -170 -189 6.78429 0.0277
NP_442911.1_2 Forward -199 -180 -0.983855 0.0804
NP_440153.1_5 Forward -188 -174 2.94952 0.219
NP_440858.1_1 Forward -333 -314 9.73422 0.0622
NP_440369.1_6 Reverse -259 -278 13.1758 0.17
NP_441941.1_9 Reverse -118 -137 -1.57384 0.298
NP_442119.1_6 Forward -282 -263 10.5209 0.134
NP_443055.1_6 Reverse -207 -225 2.18168 0.218
NP_440934.1_1 Reverse -166 -185 3.83436 0.286
NP_440602.1_2 Reverse -175 -194 5.89931 0.254
NP_441348.1_3 Reverse -175 -194 13.0775 0.138
NP_441099.1_5 Forward -199 -180 8.94757 0.0333
NP_440809.1_9 Reverse -171 -189 -6.56903 0.225
NP_441294.1_7 Reverse -176 -190 20.5773 0.00181
NP_441646.1_1 Reverse -173 -192 3.93269 0.204
NP_441646.1_1 Forward -346 -327 2.65439 0.216
NP_442438.1_10 Reverse -175 -189 3.04785 0.166
NP_442438.1_10 Forward -194 -180 0.786239 0.213
NP_441000.1_6 Forward -190 -176 -5.01529 0.257
NP_440147.1_4 Reverse -178 -191 18.9972 0.00328
NP_440147.1_4 Forward -191 -178 8.77074 0.0465
NP_441175.1_7 Forward -168 -149 9.93088 0.175
NP_441550.1_8 Forward -191 -181 15.1225 0.0132
NP_441550.1_8 Reverse -178 -188 14.6309 0.0132
NP_441916.1_7 Forward -189 -179 10.3048 0.0261
NP_441916.1_7 Reverse -180 -190 10.3048 0.0261
NP_441916.1_10 Forward -68 -49 2.65439 0.243
NP_441041.1_4 Reverse -168 -187 -11.2103 0.242
NP_441041.1_4 Reverse -180 -199 -11.7019 0.251
NP_441041.1_7 Forward -192 -180 7.51478 0.162
NP_442396.1_5 Reverse -176 -189 10.7374 0.106
NP_441547.1_2 Forward -200 -182 5.82068 0.215
NP_442004.1_6 Forward -189 -175 8.35772 0.142
NP_441725.1_4 Forward -194 -180 4.42388 0.278
NP_441725.1_5 Reverse -207 -217 5.48657 0.115
NP_441725.1_5 Forward -188 -178 2.04498 0.115
NP_441725.1_5 Reverse -181 -191 2.04498 0.115
NP_439966.1_7 Forward -191 -181 15.3192 0.0152
NP_439966.1_7 Reverse -178 -188 7.25606 0.15
NP_439966.1_7 Reverse -265 -275 6.17443 0.191
NP_442941.1_3 Reverse -181 -191 19.2529 0.00262
NP_442941.1_3 Forward -188 -178 11.0914 0.0116
NP_440289.1_2 Forward -192 -179 3.06754 0.0811
NP_440289.1_2 Reverse -177 -190 -4.89726 0.294
NP_440260.1_8 Forward -198 -180 -7.749 0.3
NP_442281.1_1 Forward -194 -180 8.45543 0.0808
NP_440177.1_1 Forward -337 -319 8.37728 0.272
NP_442256.1_2 Forward -191 -173 -7.35568 0.214
NP_442012.1_2 Forward -191 -172 1.76941 0.295
NP_440723.1_4 Reverse -258 -277 -10.7186 0.284
NP_441556.1_10 Forward -194 -180 12.4606 0.195
NP_441556.1_10 Reverse -174 -188 10.5138 0.267
NP_441644.1_6 Forward -189 -179 17.3841 0.00127
NP_441644.1_6 Reverse -180 -190 17.3841 0.00127
NP_442215.1_2 Reverse -178 -194 6.64671 0.0702
NP_442215.1_2 Forward -191 -175 -4.75968 0.239
NP_442029.1_6 Forward -194 -175 3.34271 0.282
NP_442029.1_6 Reverse -175 -194 2.75272 0.289
NP_440253.1_2 Reverse -180 -198 11.9172 0.0302
NP_440929.1_8 Forward -189 -180 19.2726 0.000701
NP_440929.1_8 Reverse -180 -189 19.2726 0.000701
NP_442933.1_10 Forward -189 -180 17.601 0.00325
NP_442933.1_10 Reverse -180 -189 17.601 0.00325
NP_442933.1_10 Forward -276 -267 3.83464 0.283
NP_442671.1_2 Forward -47 -28 -0.477563 0.297
NP_441751.2_8 Forward -188 -174 7.27608 0.0339
NP_441751.2_8 Reverse -181 -195 5.01447 0.0448
NP_442554.1_8 Reverse -181 -191 16.2046 0.0065
NP_442554.1_8 Forward -188 -178 15.3197 0.00882
NP_442554.1_8 Forward -275 -265 1.94665 0.288
NP_441762.1_7 Forward -190 -178 0.432302 0.0747
NP_441762.1_7 Reverse -179 -191 -6.74586 0.284
NP_442142.1_4 Forward -192 -179 13.49 0.0348
NP_442142.1_4 Reverse -264 -277 4.83694 0.209
NP_442142.1_4 Reverse -177 -190 3.06699 0.268
NP_442292.1_1 Forward -188 -179 18.486 0.00229
NP_442292.1_1 Reverse -181 -190 18.486 0.00229
NP_440919.1_7 Forward -385 -367 5.16171 0.286
NP_442476.1_6 Reverse -181 -195 2.2612 0.188
NP_440895.1_6 Forward -195 -182 18.6038 0.039
NP_441523.1_6 Forward -193 -174 5.211 0.239
