Your browser is old and dusty. Try Google Chrome!

Details for slr1365

ORF slr1365
Accession NP_440899.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -217 -203 12.586 0.0452
NP_441061.1_2 Reverse -210 -224 0.0979218 0.218
NP_441061.1_2 Reverse -161 -175 -0.492064 0.231
NP_440557.1_1 Reverse -210 -229 13.8641 0.0669
NP_440795.1_7 Forward -217 -210 14.6904 0.0123
NP_440795.1_7 Reverse -210 -217 14.6904 0.0123
NP_441418.1_6 Reverse -209 -228 -19.4701 0.0888
NP_442291.1_5 Forward -219 -203 13.8249 0.0261
NP_441453.1_1 Forward -225 -207 4.14829 0.263
NP_441453.1_4 Reverse -209 -217 16.539 0.00633
NP_441453.1_4 Forward -218 -210 16.539 0.00633
NP_442151.1_6 Reverse -209 -223 14.6509 0.0321
NP_442151.1_6 Forward -218 -204 7.76774 0.19
NP_442151.1_6 Reverse -340 -354 5.99778 0.253
NP_441818.1_1 Forward -217 -206 18.8393 0.00301
NP_441818.1_1 Reverse -377 -388 8.51463 0.288
NP_440226.1_1 Forward -218 -199 10.0292 0.0665
NP_440226.1_1 Reverse -209 -228 8.55425 0.0849
NP_441630.1_3 Reverse -201 -220 -0.885524 0.29
NP_442744.1_9 Reverse -203 -217 17.5862 0.266
NP_442173.1_1 Forward -217 -209 15.4574 0.00633
NP_442173.1_1 Reverse -210 -218 15.4574 0.00633
NP_442752.1_4 Forward -218 -211 13.8055 0.0199
NP_442752.1_4 Reverse -209 -216 13.8055 0.0199
NP_442752.1_4 Forward -152 -145 10.5605 0.1
NP_442752.1_4 Reverse -2 -9 5.54565 0.194
NP_442752.1_4 Reverse -274 -281 5.44732 0.202
NP_442752.1_4 Reverse -223 -230 5.25066 0.256
NP_443027.1_4 Forward -220 -210 16.2046 0.0437
NP_443027.1_4 Reverse -207 -217 14.0414 0.0452
NP_443027.1_4 Reverse -221 -231 5.87989 0.294
NP_441812.1_3 Reverse -208 -222 19.1741 0.0453
NP_442975.1_10 Reverse -205 -219 13.1753 0.0459
NP_442975.1_10 Forward -222 -208 4.22722 0.245
NP_440784.1_7 Forward -217 -210 15.9687 0.0123
NP_440784.1_7 Reverse -210 -217 15.9687 0.0123
NP_442909.1_7 Forward -217 -203 8.84875 0.161
NP_440061.1_9 Forward -76 -62 5.30886 0.29
NP_440110.1_8 Reverse -47 -66 1.0811 0.211
NP_440110.1_8 Reverse -207 -226 -0.197208 0.219
NP_441054.1_2 Forward -343 -324 14.0608 0.172
NP_441145.1_1 Forward -21 -2 15.0441 0.176
NP_442062.1_8 Forward -218 -208 17.3846 0.00193
NP_442062.1_8 Reverse -209 -219 10.3048 0.0493
NP_440761.1_4 Reverse -204 -223 -13.7669 0.257
NP_440304.1_4 Forward -220 -210 19.9412 0.00364
NP_440304.1_4 Reverse -207 -217 10.8948 0.051
NP_442242.1_4 Forward -217 -210 14.3954 0.0124
NP_442242.1_4 Reverse -210 -217 14.3954 0.0124
NP_442097.1_2 Forward -318 -299 10.1275 0.189
NP_441352.1_2 Forward -159 -140 13.4708 0.0835
NP_441208.1_9 Reverse -206 -220 4.81781 0.285
NP_440764.1_10 Forward -35 -16 17.2065 0.141
NP_440132.1_1 Reverse -207 -225 9.26226 0.244
NP_442110.1_7 Reverse -209 -223 11.701 0.0593
NP_442110.1_7 Forward -218 -204 0.196253 0.266
NP_440769.1_3 Reverse -354 -373 11.6017 0.28
NP_441083.1_5 Forward -218 -208 20.3345 0.00053
NP_441083.1_5 Reverse -209 -219 11.2881 0.0159
NP_442827.1_8 Reverse -201 -220 4.32522 0.137
NP_441738.1_2 Forward -216 -209 15.28 0.0102
NP_441738.1_2 Reverse -211 -218 15.28 0.0102
NP_441738.1_2 Forward -281 -274 10.2652 0.101
NP_440209.1_1 Reverse -209 -217 18.1123 0.00295
NP_440209.1_1 Forward -218 -210 18.1123 0.00295
NP_442889.1_1 Reverse -58 -77 -13.1769 0.248
NP_442889.1_8 Forward -221 -207 8.3571 0.123
NP_441713.1_1 Reverse -22 -41 -17.1101 0.298
NP_441713.1_4 Reverse -377 -396 11.0125 0.228
NP_440178.1_7 Forward -219 -200 -5.99873 0.066
NP_440178.1_7 Reverse -208 -227 -22.715 0.272
NP_442570.1_3 Forward -335 -316 -1.7705 0.212
NP_442570.1_3 Forward -272 -253 -1.86883 0.212
NP_442570.1_3 Reverse -350 -369 -8.55534 0.288
NP_442570.1_3 Reverse -207 -226 -9.34199 0.298
NP_441792.1_1 Reverse -15 -34 10.3242 0.157
NP_441716.1_1 Forward -218 -204 10.7177 0.0936
NP_442111.1_4 Reverse -208 -222 11.0127 0.0518
NP_441163.1_1 Forward -27 -10 16.066 0.174
NP_441163.1_4 Reverse -18 -37 12.9205 0.278
NP_440343.1_3 Forward -282 -264 6.01657 0.242
NP_440906.1_5 Forward -217 -210 15.8704 0.0124
NP_440906.1_5 Reverse -210 -217 15.8704 0.0124
NP_440747.1_10 Forward -221 -209 7.80712 0.00223
NP_440747.1_10 Reverse -206 -218 7.51213 0.00286
NP_441486.1_1 Reverse -206 -220 12.586 0.0112
NP_441486.1_1 Forward -221 -207 3.24451 0.0638
NP_442634.1_4 Reverse -207 -221 7.86607 0.0479
NP_442634.1_4 Forward -220 -206 -2.26202 0.149
NP_442634.1_4 Forward -351 -337 -5.40861 0.253
NP_440403.1_10 Forward -227 -208 3.14605 0.278
NP_441695.1_4 Forward -216 -198 13.1955 0.219
NP_441695.1_4 Reverse -145 -163 11.1305 0.243