NP_441523.1_6 Reverse -176 -195 2.16274 0.299
NP_443009.1_5 Reverse -179 -190 8.90795 0.0965
NP_443009.1_5 Forward -190 -179 8.90795 0.0965
NP_442301.1_8 Reverse -174 -193 16.5191 0.205
NP_441715.1_4 Reverse -181 -191 17.3846 0.0106
NP_441715.1_4 Forward -188 -178 7.94484 0.107
NP_441715.1_4 Forward -354 -344 5.19158 0.224
NP_441715.1_4 Forward -279 -269 4.60159 0.261
NP_440015.1_9 Forward -189 -171 -1.25915 0.277
NP_441448.1_1 Forward -241 -222 12.1925 0.178
NP_440379.1_5 Reverse -165 -184 -11.6036 0.299
NP_440464.1_10 Forward -188 -178 13.0082 0.169
NP_441468.1_1 Forward -188 -181 15.8704 0.0124
NP_441468.1_1 Reverse -181 -188 15.8704 0.0124
NP_441468.1_1 Forward -275 -268 10.2655 0.0906
NP_441015.1_10 Forward -194 -175 -9.83364 0.282
NP_441015.1_10 Reverse -175 -194 -11.7019 0.3
NP_441673.1_1 Forward -189 -180 20.8459 0.000698
NP_441673.1_1 Reverse -180 -189 20.8459 0.000698
NP_441826.1_2 Reverse -174 -188 3.63784 0.107
NP_441826.1_2 Forward -195 -181 -2.65535 0.273
NP_442868.1_6 Forward -191 -181 19.2529 0.00563
NP_442868.1_6 Reverse -178 -188 9.81313 0.038
NP_442719.1_2 Forward -329 -311 3.36165 0.158
NP_442719.1_2 Forward -375 -357 -11.3879 0.291
NP_441251.1_7 Reverse -46 -59 10.5407 0.288
NP_441612.1_2 Forward -40 -30 8.74291 0.21
NP_441612.1_2 Reverse -180 -190 8.54929 0.21
NP_441612.1_2 Forward -189 -179 8.54929 0.21
NP_442808.1_1 Reverse -179 -189 8.63269 0.0481
NP_442808.1_1 Forward -190 -180 8.63269 0.0481
NP_441101.1_10 Forward -193 -174 11.9958 0.119
NP_440145.1_3 Forward -199 -180 16.7157 0.00972
NP_442718.1_2 Reverse -108 -127 9.3409 0.0855
NP_442718.1_2 Reverse -159 -178 -2.85214 0.277
NP_442050.1_5 Forward -191 -181 14.3359 0.0206
NP_442050.1_5 Reverse -178 -188 7.64939 0.243
NP_440601.1_8 Reverse -83 -102 14.9694 0.222
NP_440346.1_6 Forward -54 -44 14.9247 0.231
NP_440558.1_2 Forward -198 -179 9.43923 0.102
NP_440558.1_2 Reverse -258 -277 1.96607 0.175
NP_440558.1_2 Forward -192 -173 -2.65548 0.229
NP_440558.1_2 Forward -219 -200 -7.37537 0.293
NP_441518.1_3 Reverse -257 -276 -14.5535 0.278
NP_442792.1_5 Forward -161 -144 13.8052 0.261
NP_441878.1_6 Forward -190 -180 10.4031 0.0176
NP_441878.1_6 Reverse -179 -189 10.4031 0.0176
NP_441878.1_6 Reverse -388 -398 0.766681 0.134
NP_441036.1_8 Forward -190 -180 8.33817 0.174
NP_441036.1_8 Reverse -179 -189 8.33817 0.174
NP_441557.1_5 Forward -189 -180 19.9609 0.000699
NP_441557.1_5 Reverse -180 -189 19.9609 0.000699
NP_441445.1_1 Reverse -171 -190 19.5673 0.0276
NP_441433.1_8 Forward -74 -55 -4.72043 0.294
NP_442579.1_6 Forward -323 -304 20.2556 0.0278
NP_440101.1_5 Forward -196 -177 5.211 0.196
NP_440676.1_4 Forward -175 -156 17.6982 0.267
NP_441116.1_9 Reverse -311 -325 14.6509 0.229
NP_441549.1_9 Reverse -226 -244 -9.71562 0.258
NP_442347.1_2 Forward -188 -179 12.4878 0.056
NP_442347.1_2 Reverse -181 -190 12.4878 0.056
NP_442645.1_2 Forward -197 -178 -12.8819 0.144
NP_442645.1_2 Reverse -172 -191 -14.5535 0.175
NP_441037.1_4 Reverse -178 -188 7.9999 0.237
NP_442594.1_8 Reverse -309 -328 2.85105 0.293
NP_441633.1_3 Forward -191 -178 3.46087 0.0699
NP_441633.1_3 Reverse -178 -191 1.19926 0.109
NP_440136.1_2 Forward -188 -181 15.9687 0.0123
NP_440136.1_2 Reverse -181 -188 15.9687 0.0123
NP_442590.1_10 Forward -189 -170 5.01433 0.267
NP_442998.1_5 Forward -141 -131 9.22315 0.248
NP_442998.1_10 Forward -187 -180 15.5754 0.0102
NP_442998.1_10 Reverse -182 -189 15.5754 0.0102
NP_440299.1_1 Forward -193 -180 20.2748 0.00128
NP_440299.1_1 Reverse -176 -189 16.2433 0.0109
NP_441799.1_1 Reverse -176 -190 18.5835 0.00832
NP_441799.1_1 Forward -193 -179 6.58715 0.167
NP_441799.1_1 Forward -284 -270 3.8339 0.279
NP_440256.1_1 Forward -192 -173 -7.57203 0.24
NP_440256.1_1 Reverse -264 -283 -9.44032 0.28
NP_441559.1_8 Forward -194 -180 12.4876 0.0574
NP_441559.1_8 Forward -205 -191 3.8345 0.141
NP_441559.1_8 Reverse -175 -189 0.392915 0.167
NP_441559.1_8 Reverse -185 -199 -5.50694 0.264
NP_440915.1_6 Forward -193 -179 10.6193 0.0301
NP_440717.1_2 Reverse -327 -346 -10.9153 0.259
NP_442785.1_7 Forward -191 -177 11.0127 0.228
NP_442069.1_7 Forward -335 -316 9.14342 0.3
NP_442452.1_8 Forward -195 -181 11.2087 0.28
NP_440748.1_5 Forward -186 -167 11.2092 0.133
NP_440748.1_5 Forward -359 -340 -2.55715 0.277
NP_441464.1_8 Forward -189 -175 5.50613 0.253
NP_439985.1_7 Reverse -174 -193 16.7157 0.148
NP_442993.1_1 Reverse -123 -139 -9.77456 0.194
NP_440677.1_1 Reverse -171 -190 7.96426 0.221
NP_442386.1_9 Reverse -179 -188 13.8639 0.0289
NP_442386.1_9 Forward -190 -181 13.8639 0.0289
NP_440570.1_5 Reverse -149 -168 6.68596 0.183
NP_441340.1_5 Forward -188 -181 15.6737 0.0124
NP_441340.1_5 Reverse -181 -188 15.6737 0.0124
NP_441340.1_5 Reverse -268 -275 4.07068 0.239
NP_441248.1_10 Forward -49 -39 15.2929 0.277
NP_442240.1_2 Reverse -181 -200 -19.5684 0.295
NP_440161.1_3 Forward -128 -109 7.86593 0.285
NP_442714.1_7 Forward -188 -169 3.14605 0.206
NP_440586.1_1 Reverse -317 -336 -4.91709 0.278
NP_440586.1_8 Forward -188 -181 13.2151 0.026
NP_440586.1_8 Reverse -181 -188 13.2151 0.026
NP_442251.1_6 Forward -188 -181 15.2804 0.0124
NP_442251.1_6 Reverse -181 -188 15.2804 0.0124
NP_440192.1_5 Reverse -158 -177 3.93269 0.268
NP_442959.1_6 Reverse -162 -181 1.0811 0.29
NP_440684.1_9 Reverse -174 -188 8.94771 0.221
NP_441262.1_3 Reverse -180 -187 14.7888 0.0223
NP_441262.1_3 Forward -189 -182 14.7888 0.0223
NP_440027.1_3 Reverse -180 -198 1.88669 0.295
NP_443051.1_1 Reverse -179 -188 10.4228 0.00754
NP_443051.1_1 Forward -190 -181 10.4228 0.00754
NP_439996.1_6 Reverse -220 -239 8.7879 0.242
NP_441232.1_10 Reverse -256 -275 5.60432 0.173
NP_439984.1_3 Reverse -173 -187 14.3553 0.192
NP_439937.1_9 Forward -190 -173 -5.07504 0.157
NP_439937.1_9 Reverse -179 -196 -16.383 0.287
NP_440626.1_1 Forward -188 -169 9.53674 0.258
NP_440626.1_2 Forward -186 -167 8.55425 0.293
NP_440439.1_1 Forward -192 -179 1.9859 0.138
NP_440372.1_2 Forward -188 -181 16.3621 0.0124
NP_440372.1_2 Reverse -181 -188 16.3621 0.0124
NP_440171.1_3 Forward -152 -133 2.26107 0.288
NP_440574.1_7 Reverse -43 -62 12.2908 0.25
NP_440819.1_5 Forward -324 -316 7.59091 0.272
NP_441803.1_2 Reverse -195 -214 12.8808 0.0575
NP_439977.1_5 Forward -195 -176 -0.39387 0.225
NP_439977.1_8 Reverse -40 -59 16.9475 0.196
NP_440139.1_1 Reverse -3 -22 0.392004 0.292
NP_441572.1_7 Forward -195 -176 8.16093 0.0744
NP_441572.1_7 Forward -206 -187 -1.86883 0.19
NP_442887.1_5 Reverse -228 -247 -9.14533 0.264
NP_442384.1_10 Reverse -180 -193 20.8655 0.00194
NP_442384.1_10 Forward -189 -176 18.0139 0.00545
NP_441380.1_3 Reverse -12 -31 7.86593 0.12
NP_441877.1_5 Reverse -73 -92 11.3075 0.124
NP_441018.1_7 Reverse -164 -183 8.16093 0.255
NP_440399.1_1 Reverse -162 -181 5.99764 0.3
NP_442790.1_4 Reverse -221 -240 -2.55715 0.115
NP_442262.1_10 Forward -188 -181 14.1988 0.0123
NP_442262.1_10 Reverse -181 -188 14.1988 0.0123
NP_441689.1_5 Forward -191 -181 5.78111 0.197
NP_441689.1_5 Reverse -178 -188 5.78111 0.197
NP_442244.1_6 Forward -132 -113 -0.000545616 0.291
NP_440344.1_10 Forward -196 -179 -5.86102 0.11
NP_440344.1_10 Reverse -173 -190 -8.22096 0.124
NP_440282.1_10 Reverse -196 -215 -8.45701 0.263
NP_440531.1_1 Reverse -366 -385 7.47261 0.217
NP_440531.1_6 Forward -197 -178 -4.91709 0.29
NP_442910.1_1 Forward -196 -177 -5.40875 0.254
NP_440562.1_3 Reverse -181 -198 13.9035 0.0648
NP_440562.1_10 Forward -198 -180 12.2122 0.206
NP_441965.1_10 Reverse -177 -193 2.51681 0.287
NP_440297.1_9 Reverse -207 -217 5.19158 0.213
NP_440297.1_9 Forward -188 -178 -0.118297 0.282
NP_440297.1_9 Reverse -181 -191 -0.118297 0.282