NP_441014.1_8 Reverse -150 -169 -7.96535 0.282
NP_441014.1_8 Reverse -147 -166 -8.16202 0.283
NP_442848.1_1 Reverse -203 -217 6.6861 0.0791
NP_442848.1_4 Reverse -245 -259 10.7177 0.282
NP_442848.1_4 Forward -328 -314 7.17775 0.282
NP_443018.1_3 Forward -217 -210 14.8871 0.0123
NP_443018.1_3 Reverse -210 -217 14.8871 0.0123
NP_441316.1_7 Reverse -207 -222 7.74804 0.107
NP_441634.1_8 Forward -387 -373 -3.147 0.295
NP_440376.1_1 Forward -218 -209 19.4693 0.000692
NP_440376.1_1 Reverse -209 -218 19.4693 0.000692
NP_440376.1_1 Forward -21 -12 2.06468 0.236
NP_440376.1_1 Reverse -2 -11 1.57302 0.246
NP_441588.1_4 Forward -216 -206 8.63316 0.14
NP_440580.1_5 Reverse -5 -19 16.9125 0.157
NP_442687.1_7 Forward -219 -209 9.02648 0.0994
NP_442687.1_7 Reverse -208 -218 8.92815 0.0994
NP_441077.1_6 Forward -249 -233 2.03061 0.29
NP_442485.1_3 Forward -229 -210 -4.52377 0.282
NP_441846.1_10 Forward -32 -13 -15.6352 0.254
NP_441846.1_10 Reverse -260 -279 -22.9117 0.271
NP_441846.1_10 Reverse -264 -283 -23.5016 0.289
NP_442530.1_2 Reverse -38 -48 15.713 0.203
NP_441013.1_3 Forward -379 -360 6.09597 0.281
NP_442658.1_1 Forward -220 -210 13.0576 0.04
NP_442658.1_1 Reverse -207 -217 6.76441 0.214
NP_442658.1_1 Forward -234 -224 6.76441 0.214
NP_442198.1_7 Forward -41 -22 9.34008 0.273
NP_442782.1_2 Reverse -209 -223 1.67122 0.281
NP_442205.1_9 Reverse -203 -219 -1.02311 0.264
NP_442544.1_6 Forward -225 -206 -7.27704 0.298
NP_441414.1_9 Forward -218 -199 -5.50708 0.177
NP_442937.1_5 Forward -157 -138 7.07928 0.263
NP_441958.1_5 Forward -219 -209 21.2195 0.000805
NP_441958.1_5 Reverse -208 -218 12.2714 0.00183
NP_442685.1_2 Reverse -176 -186 13.943 0.278
NP_440203.1_5 Reverse -212 -222 12.5659 0.146
NP_442260.1_4 Forward -355 -336 25.9588 0.00588
NP_440984.1_7 Forward -223 -209 11.701 0.122
NP_442911.1_2 Forward -228 -209 -4.72043 0.14
NP_440153.1_5 Forward -217 -203 5.40779 0.191
NP_440153.1_6 Reverse -208 -227 15.7324 0.222
NP_443055.1_6 Forward -232 -214 -0.964891 0.271
NP_443055.1_6 Forward -19 -1 -2.53818 0.296
NP_440993.1_2 Forward -223 -207 1.33684 0.284
NP_440993.1_3 Forward -82 -63 1.37531 0.231
NP_440602.1_8 Forward -218 -204 15.6342 0.116
NP_440850.1_2 Reverse -165 -184 4.916 0.299
NP_442002.1_1 Forward -161 -143 -5.38906 0.239
NP_441294.1_7 Reverse -205 -219 10.7864 0.171
NP_442438.1_10 Forward -223 -209 3.04785 0.166
NP_442438.1_10 Reverse -204 -218 -0.295402 0.256
NP_442431.1_10 Forward -158 -140 -0.0791831 0.284
NP_441000.1_6 Reverse -142 -156 -0.688726 0.208
NP_441000.1_6 Forward -219 -205 -4.62196 0.248
NP_440147.1_4 Forward -220 -207 3.65753 0.183
NP_440147.1_4 Reverse -207 -220 1.49425 0.226
NP_441550.1_8 Forward -220 -210 13.0576 0.0273
NP_441550.1_8 Reverse -207 -217 12.3692 0.0336
NP_441916.1_7 Reverse -209 -219 18.9579 0.00144
NP_441916.1_7 Forward -218 -208 10.3048 0.0261
NP_441041.1_7 Forward -221 -209 6.34865 0.211
NP_442004.1_6 Reverse -209 -223 5.30946 0.191
NP_441725.1_5 Forward -217 -207 11.2881 0.0247
NP_441725.1_5 Reverse -210 -220 11.1898 0.0247
NP_439966.1_7 Reverse -207 -217 15.8108 0.0124
NP_439966.1_7 Forward -220 -210 14.8275 0.0177
NP_439966.1_7 Forward -13 -3 4.99446 0.248
NP_439966.1_9 Reverse -272 -281 5.3096 0.253
NP_440736.1_3 Forward -220 -201 -0.688862 0.282
NP_442941.1_3 Forward -217 -207 19.9412 0.00262
NP_442941.1_3 Reverse -210 -220 19.9412 0.00262
NP_440289.1_2 Reverse -206 -219 6.50913 0.0591
NP_440289.1_2 Forward -221 -208 3.85419 0.0735
NP_441678.1_9 Forward -362 -343 -5.70374 0.299
NP_442281.1_1 Reverse -204 -218 17.8952 0.00513
NP_442281.1_1 Forward -223 -209 16.3219 0.00832
NP_441334.1_7 Reverse -207 -226 -11.8003 0.126
NP_442256.1_2 Reverse -207 -225 -7.749 0.215
NP_440437.1_1 Forward -224 -205 12.1925 0.0354
NP_441556.1_7 Forward -38 -19 -1.27961 0.3
NP_440498.1_1 Forward -227 -209 8.67227 0.0786
NP_440498.1_1 Reverse -200 -218 -0.865831 0.22
NP_440498.1_5 Forward -150 -132 12.4805 0.187
NP_442982.1_5 Forward -228 -209 6.4893 0.153
NP_442982.1_5 Reverse -199 -218 4.71934 0.171
NP_440375.1_8 Forward -78 -59 -1.96717 0.298
NP_441644.1_6 Reverse -209 -219 19.0557 0.000803
NP_441644.1_6 Forward -218 -208 17.3841 0.00127
NP_442215.1_2 Reverse -207 -223 3.69678 0.093
NP_442029.1_1 Forward -177 -158 -11.5053 0.229
NP_440253.1_2 Forward -218 -200 -1.55415 0.244
NP_440929.1_8 Forward -218 -209 19.2726 0.000701
NP_440929.1_8 Reverse -209 -218 19.2726 0.000701
NP_442933.1_10 Forward -218 -209 17.601 0.00325
NP_442933.1_10 Reverse -209 -218 17.601 0.00325