NP_440297.1_9 Forward -275 -265 -0.216628 0.282
NP_442280.1_10 Reverse -133 -151 5.25962 0.289
NP_441592.1_4 Reverse -180 -199 -1.57384 0.254
NP_441896.1_3 Forward -198 -179 0.0977854 0.23
NP_440834.1_2 Forward -204 -185 21.828 0.0492
NP_440999.1_2 Reverse -367 -386 8.84924 0.288
NP_440999.1_5 Reverse -222 -241 10.815 0.291
NP_440999.1_9 Forward -193 -179 10.1277 0.055
NP_440999.1_9 Forward -172 -158 0.687908 0.177
NP_440999.1_9 Forward -121 -107 -3.24533 0.289
NP_440888.1_2 Reverse -180 -194 16.1252 0.00789
NP_440888.1_2 Forward -189 -175 10.2254 0.1
NP_440888.1_2 Forward -177 -163 5.30886 0.284
NP_440179.1_6 Forward -329 -310 4.32602 0.246
NP_439969.1_6 Forward -331 -312 11.1109 0.158
NP_439969.1_9 Reverse -258 -270 17.8369 0.23
NP_442033.1_10 Reverse -178 -197 8.25926 0.057
NP_441543.1_2 Forward -188 -179 16.9127 0.00359
NP_441543.1_2 Reverse -181 -190 16.9127 0.00359
NP_442845.1_2 Reverse -174 -188 14.8476 0.0774
NP_442845.1_2 Forward -282 -268 9.63603 0.171
NP_442845.1_2 Forward -195 -181 3.93283 0.272
NP_441551.1_5 Reverse -263 -279 6.84268 0.256
NP_441319.1_8 Forward -195 -177 4.6407 0.29
NP_441469.1_8 Forward -190 -181 6.48957 0.227
NP_441469.1_8 Reverse -179 -188 6.48957 0.227
NP_442315.1_3 Reverse -230 -249 9.93088 0.172
NP_443064.1_6 Forward -189 -179 12.5669 0.0796
NP_443064.1_6 Reverse -180 -190 12.5669 0.0796
NP_442337.1_8 Forward -157 -138 -1.27885 0.28
NP_442578.1_7 Forward -188 -181 14.5921 0.026
NP_442578.1_7 Reverse -181 -188 14.5921 0.026
NP_442578.1_7 Forward -131 -124 9.97054 0.112
NP_441462.1_2 Forward -189 -179 11.5831 0.00406
NP_441462.1_2 Reverse -180 -190 11.5831 0.00406
NP_443062.1_6 Reverse -172 -191 12.9791 0.0924
NP_442204.1_1 Forward -193 -182 11.5634 0.0565
NP_442204.1_5 Reverse -356 -375 0.0977854 0.272
NP_441560.1_8 Forward -194 -175 14.2396 0.172
NP_440516.1_2 Forward -195 -177 12.0155 0.0708
NP_440516.1_2 Reverse -174 -192 -2.0458 0.297
NP_440516.1_8 Forward -189 -180 16.9127 0.00442
NP_440516.1_8 Reverse -180 -189 16.9127 0.00442
NP_442428.1_5 Forward -188 -181 15.8704 0.0124
NP_442428.1_5 Reverse -181 -188 15.8704 0.0124
NP_442428.1_5 Forward -275 -268 4.66067 0.244
NP_440618.1_1 Forward -327 -308 -11.5053 0.297
NP_441835.1_3 Forward -270 -256 16.2242 0.266
NP_440673.1_2 Forward -172 -153 10.7798 0.198
NP_440673.1_3 Forward -187 -180 12.4288 0.0426
NP_440673.1_3 Reverse -182 -189 12.4288 0.0426
NP_440718.1_2 Forward -96 -77 11.8975 0.269
NP_441052.1_2 Forward -189 -179 19.9412 0.00106
NP_441052.1_2 Reverse -180 -190 19.9412 0.00106
NP_441052.1_2 Forward -183 -173 2.83163 0.19
NP_441052.1_2 Reverse -389 -399 0.963343 0.255
NP_442219.1_9 Forward -188 -179 17.7976 0.00718
NP_442219.1_9 Reverse -181 -190 17.7976 0.00718
NP_440436.1_4 Forward -188 -179 17.2072 0.00233
NP_440436.1_4 Reverse -181 -190 17.2072 0.00233
NP_440314.1_9 Reverse -181 -200 10.2259 0.0289
NP_441719.1_4 Forward -188 -181 16.3621 0.0124
NP_441719.1_4 Reverse -181 -188 16.3621 0.0124
NP_441004.1_1 Reverse -315 -334 -15.9302 0.279
NP_441004.1_1 Reverse -162 -181 -16.4218 0.284
NP_442366.1_5 Reverse -177 -187 17.2858 0.0141
NP_442366.1_5 Reverse -383 -393 10.1076 0.289
NP_442694.1_4 Reverse -312 -321 15.536 0.164
NP_442206.1_9 Forward -189 -170 14.8466 0.28
NP_442206.1_10 Reverse -180 -195 2.43817 0.201
NP_442854.1_6 Reverse -168 -187 0.58944 0.292
NP_443054.1_2 Forward -191 -177 -0.492064 0.295
NP_441851.1_10 Forward -190 -180 15.8113 0.00552
NP_441851.1_10 Reverse -179 -189 15.8113 0.00552
NP_442622.1_5 Reverse -130 -149 -4.52377 0.2
NP_441542.1_4 Reverse -164 -178 3.14618 0.291
NP_442856.1_7 Forward -198 -179 -1.27885 0.223
NP_442515.1_1 Reverse -179 -193 2.16287 0.141
NP_442515.1_1 Forward -190 -176 2.06454 0.143
NP_440593.1_5 Forward -293 -274 19.2723 0.194
NP_441982.1_6 Forward -325 -316 13.5358 0.274