NP_441751.2_8 Forward -217 -203 15.3392 0.0119
NP_441751.2_8 Reverse -210 -224 6.3911 0.0354
NP_442554.1_8 Reverse -210 -220 16.9913 0.0065
NP_442554.1_8 Forward -217 -207 15.9097 0.00747
NP_441586.1_5 Forward -280 -261 22.5172 0.00426
NP_441762.1_7 Reverse -1 -13 -5.56589 0.217
NP_441762.1_7 Forward -219 -207 -6.74586 0.284
NP_441762.1_7 Reverse -208 -220 -6.94252 0.284
NP_442142.1_4 Forward -221 -208 14.8666 0.0302
NP_442142.1_4 Reverse -206 -219 14.7683 0.0302
NP_442292.1_1 Forward -217 -208 18.486 0.00229
NP_442292.1_1 Reverse -210 -219 17.5026 0.00435
NP_441024.1_1 Forward -152 -138 17.5025 0.229
NP_443009.1_5 Reverse -208 -219 14.5128 0.02
NP_443009.1_5 Forward -219 -208 10.1862 0.0792
NP_443009.1_5 Reverse -222 -233 4.8764 0.226
NP_442408.2_1 Reverse -209 -228 -4.52377 0.263
NP_441715.1_4 Forward -217 -207 14.828 0.0268
NP_441715.1_4 Reverse -210 -220 14.238 0.0295
NP_440015.1_9 Forward -218 -200 8.96727 0.099
NP_441448.1_1 Reverse -53 -72 6.68596 0.245
NP_441198.1_8 Forward -220 -210 13.2713 0.108
NP_440379.1_4 Forward -170 -152 20.0787 0.145
NP_440379.1_5 Forward -227 -208 -7.4737 0.245
NP_441468.1_1 Forward -217 -210 15.8704 0.0124
NP_441468.1_1 Reverse -210 -217 15.8704 0.0124
NP_441020.2_6 Reverse -207 -224 14.5918 0.0524
NP_441020.2_6 Reverse -272 -289 9.97027 0.156
NP_441673.1_1 Forward -218 -209 20.8459 0.000698
NP_441673.1_1 Reverse -209 -218 20.8459 0.000698
NP_441826.1_2 Reverse -203 -217 12.6843 0.0262
NP_441826.1_2 Forward -224 -210 -2.65535 0.273
NP_442490.1_9 Forward -230 -211 -7.76869 0.278
NP_442868.1_6 Reverse -207 -217 9.91146 0.038
NP_442868.1_6 Forward -220 -210 1.06167 0.205
NP_441612.1_2 Forward -256 -246 15.7134 0.209
NP_441612.1_2 Forward -218 -208 8.54929 0.21
NP_442227.1_2 Reverse -145 -164 5.211 0.202
NP_442361.1_3 Forward -224 -211 9.2624 0.276
NP_442361.1_3 Reverse -255 -268 8.47575 0.285
NP_442427.1_10 Forward -65 -46 10.0284 0.215
NP_442808.1_1 Forward -219 -209 8.73102 0.0481
NP_442808.1_1 Reverse -208 -218 8.63269 0.0481
NP_442808.1_1 Forward -12 -2 7.25606 0.0831
NP_442808.1_1 Reverse -316 -326 3.8145 0.222
NP_442808.1_1 Reverse -165 -175 1.15957 0.292
NP_440145.1_3 Reverse -23 -42 -0.4922 0.141
NP_440145.1_3 Reverse -199 -218 -1.96717 0.159
NP_442542.1_9 Forward -225 -211 9.43874 0.135
NP_442050.1_5 Forward -220 -210 18.0724 0.00365
NP_442050.1_5 Reverse -207 -217 16.4991 0.00812
NP_442342.1_9 Forward -21 -5 5.07341 0.241
NP_440558.1_2 Forward -227 -208 -0.787193 0.204
NP_440558.1_2 Forward -41 -22 -4.42544 0.245
NP_441498.1_1 Reverse -176 -195 18.6683 0.21
NP_442789.1_4 Reverse -207 -226 9.63589 0.0942
NP_441518.1_3 Reverse -199 -218 4.12936 0.05
NP_441518.1_3 Forward -228 -209 -11.0136 0.255
NP_441878.1_6 Forward -219 -209 10.5014 0.0176
NP_441878.1_6 Reverse -208 -218 10.4031 0.0176
NP_441878.1_6 Reverse -63 -73 1.06167 0.116
NP_441878.1_6 Reverse -9 -19 -1.00328 0.188
NP_441878.1_6 Forward -20 -10 -7.78811 0.266
NP_441036.1_8 Forward -219 -209 15.713 0.00724
NP_441036.1_8 Reverse -208 -218 8.33817 0.174
NP_441557.1_5 Forward -218 -209 19.9609 0.000699
NP_441557.1_5 Reverse -209 -218 19.9609 0.000699
NP_441557.1_8 Forward -277 -267 14.2375 0.201
NP_441433.1_8 Forward -331 -312 3.04771 0.208
NP_442962.1_5 Reverse -335 -354 5.211 0.242
NP_441308.1_8 Forward -220 -210 13.353 0.218
NP_442183.1_1 Forward -218 -204 16.6175 0.0139
NP_442183.1_1 Reverse -209 -223 10.521 0.0829
NP_442183.1_1 Reverse -33 -47 5.60446 0.21
NP_441549.1_9 Reverse -205 -223 2.87075 0.094
NP_442347.1_2 Forward -217 -208 12.4878 0.056
NP_442347.1_2 Forward -282 -273 4.42462 0.284
NP_442347.1_2 Reverse -210 -219 3.34298 0.284
NP_442965.1_2 Forward -367 -348 -6.09707 0.257
NP_441037.1_4 Forward -220 -210 7.31769 0.237
NP_442594.1_8 Forward -161 -142 2.55606 0.295
NP_441633.1_3 Reverse -141 -154 1.10092 0.109
NP_441633.1_3 Reverse -133 -146 -5.68391 0.236
NP_441633.1_3 Reverse -207 -220 -6.17557 0.238
NP_441633.1_3 Forward -354 -341 -6.2739 0.242
NP_440136.1_2 Forward -217 -210 15.9687 0.0123
NP_440136.1_2 Reverse -210 -217 15.9687 0.0123
NP_442590.1_9 Reverse -54 -73 5.211 0.273
NP_442590.1_10 Forward -44 -25 6.88262 0.237
NP_442998.1_10 Forward -216 -209 15.5754 0.0102
NP_442998.1_10 Reverse -211 -218 15.5754 0.0102
NP_440899.1_1 Forward -379 -360 23.339 0.00869
NP_440899.1_1 Forward -118 -99 13.8726 0.125
NP_440899.1_2 Forward -229 -210 32.4477 0.00000276
NP_440899.1_3 Forward -182 -163 26.7455 0.00265
NP_440899.1_4 Forward -162 -143 29.5971 0.000127