NP_441046.1_2 Reverse -148 -167 13.9625 0.182
NP_440940.1_7 Reverse -336 -354 7.3932 0.205
NP_441349.1_10 Forward -199 -180 9.24257 0.0248
NP_441349.1_10 Reverse -170 -189 2.75272 0.0731
NP_441409.1_6 Forward -195 -176 -8.06369 0.162
NP_441409.1_6 Reverse -174 -193 -9.24366 0.18
NP_442843.1_1 Reverse -372 -391 -11.6036 0.291
NP_439960.1_3 Forward -398 -379 5.99764 0.202
NP_440431.1_3 Forward -190 -171 -11.1119 0.284
NP_442450.1_5 Reverse -178 -188 7.55152 0.13
NP_440588.1_2 Forward -198 -179 3.6377 0.0983
NP_440588.1_2 Reverse -318 -337 1.57275 0.135
NP_440588.1_2 Reverse -171 -190 -1.08219 0.155
NP_442006.1_2 Forward -224 -207 -17.4641 0.276
NP_442243.1_1 Forward -195 -177 5.42659 0.182
NP_441570.1_1 Forward -276 -258 -9.81395 0.15
NP_441078.1_4 Forward -189 -180 19.6659 0.0007
NP_441078.1_4 Reverse -180 -189 19.6659 0.0007
NP_442348.1_2 Reverse -311 -320 17.011 0.055
NP_442348.1_2 Reverse -51 -60 14.5527 0.147
NP_442443.1_1 Forward -275 -256 9.83255 0.108
NP_442443.1_1 Reverse -328 -347 0.58944 0.215
NP_442443.1_1 Reverse -319 -338 -3.04881 0.264
NP_440526.1_3 Reverse -181 -192 8.02298 0.126
NP_440526.1_3 Forward -188 -177 0.943182 0.267
NP_441432.1_8 Reverse -179 -188 16.8143 0.00595
NP_441432.1_8 Forward -190 -181 16.8143 0.00595
NP_442320.1_8 Forward -195 -181 -2.06536 0.0851
NP_441732.1_2 Forward -193 -177 3.20513 0.0141
NP_441732.1_2 Reverse -176 -192 -7.70961 0.0885
NP_440313.1_1 Forward -334 -315 17.0107 0.168
NP_440759.1_9 Forward -96 -77 5.11266 0.293
NP_440760.1_1 Reverse -180 -199 -22.0267 0.248
NP_440760.1_1 Forward -168 -149 -23.2067 0.288
NP_442146.1_5 Forward -379 -360 13.8641 0.188
NP_442298.1_10 Forward -188 -169 11.6025 0.239
NP_442353.1_4 Reverse -174 -193 5.50519 0.183
NP_442353.1_4 Forward -195 -176 4.42355 0.205
NP_442353.1_4 Forward -332 -313 2.6536 0.229
NP_442353.1_4 Forward -335 -316 -1.08295 0.298
NP_441072.1_2 Reverse -169 -188 9.73422 0.216
NP_442400.1_10 Forward -59 -46 7.51014 0.284
NP_440713.1_4 Reverse -170 -189 8.75091 0.162
NP_440713.1_4 Reverse -197 -216 1.37609 0.287
NP_442489.1_7 Forward -189 -180 20.1576 0.000695
NP_442489.1_7 Reverse -180 -189 20.1576 0.000695
NP_442079.1_7 Reverse -181 -200 3.73603 0.209
NP_440559.1_1 Forward -188 -179 17.4043 0.00658
NP_440559.1_1 Reverse -181 -190 17.4043 0.00658
NP_441659.2_8 Forward -189 -179 18.1713 0.00133
NP_441659.2_8 Reverse -180 -190 18.1713 0.00133
NP_441022.1_1 Forward -159 -150 12.8891 0.222
NP_441040.1_2 Forward -211 -192 -0.590531 0.128
NP_441040.1_5 Reverse -175 -194 7.27595 0.229
NP_441800.1_7 Forward -176 -158 -1.65248 0.246
NP_442776.1_8 Forward -196 -177 15.2399 0.21
NP_442346.1_5 Forward -190 -180 16.6963 0.00248
NP_442346.1_5 Reverse -179 -189 16.6963 0.00248
NP_442346.1_5 Forward -399 -389 8.92815 0.121
NP_440352.1_5 Forward -228 -209 13.0451 0.208
NP_440352.1_5 Forward -334 -315 12.461 0.229
NP_440545.1_3 Reverse -176 -193 14.0018 0.0163
NP_440545.1_3 Forward -193 -176 -2.71443 0.191
NP_440545.1_5 Reverse -176 -193 8.69197 0.21
NP_440010.1_4 Forward -136 -117 0.490334 0.248
NP_440010.1_10 Reverse -318 -337 11.0125 0.209
NP_440010.1_10 Reverse -218 -237 6.4893 0.226
NP_442603.1_7 Reverse -180 -194 18.7801 0.0119
NP_441888.1_7 Forward -194 -180 3.73617 0.225
NP_441948.1_4 Reverse -173 -191 1.00246 0.134
NP_441502.1_9 Reverse -139 -153 16.2231 0.289
NP_441833.1_4 Forward -188 -181 15.9687 0.0124
NP_441833.1_4 Reverse -181 -188 15.9687 0.0124
NP_440912.1_3 Reverse -29 -48 8.94676 0.271
NP_441895.1_2 Reverse -186 -205 -26.8449 0.256
NP_442162.1_9 Forward -188 -181 16.2637 0.0124
NP_442162.1_9 Reverse -181 -188 16.2637 0.0124
NP_442055.1_6 Forward -273 -254 17.699 0.221
NP_440671.1_4 Forward -195 -181 8.84938 0.188
NP_440224.1_1 Forward -287 -268 6.39097 0.127
NP_440224.1_1 Forward -200 -181 2.65439 0.132