NP_440899.1_5 Forward -82 -63 26.7455 0.00419
NP_440899.1_6 Forward -112 -93 29.4004 0.000344
NP_440899.1_7 Forward -295 -276 28.5145 0.000866
NP_440899.1_8 Forward -208 -189 32.547 0.0000498
NP_440899.1_9 Forward -22 -3 24.2872 0.00842
NP_440899.1_10 Forward -316 -297 30.2854 0.000374
NP_440299.1_1 Reverse -205 -218 4.44361 0.207
NP_440299.1_1 Forward -222 -209 3.46031 0.243
NP_440299.1_4 Forward -76 -57 20.2556 0.149
NP_441799.1_1 Forward -222 -208 15.3386 0.0187
NP_441799.1_1 Reverse -205 -219 11.012 0.0629
NP_441007.1_10 Forward -223 -210 10.934 0.0646
NP_441007.1_10 Reverse -204 -217 0.510939 0.226
NP_442333.2_5 Forward -229 -210 -14.3569 0.272
NP_440256.1_1 Reverse -206 -225 7.86593 0.0246
NP_440256.1_1 Forward -221 -202 -2.0655 0.112
NP_441229.1_10 Forward -336 -317 -2.26216 0.288
NP_441559.1_8 Reverse -348 -362 3.14618 0.143
NP_441559.1_8 Reverse -228 -242 -6.09693 0.274
NP_441559.1_8 Reverse -293 -307 -7.47356 0.294
NP_440915.1_6 Reverse -205 -219 4.03116 0.1
NP_441179.1_6 Reverse -46 -65 15.6341 0.295
NP_441296.1_9 Reverse -298 -311 19.6848 0.0761
NP_442866.1_1 Forward -223 -204 -8.35868 0.279
NP_441464.1_1 Forward -282 -263 8.25926 0.261
NP_441494.1_6 Forward -223 -210 5.82081 0.292
NP_442993.1_1 Forward -218 -202 11.8583 0.0141
NP_442993.1_1 Reverse -209 -225 -11.0529 0.233
NP_442386.1_9 Reverse -208 -217 13.8639 0.0289
NP_442386.1_9 Forward -43 -34 6.78414 0.219
NP_442386.1_9 Forward -219 -210 6.39082 0.219
NP_441340.1_5 Forward -217 -210 15.6737 0.0124
NP_441340.1_5 Reverse -210 -217 15.6737 0.0124
NP_440168.1_9 Reverse -207 -226 3.34271 0.231
NP_440327.1_6 Forward -379 -360 2.75272 0.29
NP_442506.1_2 Forward -229 -210 2.85105 0.278
NP_442240.1_2 Reverse -210 -229 -3.54046 0.0766
NP_440211.1_4 Forward -147 -137 16.7946 0.209
NP_440586.1_8 Forward -217 -210 13.2151 0.026
NP_440586.1_8 Reverse -210 -217 13.2151 0.026
NP_442251.1_6 Forward -217 -210 15.2804 0.0124
NP_442251.1_6 Reverse -210 -217 15.2804 0.0124
NP_440684.1_9 Reverse -203 -217 18.7808 0.0363
NP_441262.1_3 Reverse -209 -216 14.7888 0.0223
NP_441262.1_3 Forward -218 -211 14.7888 0.0223
NP_443051.1_1 Forward -219 -210 19.5676 0.00335
NP_443051.1_1 Reverse -208 -217 10.4228 0.00754
NP_439937.1_9 Reverse -113 -130 -13.5315 0.287
NP_439937.1_9 Reverse -114 -131 -16.4814 0.287
NP_440836.1_6 Forward -201 -187 5.60446 0.299
NP_443039.1_7 Reverse -297 -311 15.4369 0.0927
NP_443039.1_7 Reverse -303 -317 5.70218 0.211
NP_440408.1_7 Forward -165 -146 12.5858 0.21
NP_440439.1_1 Forward -221 -208 9.06573 0.0475
NP_440439.1_1 Forward -162 -149 8.67241 0.0513
NP_440439.1_1 Reverse -206 -219 -0.177378 0.209
NP_439943.1_7 Forward -47 -28 2.26107 0.298
NP_440372.1_2 Forward -217 -210 16.3621 0.0124
NP_440372.1_2 Reverse -210 -217 16.3621 0.0124
NP_440574.1_2 Reverse -49 -68 8.06259 0.242
NP_440139.1_1 Reverse -203 -222 1.37531 0.263
NP_441572.1_4 Reverse -64 -83 11.0125 0.298
NP_440267.1_2 Reverse -204 -218 9.43874 0.156
NP_440267.1_2 Forward -223 -209 8.65209 0.162
NP_442384.1_10 Reverse -209 -222 13.589 0.0195
NP_442384.1_10 Forward -218 -205 1.10092 0.268
NP_442790.1_4 Reverse -200 -219 -7.27704 0.152
NP_442262.1_10 Forward -217 -210 14.1988 0.0123
NP_442262.1_10 Reverse -210 -217 14.1988 0.0123
NP_441689.1_5 Forward -220 -210 17.8758 0.0158
NP_441689.1_5 Reverse -207 -217 15.3192 0.0403
NP_440163.1_10 Reverse -206 -216 11.3864 0.169
NP_440344.1_10 Forward -225 -208 -9.40093 0.146
NP_440075.1_2 Forward -35 -16 5.89931 0.266
NP_440075.1_5 Forward -220 -201 10.7167 0.288
NP_440282.1_10 Forward -228 -209 -5.60541 0.25
NP_440531.1_6 Forward -226 -207 4.71934 0.122
NP_440531.1_6 Reverse -56 -75 1.37609 0.177
NP_440562.1_3 Reverse -210 -227 5.74204 0.153
NP_441965.1_10 Reverse -206 -222 15.2998 0.0656
NP_442556.1_10 Forward -207 -188 8.06688 0.299
NP_440297.1_9 Forward -217 -207 9.32148 0.0917
NP_440297.1_9 Reverse -210 -220 9.22315 0.0917
NP_442280.1_10 Forward -41 -23 7.79204 0.268
NP_441592.1_4 Forward -79 -60 -3.83545 0.29
NP_440894.1_10 Forward -275 -256 3.73603 0.266
NP_442067.1_4 Forward -229 -210 7.47261 0.195
NP_440999.1_2 Reverse -190 -209 10.8159 0.234
NP_440999.1_9 Forward -222 -208 0.392915 0.187
NP_440888.1_2 Forward -218 -204 15.4369 0.0107
NP_440888.1_2 Reverse -209 -223 12.9786 0.0354
NP_441771.1_4 Forward -56 -37 -3.83545 0.292
NP_440179.1_6 Forward -79 -60 21.7306 0.0627
NP_440491.1_1 Reverse -206 -225 11.7899 0.161
NP_440575.1_1 Reverse -239 -258 4.22689 0.236
NP_441543.1_2 Forward -217 -208 16.9127 0.00359
NP_441543.1_2 Reverse -210 -219 15.9293 0.00518
NP_442845.1_2 Reverse -203 -217 12.6843 0.104
NP_442845.1_2 Forward -224 -210 7.27608 0.195
NP_442845.1_2 Forward -374 -360 5.30946 0.237
NP_441551.1_5 Reverse -205 -221 7.53099 0.245
NP_441469.1_8 Forward -219 -210 6.5879 0.227
NP_441469.1_8 Reverse -208 -217 6.48957 0.227
NP_441469.1_8 Forward -233 -224 5.40793 0.272
NP_443064.1_6 Forward -218 -208 12.5669 0.0796
NP_443064.1_6 Reverse -209 -219 10.8217 0.13
NP_442578.1_7 Forward -217 -210 14.5921 0.026
NP_442578.1_7 Reverse -210 -217 14.5921 0.026
NP_440710.1_1 Forward -226 -208 -1.35749 0.179
NP_440220.1_4 Reverse -346 -365 1.86696 0.236
NP_440220.1_4 Reverse -130 -149 -3.24622 0.285
NP_441462.1_2 Reverse -209 -219 20.2362 0.000805
NP_441462.1_2 Forward -218 -208 11.5831 0.00406
NP_441462.1_5 Forward -32 -13 6.39097 0.225
NP_441621.1_7 Reverse -207 -221 -5.21195 0.248
NP_443062.1_1 Forward -218 -200 10.106 0.121
NP_442204.1_1 Forward -222 -211 9.40011 0.0786
NP_442204.1_5 Forward -162 -143 5.70265 0.154
NP_440516.1_8 Forward -218 -209 16.9127 0.00442
NP_440516.1_8 Reverse -209 -218 16.9127 0.00442
NP_440516.1_8 Reverse -2 -11 -0.491928 0.262
NP_441785.1_1 Forward -218 -204 14.9684 0.148
NP_442428.1_5 Forward -217 -210 15.8704 0.0124
NP_442428.1_5 Reverse -210 -217 15.8704 0.0124
NP_442120.1_10 Reverse -203 -222 -9.14533 0.242
NP_440673.1_3 Forward -216 -209 12.4288 0.0426
NP_440673.1_3 Reverse -211 -218 12.4288 0.0426
NP_441052.1_2 Forward -218 -208 19.9412 0.00106
NP_441052.1_2 Reverse -209 -219 10.4031 0.0285
NP_442219.1_9 Forward -217 -208 17.7976 0.00718
NP_442219.1_9 Reverse -210 -219 8.25953 0.0681
NP_440436.1_4 Forward -217 -208 17.2072 0.00233
NP_440436.1_4 Reverse -210 -219 9.24241 0.0871
NP_441884.1_9 Reverse -206 -225 -14.1602 0.138
NP_441719.1_4 Forward -217 -210 16.3621 0.0124
NP_441719.1_4 Reverse -210 -217 16.3621 0.0124
NP_441004.1_1 Forward -170 -151 -17.1101 0.289
NP_441004.1_1 Forward -164 -145 -17.7985 0.294
NP_442366.1_3 Forward -219 -201 2.28076 0.132
NP_442176.1_4 Forward -68 -49 9.14423 0.298
NP_442206.1_10 Reverse -209 -224 8.82968 0.167
NP_440328.1_4 Reverse -203 -222 -0.885524 0.292
NP_443054.1_2 Forward -22 -8 6.6861 0.185
NP_443054.1_2 Forward -220 -206 3.04785 0.24
NP_443054.1_2 Forward -353 -339 -0.295402 0.293
NP_440508.1_4 Reverse -22 -41 18.6823 0.204
NP_440864.1_9 Forward -273 -254 -6.1954 0.254
NP_441851.1_10 Reverse -208 -218 15.8113 0.00552
NP_441851.1_10 Forward -219 -209 8.53483 0.114
NP_442622.1_8 Forward -218 -200 -9.42063 0.145
NP_442856.1_7 Forward -227 -208 -6.09707 0.295
NP_442515.1_1 Reverse -208 -222 4.03116 0.109
NP_442515.1_1 Forward -219 -205 0.786239 0.18
NP_442515.1_1 Forward -116 -102 -1.47537 0.255
NP_441396.1_5 Forward -27 -18 7.76787 0.239
NP_440593.1_9 Forward -77 -63 8.45605 0.261
NP_440165.1_5 Forward -219 -200 -6.1954 0.231
NP_441349.1_10 Reverse -199 -218 16.1257 0.0114
NP_441409.1_6 Forward -224 -205 11.1109 0.024
NP_441394.1_2 Forward -33 -14 15.8307 0.265
NP_442314.1_1 Reverse -59 -77 -4.60241 0.268
NP_440432.1_9 Reverse -210 -225 -1.10174 0.167
NP_442843.1_1 Forward -384 -365 -8.06369 0.253
NP_442843.1_1 Forward -367 -348 -10.4236 0.278
NP_439960.1_4 Forward -333 -314 12.3883 0.288
NP_440474.1_8 Forward -217 -203 7.57046 0.204
NP_440474.1_8 Reverse -210 -224 4.12889 0.291
NP_442450.1_5 Forward -220 -210 9.41981 0.115
NP_442450.1_5 Reverse -207 -217 9.32148 0.115
NP_439950.1_1 Forward -146 -137 17.4043 0.145
NP_442006.1_2 Forward -326 -309 -7.82764 0.185
NP_442006.1_3 Forward -163 -145 -7.749 0.298
NP_443047.1_7 Reverse -210 -229 7.47261 0.22
NP_441570.1_1 Forward -218 -200 10.3439 0.00901
NP_441570.1_1 Reverse -209 -227 1.00246 0.034
NP_441570.1_1 Reverse -49 -67 -11.1906 0.189
NP_441078.1_4 Forward -218 -209 19.6659 0.0007
NP_441078.1_4 Reverse -209 -218 19.6659 0.0007
NP_440707.1_6 Forward -226 -207 12.29 0.224
NP_442443.1_1 Reverse -56 -75 -0.295539 0.222
NP_442443.1_1 Forward -151 -132 -3.3438 0.267
NP_440526.1_3 Forward -217 -206 10.1862 0.0646
NP_440526.1_3 Forward -72 -61 7.03967 0.168
NP_441432.1_8 Reverse -208 -217 16.8143 0.00595
NP_441432.1_8 Forward -219 -210 16.8143 0.00595
NP_441432.1_9 Reverse -109 -122 10.0527 0.256
NP_442320.1_8 Reverse -203 -217 11.701 0.0178
NP_441732.1_2 Forward -222 -206 1.5335 0.0368
NP_440760.1_1 Reverse -209 -228 -20.5517 0.223
NP_440760.1_1 Forward -218 -199 -21.0434 0.228
NP_442797.1_6 Reverse -145 -164 9.19461 0.246
NP_442797.1_7 Forward -225 -207 1.39578 0.259