NP_442045.1_5 Reverse -258 -277 -1.86883 0.29
NP_442140.1_3 Forward -188 -178 12.2714 0.0632
NP_442140.1_3 Reverse -181 -191 10.3048 0.0902
NP_442723.1_1 Forward -22 -3 2.16195 0.291
NP_442914.1_8 Reverse -148 -167 18.3873 0.123
NP_440875.1_9 Reverse -182 -192 8.37203 0.233
NP_441813.1_5 Forward -191 -181 18.1713 0.00743
NP_441813.1_5 Reverse -178 -188 8.63316 0.0367
NP_440594.1_5 Reverse -17 -36 10.7167 0.293
NP_441227.1_7 Reverse -181 -200 12.5707 0.275
NP_440590.1_4 Reverse -181 -194 14.7689 0.0106
NP_440590.1_4 Forward -188 -175 11.6223 0.019
NP_440590.1_4 Reverse -262 -275 -2.34066 0.241
NP_440567.1_1 Forward -188 -174 8.45605 0.0577
NP_440567.1_1 Reverse -181 -195 0.392915 0.246
NP_440567.1_1 Forward -214 -200 -0.393733 0.281
NP_442497.1_10 Forward -188 -179 10.4228 0.0087
NP_442497.1_10 Reverse -181 -190 10.4228 0.0087
NP_440821.1_4 Reverse -178 -188 9.41981 0.0286
NP_440821.1_4 Forward -191 -181 9.41981 0.0286
NP_441239.1_9 Forward -191 -179 5.25052 0.223
NP_441239.1_9 Forward -278 -266 4.95553 0.234
NP_441239.1_9 Reverse -178 -190 3.38223 0.285
NP_441951.1_4 Reverse -188 -207 4.62101 0.273
NP_440400.1_1 Forward -177 -158 4.81688 0.22
NP_441892.1_1 Reverse -171 -188 -5.46769 0.281
NP_442643.1_3 Forward -167 -148 -8.752 0.297
NP_442629.1_3 Reverse -319 -338 3.04771 0.275
NP_440900.1_3 Reverse -315 -334 20.649 0.0935
NP_440546.1_4 Forward -189 -179 10.046 0.109
NP_440546.1_4 Reverse -180 -190 10.046 0.109
NP_440546.1_4 Forward -380 -370 7.52511 0.235
NP_442349.1_6 Forward -326 -307 -3.73712 0.299
NP_440462.1_4 Reverse -166 -180 7.17775 0.278
NP_440462.1_4 Forward -353 -339 4.91614 0.291
NP_440462.1_6 Forward -191 -181 9.61647 0.0429
NP_440462.1_6 Reverse -178 -188 1.35667 0.294
NP_440868.1_4 Reverse -176 -188 15.7719 0.0164
NP_440868.1_4 Forward -193 -181 8.00379 0.0602
NP_442499.1_3 Reverse -179 -197 5.62401 0.282
NP_441672.1_6 Reverse -266 -285 9.14342 0.294
NP_442402.1_4 Forward -382 -363 -0.00131823 0.186
NP_440696.1_3 Forward -199 -181 -3.22577 0.284
NP_442923.1_4 Forward -276 -257 -0.0988766 0.201
NP_442039.1_4 Forward -188 -181 15.1821 0.0124
NP_442039.1_4 Reverse -181 -188 15.1821 0.0124
NP_442039.1_7 Reverse -382 -392 7.64985 0.273
NP_441811.1_8 Reverse -174 -188 14.7492 0.162
NP_440825.1_7 Forward -188 -178 12.9096 0.152
NP_442837.1_3 Forward -188 -181 15.7721 0.0124
NP_442837.1_3 Reverse -181 -188 15.7721 0.0124
NP_442053.1_1 Forward -189 -180 18.3876 0.0007
NP_442053.1_1 Reverse -180 -189 18.3876 0.0007
NP_440505.1_3 Forward -191 -181 18.3679 0.00213
NP_440505.1_3 Reverse -178 -188 9.22315 0.122
NP_440505.1_3 Forward -272 -262 9.02648 0.128
NP_440520.1_1 Reverse -158 -177 -4.81876 0.289
NP_441252.1_6 Reverse -363 -370 11.6422 0.288
NP_441203.1_1 Reverse -181 -200 -8.94866 0.137
NP_440914.1_1 Forward -189 -179 17.5935 0.000537
NP_440914.1_1 Reverse -180 -190 17.5935 0.000537
NP_440914.1_1 Reverse -207 -217 6.46809 0.279
NP_441011.1_8 Forward -188 -179 8.25953 0.144
NP_441011.1_8 Reverse -181 -190 8.25953 0.144
NP_442533.1_6 Forward -189 -180 17.2076 0.00137
NP_442533.1_6 Reverse -180 -189 17.2076 0.00137
NP_442533.1_6 Reverse -389 -398 4.42462 0.179
NP_442533.1_6 Reverse -267 -276 2.94966 0.232
NP_442232.1_3 Forward -347 -328 -11.2103 0.281
NP_442232.1_3 Reverse -172 -191 -12.8819 0.282
NP_441482.1_7 Forward -195 -181 -0.688726 0.0612
NP_441482.1_7 Reverse -206 -220 -11.8985 0.286
NP_439944.1_9 Forward -188 -178 10.5014 0.0887
NP_439944.1_9 Reverse -181 -191 10.5014 0.0887
NP_439944.1_9 Forward -275 -265 4.99491 0.284
NP_442269.1_2 Forward -182 -163 22.2223 0.025
NP_442269.1_10 Reverse -169 -188 2.0644 0.28
NP_440116.1_5 Reverse -177 -194 3.67709 0.225
NP_440116.1_8 Reverse -181 -200 4.71934 0.0698
NP_441527.1_4 Forward -96 -77 -6.06416 0.214
NP_440115.1_6 Forward -192 -182 16.008 0.0325