NP_440199.1_10 Reverse -206 -216 16.7946 0.0381
NP_440913.1_1 Reverse -207 -225 8.27895 0.188
NP_441072.1_2 Forward -163 -144 17.404 0.0751
NP_442400.1_1 Forward -221 -202 -6.09707 0.299
NP_442400.1_10 Reverse -192 -205 12.7622 0.206
NP_442489.1_7 Forward -218 -209 20.1576 0.000695
NP_442489.1_7 Reverse -209 -218 20.1576 0.000695
NP_441830.1_2 Forward -376 -357 -5.99873 0.296
NP_440757.1_7 Forward -174 -156 0.21581 0.269
NP_442079.1_7 Reverse -210 -229 15.3391 0.0744
NP_440559.1_1 Forward -217 -208 17.4043 0.00658
NP_440559.1_1 Reverse -210 -219 8.65285 0.0586
NP_441659.2_8 Reverse -209 -219 20.9245 0.000805
NP_441659.2_8 Forward -218 -208 18.1713 0.00133
NP_440426.1_7 Forward -228 -209 3.53937 0.207
NP_441040.1_2 Forward -206 -187 -16.1268 0.294
NP_441800.1_3 Forward -37 -19 4.6407 0.289
NP_442346.1_5 Reverse -208 -218 16.6963 0.00248
NP_442346.1_5 Forward -219 -209 16.303 0.00248
NP_440545.1_3 Reverse -205 -222 2.79211 0.0941
NP_440545.1_3 Forward -353 -336 -7.04099 0.295
NP_441856.1_3 Reverse -206 -225 14.7491 0.0562
NP_441856.1_7 Forward -161 -142 16.9124 0.192
NP_441923.1_9 Reverse -157 -176 15.2408 0.102
NP_440459.1_2 Reverse -20 -37 8.00365 0.272
NP_441653.1_2 Forward -360 -341 11.4536 0.111
NP_440010.1_4 Reverse -199 -218 -3.34455 0.297
NP_442603.1_7 Reverse -209 -223 8.65209 0.168
NP_442603.1_7 Forward -64 -50 5.40719 0.296
NP_441047.1_2 Forward -366 -347 1.27776 0.239
NP_441833.1_4 Forward -217 -210 15.9687 0.0124
NP_441833.1_4 Reverse -210 -217 15.9687 0.0124
NP_442699.1_8 Reverse -181 -200 -11.4069 0.238
NP_442162.1_9 Forward -217 -210 16.2637 0.0124
NP_442162.1_9 Reverse -210 -217 16.2637 0.0124
NP_440671.1_4 Reverse -203 -217 16.6175 0.0276
NP_440671.1_5 Reverse -138 -152 13.5686 0.293
NP_440224.1_1 Forward -229 -210 2.55606 0.132
NP_442140.1_3 Forward -217 -207 4.40493 0.243
NP_441671.1_6 Forward -343 -324 5.80098 0.275
NP_440875.1_9 Reverse -220 -230 10.4161 0.216
NP_440875.1_9 Forward -35 -25 9.83208 0.233
NP_440875.1_9 Reverse -211 -221 8.27469 0.233
NP_440875.1_9 Forward -281 -271 7.496 0.262
NP_441813.1_5 Reverse -207 -217 15.9097 0.01
NP_441813.1_5 Forward -220 -210 15.9097 0.01
NP_440590.1_4 Forward -217 -204 -4.50394 0.262
NP_440567.1_1 Reverse -210 -224 12.7826 0.0216
NP_440567.1_1 Forward -217 -203 3.53951 0.141
NP_440567.1_1 Forward -282 -268 0.0979218 0.256
NP_442497.1_10 Reverse -210 -219 17.601 0.00813
NP_442497.1_10 Forward -217 -208 10.4228 0.0087
NP_440821.1_4 Reverse -207 -217 18.2696 0.00448
NP_440821.1_4 Forward -220 -210 11.0914 0.0146
NP_441239.1_9 Forward -220 -208 12.1337 0.0494
NP_441239.1_9 Reverse -141 -153 4.46387 0.253
NP_441239.1_9 Reverse -207 -219 4.36554 0.253
NP_441239.1_9 Reverse -62 -74 3.48056 0.285
NP_441009.1_7 Forward -219 -200 12.9791 0.191
NP_441892.1_1 Reverse -200 -217 0.137172 0.173
NP_442082.1_2 Reverse -197 -216 16.3215 0.0798
NP_440604.1_6 Reverse -209 -228 -2.55715 0.221
NP_442138.1_10 Forward -218 -199 15.7324 0.023
NP_441782.1_8 Forward -46 -28 12.9005 0.275
NP_440546.1_4 Reverse -209 -219 13.5365 0.0459
NP_440546.1_4 Forward -218 -208 10.046 0.109
NP_440546.1_4 Reverse -2 -12 7.91294 0.214
NP_440462.1_6 Forward -220 -210 16.893 0.00853
NP_440462.1_6 Reverse -207 -217 7.74818 0.0699
NP_440462.1_6 Reverse -272 -282 3.12662 0.26
NP_440462.1_6 Forward -60 -50 1.16001 0.298
NP_442340.1_3 Forward -331 -312 -9.83364 0.275
NP_442611.1_1 Reverse -209 -228 -2.75381 0.295
NP_440868.1_4 Forward -222 -210 15.1819 0.0164
NP_440868.1_4 Reverse -205 -217 5.93884 0.0879
NP_440868.1_4 Forward -32 -20 -0.452677 0.269
NP_441868.1_1 Forward -210 -191 11.6018 0.261
NP_441474.1_1 Forward -228 -209 0.392004 0.255
NP_441474.1_1 Forward -71 -52 -0.787962 0.255
NP_440638.2_2 Forward -234 -215 12.0942 0.239
NP_441084.1_6 Forward -220 -206 10.7985 0.228
NP_442039.1_4 Forward -217 -210 15.1821 0.0124
NP_442039.1_4 Reverse -210 -217 15.1821 0.0124
NP_442039.1_7 Forward -383 -373 14.9263 0.211
NP_442679.1_1 Reverse -188 -207 -5.99873 0.298
NP_441926.1_3 Forward -218 -202 16.5781 0.0428
NP_442696.1_2 Reverse -208 -226 15.5554 0.111
NP_442837.1_3 Forward -217 -210 15.7721 0.0124
NP_442837.1_3 Reverse -210 -217 15.7721 0.0124
NP_442837.1_3 Reverse -50 -57 6.52896 0.2
NP_441760.1_9 Forward -293 -274 15.5357 0.265
NP_442053.1_1 Forward -218 -209 18.3876 0.0007
NP_442053.1_1 Reverse -209 -218 18.3876 0.0007
NP_440505.1_3 Reverse -207 -217 16.303 0.00696
NP_440505.1_3 Forward -220 -210 15.123 0.014
NP_442360.1_5 Forward -325 -315 14.4347 0.228
NP_442360.1_5 Forward -262 -252 13.353 0.279
NP_442360.1_5 Forward -79 -69 12.9597 0.298
NP_441102.1_1 Reverse -210 -229 19.9606 0.0593
NP_441252.1_6 Reverse -186 -193 11.9372 0.25
NP_441203.1_1 Reverse -210 -229 -12.6852 0.144
NP_440914.1_1 Forward -218 -208 17.5935 0.000537
NP_440914.1_1 Reverse -209 -219 16.3248 0.00196
NP_440914.1_1 Reverse -33 -43 8.12715 0.207
NP_441011.1_8 Reverse -210 -219 16.6177 0.00602
NP_441011.1_8 Forward -217 -208 8.25953 0.144
NP_442101.1_10 Forward -226 -207 2.65439 0.0714
NP_442101.1_10 Reverse -201 -220 -13.3736 0.29
NP_442533.1_1 Forward -366 -347 -14.4552 0.243
NP_442533.1_1 Reverse -206 -225 -15.6352 0.257
NP_442533.1_6 Forward -218 -209 17.2076 0.00137
NP_442533.1_6 Reverse -209 -218 17.2076 0.00137
NP_442533.1_6 Forward -73 -64 4.32629 0.184
NP_442533.1_6 Forward -19 -10 3.14632 0.224
NP_442533.1_6 Reverse -143 -152 2.16301 0.27
NP_442541.1_10 Reverse -376 -390 1.76896 0.279
NP_442541.1_10 Forward -79 -65 1.08065 0.292
NP_440263.1_6 Reverse -198 -217 11.3075 0.272
NP_441187.1_5 Reverse -356 -373 18.2478 0.262
NP_442322.1_4 Forward -287 -270 -8.31994 0.286
NP_442322.1_4 Forward -286 -269 -10.1882 0.298
NP_441482.1_7 Forward -224 -210 -1.67204 0.0787
NP_441482.1_7 Reverse -203 -217 -10.8168 0.216
NP_439944.1_9 Forward -217 -207 19.0562 0.00329
NP_439944.1_9 Reverse -210 -220 17.6796 0.00347
NP_439944.1_9 Forward -331 -321 8.04317 0.121
NP_442269.1_10 Forward -379 -360 7.37428 0.194
NP_441527.1_4 Forward -122 -103 -8.16498 0.241
NP_440115.1_6 Forward -221 -211 7.45319 0.147
NP_440007.1_9 Forward -222 -208 8.75105 0.171
NP_440007.1_9 Reverse -205 -219 1.47456 0.285
NP_442728.1_7 Reverse -22 -36 11.2093 0.289
NP_441347.1_5 Reverse -27 -41 12.9786 0.238
NP_440608.1_6 Reverse -210 -229 4.71854 0.258
NP_441106.1_1 Forward -219 -210 18.486 0.0028
NP_441106.1_1 Reverse -208 -217 9.63616 0.0311
NP_439903.1_6 Forward -221 -202 10.4217 0.106
NP_439903.1_6 Reverse -206 -225 5.30853 0.184
NP_440797.1_2 Reverse -198 -217 17.0502 0.125
NP_441286.1_1 Reverse -208 -220 14.3953 0.00424
NP_441286.1_1 Forward -219 -207 11.937 0.0108
NP_442674.1_3 Forward -226 -207 5.89851 0.254
NP_440670.1_6 Reverse -155 -174 13.5691 0.292
NP_440670.1_8 Forward -218 -209 18.3876 0.000699
NP_440670.1_8 Reverse -209 -218 18.3876 0.000699
NP_440886.1_7 Forward -12 -2 13.2542 0.0802
NP_440886.1_7 Forward -219 -209 8.04271 0.0805
NP_440886.1_7 Reverse -208 -218 7.94438 0.0805
NP_440886.1_7 Reverse -142 -152 6.76441 0.114
NP_440828.1_1 Reverse -145 -164 0.293673 0.269
NP_442614.1_2 Forward -166 -152 12.8809 0.142
NP_442614.1_2 Reverse -209 -223 10.226 0.234
NP_441753.1_10 Forward -164 -145 0.884433 0.284
NP_442022.1_4 Reverse -58 -77 6.78429 0.27
NP_440907.2_8 Reverse -210 -220 9.51767 0.103
NP_441021.1_1 Reverse -377 -396 -7.96535 0.192
NP_440841.1_4 Reverse -321 -340 -5.70374 0.208
NP_442459.1_2 Forward -254 -235 10.9142 0.196
NP_441463.1_3 Reverse -199 -218 -1.7705 0.146
NP_441463.1_6 Reverse -207 -221 8.44524 0.25
NP_441463.1_6 Forward -220 -206 6.8991 0.267
NP_442842.1_4 Reverse -341 -360 1.17943 0.291
NP_441626.1_2 Forward -217 -210 15.7721 0.0124
NP_441626.1_2 Reverse -210 -217 15.7721 0.0124
NP_442365.1_7 Reverse -51 -70 1.67108 0.168
NP_442365.1_7 Forward -222 -203 -3.3438 0.217
NP_442615.1_1 Forward -227 -209 -1.84914 0.134
NP_440130.1_1 Forward -400 -381 12.7825 0.19
NP_441962.1_4 Forward -169 -150 -13.9635 0.28
NP_440387.1_1 Forward -218 -202 7.53169 0.0282
NP_440387.1_1 Reverse -209 -225 4.48343 0.0417
NP_441431.1_3 Forward -158 -139 2.45773 0.283
NP_441993.1_1 Forward -218 -199 4.57804 0.217
NP_440114.1_10 Forward -218 -204 10.1277 0.153
NP_440114.1_10 Reverse -209 -223 9.73436 0.164
NP_441510.2_7 Reverse -203 -217 11.7003 0.28
NP_442743.1_1 Reverse -349 -368 7.76679 0.264
NP_441311.1_2 Forward -224 -210 13.9619 0.229
NP_439910.1_2 Reverse -201 -218 -21.4956 0.183
NP_442867.1_8 Forward -270 -251 4.62101 0.278
NP_440457.1_1 Forward -222 -210 1.31728 0.241
NP_440457.1_1 Forward -25 -13 0.137309 0.25
NP_440457.1_1 Reverse -205 -217 0.0389777 0.25
NP_440798.1_6 Reverse -210 -223 1.9859 0.188
NP_441801.1_4 Forward -83 -73 3.12662 0.231
NP_442680.1_5 Reverse -188 -207 11.5997 0.124
NP_442680.1_5 Reverse -187 -206 0.951443 0.255
NP_440142.1_9 Reverse -112 -126 13.4703 0.284
NP_440054.1_4 Forward -124 -105 9.83255 0.289
NP_441332.1_6 Reverse -142 -152 11.9372 0.239
NP_441436.1_2 Forward -162 -143 4.62101 0.196
NP_440473.1_9 Reverse -198 -217 1.17943 0.112