NP_440115.1_6 Reverse -177 -187 8.33817 0.13
NP_440007.1_9 Forward -193 -179 8.25939 0.18
NP_439965.1_7 Reverse -38 -57 10.6116 0.294
NP_441106.1_1 Forward -190 -181 9.63616 0.0311
NP_441106.1_1 Reverse -179 -188 9.63616 0.0311
NP_441106.1_1 Forward -277 -268 4.91628 0.194
NP_440429.1_2 Forward -188 -169 7.86593 0.279
NP_441286.1_1 Forward -190 -178 12.9203 0.00815
NP_441286.1_1 Reverse -179 -191 12.9203 0.00815
NP_440670.1_8 Forward -189 -180 18.3876 0.000699
NP_440670.1_8 Reverse -180 -189 18.3876 0.000699
NP_440886.1_7 Forward -190 -180 7.94438 0.0805
NP_440886.1_7 Reverse -179 -189 7.94438 0.0805
NP_440886.1_7 Forward -337 -327 6.0761 0.147
NP_440886.1_7 Forward -169 -159 4.40448 0.237
NP_440886.1_7 Forward -183 -173 3.12618 0.296
NP_440828.1_4 Forward -340 -321 -7.3761 0.285
NP_442614.1_2 Forward -189 -175 13.5693 0.124
NP_442614.1_2 Reverse -180 -194 9.14437 0.242
NP_442614.1_2 Reverse -386 -400 8.25939 0.255
NP_442717.1_4 Reverse -19 -38 4.916 0.186
NP_442072.1_9 Forward -190 -172 -21.122 0.206
NP_442213.1_6 Reverse -303 -322 5.89931 0.268
NP_441808.1_8 Reverse -230 -249 17.404 0.152
NP_440907.2_8 Forward -188 -178 7.64939 0.117
NP_441021.1_1 Forward -188 -169 -4.72043 0.172
NP_441021.1_1 Reverse -181 -200 -12.7836 0.295
NP_441463.1_3 Reverse -257 -276 -5.9004 0.235
NP_441463.1_3 Forward -187 -168 -6.88371 0.251
NP_441463.1_3 Reverse -170 -189 -9.53865 0.28
NP_441626.1_2 Forward -188 -181 15.7721 0.0124
NP_441626.1_2 Reverse -181 -188 15.7721 0.0124
NP_442365.1_7 Forward -193 -174 9.93088 0.0723
NP_442794.1_1 Forward -193 -181 20.0002 0.00523
NP_442794.1_1 Reverse -176 -188 2.69391 0.286
NP_442615.1_1 Reverse -171 -189 8.18062 0.0297
NP_442615.1_1 Forward -198 -180 -5.38906 0.212
NP_441962.1_4 Forward -131 -112 -9.047 0.211
NP_441962.1_4 Reverse -154 -173 -10.4236 0.228
NP_441962.1_4 Reverse -175 -194 -15.1435 0.299
NP_440387.1_1 Forward -189 -173 6.35172 0.0282
NP_440387.1_1 Reverse -180 -196 -2.30141 0.147
NP_441431.1_2 Reverse -268 -282 11.5037 0.136
NP_441431.1_2 Forward -192 -178 10.422 0.159
NP_441488.1_8 Forward -194 -180 9.73373 0.146
NP_441836.1_2 Reverse -174 -193 12.9791 0.0686
NP_441836.1_2 Reverse -318 -337 6.88262 0.11
NP_441836.1_2 Forward -152 -133 -2.55715 0.23
NP_441193.1_1 Forward -66 -47 10.1267 0.277
NP_440634.1_8 Forward -333 -314 0.490334 0.285
NP_440634.1_10 Forward -260 -241 17.3048 0.124
NP_441993.1_1 Reverse -174 -193 1.65431 0.273
NP_440814.1_4 Reverse -171 -190 -12.3902 0.23
NP_440467.1_3 Forward -188 -169 13.2095 0.204
NP_440287.1_6 Reverse -171 -190 7.27595 0.156
NP_440293.1_3 Reverse -151 -170 -4.52377 0.264
NP_440293.1_10 Reverse -165 -184 -1.47551 0.271
NP_441237.1_9 Forward -188 -178 14.828 0.0242
NP_442867.1_8 Forward -337 -318 3.93269 0.295
NP_440457.1_1 Forward -193 -181 7.61046 0.101
NP_440457.1_1 Reverse -176 -188 2.69391 0.205
NP_440798.1_6 Forward -188 -175 5.62415 0.14
NP_441801.1_4 Forward -318 -308 12.1731 0.231
NP_442297.1_4 Reverse -176 -195 13.1133 0.255
NP_441332.1_4 Forward -95 -76 3.53937 0.294
NP_441436.1_8 Reverse -179 -198 16.4207 0.215
NP_441436.1_8 Forward -147 -128 7.57094 0.293
NP_442509.1_9 Forward -189 -179 8.14104 0.192
NP_442509.1_9 Reverse -180 -190 8.14104 0.192
NP_440554.1_4 Reverse -181 -191 8.92815 0.0646
NP_440554.1_4 Reverse -268 -278 5.78156 0.132
NP_441845.1_6 Forward -201 -183 1.10079 0.274
NP_441845.1_6 Forward -367 -349 0.412472 0.274
NP_441885.1_5 Forward -189 -179 20.9245 0.000538
NP_441885.1_5 Reverse -180 -190 20.9245 0.000538
NP_440478.1_10 Reverse -178 -192 7.9644 0.257
NP_442341.1_7 Reverse -179 -193 9.2427 0.0751
NP_442341.1_7 Forward -190 -176 7.9644 0.0956
NP_442341.1_9 Forward -191 -177 9.43874 0.152
NP_441756.1_5 Reverse -196 -215 2.94938 0.206
NP_441756.1_5 Forward -193 -174 -2.95047 0.287