NP_440473.1_9 Forward -163 -144 0.786102 0.123
NP_442509.1_9 Forward -218 -208 8.14104 0.192
NP_442509.1_9 Reverse -209 -219 8.04271 0.192
NP_440554.1_4 Reverse -210 -220 16.1063 0.0189
NP_440554.1_4 Forward -217 -207 7.05986 0.106
NP_441885.1_5 Forward -218 -208 20.9245 0.000538
NP_441885.1_5 Reverse -209 -219 11.3864 0.00668
NP_440649.2_8 Forward -25 -11 10.816 0.265
NP_442703.1_8 Reverse -237 -255 10.6381 0.272
NP_442341.1_7 Reverse -208 -222 4.81781 0.177
NP_442341.1_7 Reverse -142 -156 1.27789 0.295
NP_442341.1_9 Forward -220 -206 16.4202 0.0364
NP_442341.1_9 Reverse -207 -221 6.68548 0.217
NP_441756.1_5 Forward -275 -256 4.32602 0.199
NP_441173.1_9 Reverse -251 -259 11.3271 0.226
NP_442395.2_3 Forward -71 -53 17.5221 0.238
NP_440423.1_6 Reverse -201 -220 -14.8485 0.229
NP_440423.1_6 Forward -160 -141 -21.1417 0.284
NP_443000.1_7 Forward -220 -210 17.4829 0.00719
NP_443000.1_7 Reverse -207 -217 17.0896 0.00865
NP_440507.2_3 Reverse -200 -219 8.84842 0.241
NP_441842.1_10 Reverse -267 -281 7.76774 0.245
NP_441842.1_10 Forward -225 -211 6.88276 0.271
NP_440275.1_3 Forward -220 -210 9.12481 0.055
NP_440275.1_3 Reverse -207 -217 8.1415 0.0602
NP_440275.1_3 Forward -351 -341 5.97822 0.129
NP_440091.1_1 Reverse -205 -217 16.4603 0.0153
NP_441397.1_8 Forward -57 -44 12.3802 0.267
NP_441902.1_3 Forward -258 -248 15.4111 0.201
NP_440679.1_10 Reverse -211 -230 -4.13045 0.143
NP_440679.1_10 Forward -159 -140 -21.83 0.3
NP_443010.1_10 Forward -221 -204 4.5102 0.229
NP_439962.1_4 Reverse -10 -29 -5.99873 0.28
NP_439962.1_4 Forward -273 -254 -8.55534 0.296
NP_442591.1_5 Reverse -206 -225 13.1758 0.279
NP_440149.1_8 Reverse -209 -228 1.76941 0.119
NP_441105.1_3 Reverse -198 -217 -4.91709 0.209
NP_441105.1_3 Forward -343 -324 -7.96535 0.263
NP_440216.1_1 Reverse -209 -223 7.27608 0.00942
NP_440216.1_1 Forward -218 -204 -1.8687 0.0412
NP_440172.1_1 Reverse -209 -219 17.5813 0.00421
NP_440172.1_1 Forward -218 -208 15.0247 0.00945
NP_440249.1_2 Forward -54 -44 14.8275 0.273
NP_442015.1_10 Forward -222 -209 1.39592 0.204
NP_442015.1_10 Reverse -205 -218 0.60927 0.221
NP_441226.1_7 Forward -217 -210 14.4934 0.0123
NP_441226.1_7 Reverse -210 -217 14.4934 0.0123
NP_441226.1_7 Forward -63 -56 6.82361 0.246
NP_441757.1_3 Reverse -208 -227 10.1275 0.0935
NP_441111.1_7 Forward -217 -209 18.7023 0.00294
NP_441111.1_7 Reverse -210 -218 18.7023 0.00294
NP_442379.1_10 Reverse -202 -219 3.87375 0.162
NP_442379.1_10 Forward -225 -208 -2.41943 0.23
NP_442379.1_10 Reverse -333 -350 -4.09106 0.281
NP_441766.1_2 Forward -218 -209 17.5026 0.00297
NP_441766.1_2 Reverse -209 -218 17.5026 0.00297
NP_442417.1_5 Reverse -209 -223 7.27608 0.194
NP_440416.1_1 Forward -218 -199 -5.40875 0.154
NP_440416.1_9 Reverse -143 -162 -17.2085 0.234
NP_440416.1_9 Forward -80 -61 -19.8634 0.279
NP_443052.1_9 Reverse -304 -323 2.3594 0.172
NP_443052.1_9 Reverse -153 -172 -5.70374 0.273
NP_442403.1_8 Forward -216 -197 2.75272 0.226
NP_440591.1_9 Reverse -202 -220 10.9339 0.11
NP_442154.1_1 Forward -163 -145 -16.6971 0.244
NP_442154.1_1 Forward -393 -375 -17.0904 0.249
NP_440261.1_5 Reverse -210 -223 8.27909 0.0273
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCGGGCATTCAAGCTTGCACTGGCGGCATTTTAGGCATGGGAGAAACCTGGGAAGACCGCATTGATCTAGCTTTGGCTCTGCGGGAACTGGAAGTGGAATCCGTGCCCCTGAATCTACTCAATCCCCGCCCCGGTACTCCTTTGGGGGAACAACAAAAGTTAAATCCCTACGATGCCCTCAAGGCGATCGCCATTTTCCGGTTTATTTTGCCCCAACAAATTATTCGCTATGCTGGGGGCCGGGAAGCGGTGATGGGAGAATTACAGGATTTAGGGCTAAAAGCGGGCATTAACGCTATGCTAGTGGGCCATTATTTAACTACCCTGGGCCAGCCTCCCGAACGGGATCAAAAATTATTGGCATCCCTTGGCCTCGAAGGGGGAGAGGCCCCTATCCCCG

CDS

GTGAATACCAATCCTGAACCTGACCTGGACCTTGTGACGGAGGAGATTGAACTCCCCAAGCCTTCCCTGCTAGCAGAAGTCCTGTTGGCGATCGCCGGACTGCTGTTGACTGTTTTCTGTACGTTCGTGCAGGTATTTGCCACCAATCCCCCTTGGCAATGGTGGGAGGATGGCATTTATTCCAATCCCCTGGGCACAACCTACCAGGTGGGGGCCGTATTGCTCACCGCCTGTTTGGGAGGGGCTAGAGCCGGGGCGATCGCCCAGTTAGGTTACATTATGCTGGGCCTAGCTTGGTTGCCAATTTTTGCCCATGGCGGCGGCTGGGACTACTGGCAACAGCCCACCTTTGGCTACCTATTAGGTTTCATTCCGGGAGCTTGGGTCTGTGGTTGGTTAGCCTACCGTTCCCAAACCAAAATTGAAACCCTGGCCCTAGGTTGCCTAGTCGGTTTGGGAGTCATCCACGGTGCGGGTATAGTTTATCTAGGCATGATGGCTGTGTTGAAACTGGGTAATCCCCCCATTCTGTCCCTGGCAGACCTGCCCCAAGCTTTGCTGACTTTTTCCCTCATGGCATTGCCCGGCCAGATTATTCTGGTCTGTCTGACTGCTGTGCTGGCCTACTTTTTGCGGAGAATTTTATTCTATTGA

Protein

MNTNPEPDLDLVTEEIELPKPSLLAEVLLAIAGLLLTVFCTFVQVFATNPPWQWWEDGIYSNPLGTTYQVGAVLLTACLGGARAGAIAQLGYIMLGLAWLPIFAHGGGWDYWQQPTFGYLLGFIPGAWVCGWLAYRSQTKIETLALGCLVGLGVIHGAGIVYLGMMAVLKLGNPPILSLADLPQALLTFSLMALPGQIILVCLTAVLAYFLRRILFY