NP_441756.1_5 Forward -204 -185 -4.52377 0.295
NP_443000.1_7 Forward -191 -181 19.9412 0.00223
NP_443000.1_7 Reverse -178 -188 10.3048 0.0345
NP_440507.2_3 Forward -198 -179 12.0933 0.166
NP_441842.1_1 Forward -187 -174 18.1116 0.0202
NP_440275.1_3 Forward -191 -181 15.123 0.0182
NP_440275.1_3 Reverse -178 -188 8.04317 0.0602
NP_440091.1_1 Reverse -176 -188 8.29878 0.0653
NP_443060.1_1 Forward -118 -99 10.9134 0.201
NP_440679.1_10 Reverse -323 -342 -20.65 0.286
NP_441389.1_7 Reverse -268 -287 25.7622 0.00777
NP_441207.1_4 Reverse -312 -331 6.4893 0.209
NP_440175.1_7 Reverse -164 -182 14.3403 0.156
NP_440149.1_8 Forward -168 -149 -7.67036 0.29
NP_441105.1_3 Reverse -169 -188 -8.752 0.278
NP_440216.1_1 Forward -189 -175 -0.0987402 0.0284
NP_440216.1_1 Reverse -180 -194 -0.492064 0.0284
NP_440216.1_1 Forward -200 -186 -12.6851 0.296
NP_440216.1_9 Forward -89 -80 5.89959 0.289
NP_440172.1_1 Forward -189 -179 15.0247 0.00945
NP_440172.1_1 Reverse -180 -190 15.0247 0.00945
NP_440167.1_3 Reverse -320 -339 15.1424 0.15
NP_442015.1_10 Forward -193 -180 21.1604 0.00329
NP_442015.1_10 Reverse -176 -189 10.5407 0.0391
NP_441226.1_7 Forward -188 -181 14.4934 0.0123
NP_441226.1_7 Reverse -181 -188 14.4934 0.0123
NP_441226.1_7 Reverse -321 -328 6.82361 0.246
NP_441111.1_7 Forward -188 -180 18.7023 0.00294
NP_441111.1_7 Reverse -181 -189 18.7023 0.00294
NP_440244.1_1 Reverse -176 -195 -4.91709 0.245
NP_441766.1_2 Forward -189 -180 17.5026 0.00297
NP_441766.1_2 Reverse -180 -189 17.5026 0.00297
NP_440416.1_9 Reverse -173 -192 -9.047 0.125
NP_440416.1_9 Forward -206 -187 -10.522 0.142
NP_440416.1_9 Forward -196 -177 -15.1435 0.186
NP_443052.1_9 Forward -337 -318 2.26107 0.174
NP_442403.1_8 Reverse -35 -54 -1.57384 0.258
NP_442154.1_1 Forward -275 -257 -13.6489 0.217
NP_440261.1_5 Reverse -181 -194 4.93583 0.0478
NP_440261.1_5 Forward -188 -175 -4.50394 0.151
NP_440261.1_5 Forward -397 -384 -6.96221 0.201
NP_440988.1_10 Forward -191 -177 9.15859 0.205
NP_440988.1_10 Reverse -178 -192 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTGGTCATGGTCCCCAATTTACCTATGGTTTTGCCGAAGCTCAAATGCGATTATTGGGCTGTTCCGTCACCACCGTCGGCAAAAATCCCCAGGAAGCTAATTTAATCAGTCAAGCTAGTCAGAAAGCGCTGGCAATTCTGGCGGATCAACATTATCAGCAACGCTGTCGGCACAATGGACAAGAGCGCATTGGCTCCCCCGGTGGTTCCCTGGCGATCGCCAACCACATTGCCGCAACTGCCAAAACTTTGGCTGACAAGGGGTAGAATGCGGTCAACATAGCCGTGATTTACTGCCACTAACTGAACAAATCAAGGAAAAGTCTTCCCTTTAACAACCCGAAAATCCCCAAGAAGATTAGGATAAAAACATCTAGGCCAATTTTAATCGTCCTCCGCGT

CDS

ATGAGTATCTACGATCCCAACCCAGATCAGTCTCTAGCCAGAATCGACGCCCTAGAGAAGGAGTTGGCCAACCTCAAAGCCAGTCATAACACCCTGGACATCCAAAATAAAATTCTGAAAGGCTTTATCTCCCTCACCAACGTCTCGGCGGGGCGGATGTTAATTAAGGCCACGTTGCAAAAAACCATGGAAGCCTCCATTCACCAAACGGGGGCCCAATTGGGCAGTCTTTTCTTACTAGATGGGGACGGCAGGGTCACGGAGAGTATTTTAGCCAGGGGAGCCACCGACCAAAGCCAGAAAAAGAATATTGTCGGCCAAGTGCTGGACAAGGGGCTAGCGGGTTGGGTCAGGGAAAATAAAAGAACTGGTCTCATCAACGACACCACCAAGGATTACCGTTGGCTAAAACTGCCCGACGAACCTTACCAGGCCCTGTCCGCCCTGGGGGTCCCTATTGTTTGGGGGGACGAACTGTTGGGGATTTTGACTCTGATGCATTCCCAGGTGAATCATTTCACCCCGGCCTGTGCCACTGCCATGGAAAAAACGGCAGAATTAATTGCTCTAGTCTTGAACAATGCTCGCATTCAAACCAAGCATAAGCAAAATGAAACTCTGATTCAACAGGAAGACGACTTATTAAACCAAGCTATTCTCTGGTTTCCCAGTATAATTTTTATCCTAGATAACCAGGGAGTATTGCTCAAATGTGGGGGCAAATATTTAGCCCAGATTGGTCTTGACCCTAAGGAAAGCATTGGTAAATCAATTTATTATTTATTACCTGAGGCTAATGAACTAAAAAGCCTGACCAGCCATGCCCTAGCTAACAACATTATTGAGTCTGTGAGCGTGCAGATGGAACGAGTCGACCACGGCACTTGGTTCTATGATGCTTGGTTTTCTCCTATCCTAGATAACCATGGCCAGGTTTCTAATGTTGTTTGTATGCTTTTACCAGCCTAA

Protein

MSIYDPNPDQSLARIDALEKELANLKASHNTLDIQNKILKGFISLTNVSAGRMLIKATLQKTMEASIHQTGAQLGSLFLLDGDGRVTESILARGATDQSQKKNIVGQVLDKGLAGWVRENKRTGLINDTTKDYRWLKLPDEPYQALSALGVPIVWGDELLGILTLMHSQVNHFTPACATAMEKTAELIALVLNNARIQTKHKQNETLIQQEDDLLNQAILWFPSIIFILDNQGVLLKCGGKYLAQIGLDPKESIGKSIYYLLPEANELKSLTSHALANNIIESVSVQMERVDHGTWFYDAWFSPILDNHGQVSNVVCMLLPA