Your browser is old and dusty. Try Google Chrome!

Details for slr1349

ORF slr1349
Accession NP_441488.1
Symbol
Category Glycolysis
Definition glucose-6-phosphate isomerase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -339 -353 11.7993 0.0505
NP_441061.1_2 Reverse -121 -135 5.1128 0.142
NP_440557.1_1 Reverse -121 -140 1.76941 0.249
NP_440795.1_7 Forward -346 -339 14.6904 0.0123
NP_440795.1_7 Reverse -339 -346 14.6904 0.0123
NP_440795.1_7 Forward -128 -121 14.6904 0.0123
NP_440795.1_7 Reverse -121 -128 14.6904 0.0123
NP_441418.1_6 Reverse -120 -139 -20.8467 0.129
NP_441418.1_6 Reverse -338 -357 -28.3199 0.204
NP_441418.1_6 Forward -141 -122 -29.6965 0.234
NP_441418.1_6 Forward -359 -340 -29.9915 0.249
NP_442291.1_5 Forward -130 -114 9.69497 0.0492
NP_441453.1_4 Reverse -120 -128 16.539 0.00633
NP_441453.1_4 Forward -347 -339 16.539 0.00633
NP_441453.1_4 Forward -129 -121 16.539 0.00633
NP_441453.1_4 Reverse -338 -346 7.8859 0.0536
NP_442151.1_6 Reverse -338 -352 16.8142 0.0138
NP_442151.1_6 Reverse -120 -134 16.8142 0.0138
NP_442151.1_6 Forward -347 -333 7.76774 0.19
NP_442151.1_6 Forward -129 -115 5.89945 0.256
NP_441818.1_1 Forward -128 -117 9.59626 0.232
NP_441818.1_9 Forward -155 -136 -9.73531 0.291
NP_440226.1_1 Forward -129 -110 13.5691 0.0352
NP_440226.1_1 Forward -347 -328 2.65439 0.256
NP_440226.1_1 Reverse -120 -139 2.55606 0.259
NP_442169.1_1 Forward -153 -134 3.73603 0.26
NP_442623.1_3 Reverse -339 -358 0.491109 0.0569
NP_442744.1_9 Reverse -114 -128 14.3866 0.266
NP_442173.1_1 Forward -128 -120 15.4574 0.00633
NP_442173.1_1 Reverse -339 -347 15.4574 0.00633
NP_442173.1_1 Reverse -121 -129 15.4574 0.00633
NP_442173.1_1 Forward -346 -338 8.27922 0.101
NP_442752.1_4 Forward -347 -340 13.8055 0.0199
NP_442752.1_4 Forward -129 -122 13.8055 0.0199
NP_442752.1_4 Reverse -120 -127 13.8055 0.0199
NP_443027.1_4 Reverse -118 -128 16.2046 0.0437
NP_441812.1_3 Forward -130 -116 20.8458 0.00667
NP_441812.1_3 Forward -114 -100 13.9626 0.146
NP_441812.1_3 Reverse -40 -54 11.5043 0.21
NP_442975.1_10 Reverse -116 -130 21.3367 0.00107
NP_442975.1_10 Reverse -334 -348 9.93039 0.0607
NP_442975.1_10 Forward -203 -189 8.16044 0.105
NP_442975.1_10 Forward -133 -119 2.65393 0.269
NP_441675.1_4 Reverse -3 -22 5.70265 0.238
NP_440784.1_7 Forward -346 -339 15.9687 0.0123
NP_440784.1_7 Reverse -339 -346 15.9687 0.0123
NP_440784.1_7 Forward -128 -121 15.9687 0.0123
NP_440784.1_7 Reverse -121 -128 15.9687 0.0123
NP_442909.1_7 Reverse -121 -135 13.6669 0.12
NP_440061.1_9 Reverse -118 -132 9.24208 0.149
NP_441054.1_1 Forward -354 -340 18.3875 0.129
NP_442062.1_8 Reverse -120 -130 17.3846 0.00193
NP_442062.1_8 Forward -129 -119 10.3048 0.0493
NP_442062.1_8 Forward -347 -337 9.12481 0.0676
NP_442062.1_8 Reverse -338 -348 7.84651 0.0871
NP_441859.1_3 Forward -348 -329 2.06362 0.267
NP_440304.1_4 Reverse -118 -128 19.9412 0.00364
NP_440304.1_4 Forward -319 -309 7.55152 0.109
NP_440304.1_4 Forward -349 -339 1.84832 0.299
NP_440304.1_4 Forward -131 -121 1.84832 0.299
NP_442242.1_4 Forward -346 -339 14.3954 0.0124
NP_442242.1_4 Reverse -339 -346 14.3954 0.0124
NP_442242.1_4 Forward -128 -121 14.3954 0.0124
NP_442242.1_4 Reverse -121 -128 14.3954 0.0124
NP_440044.1_8 Forward -128 -109 8.84924 0.0723
NP_440044.1_8 Reverse -339 -358 0.884433 0.189
NP_440044.1_8 Reverse -121 -140 -4.03212 0.298
NP_439918.1_2 Forward -283 -264 14.0608 0.0923
NP_441935.1_1 Forward -369 -350 11.5042 0.211
NP_441208.1_9 Forward -132 -118 16.2242 0.0671
NP_441208.1_9 Reverse -27 -41 7.07942 0.227
NP_440365.1_1 Reverse -73 -92 14.2756 0.256
NP_441594.1_6 Forward -356 -337 10.2259 0.133
NP_441594.1_6 Reverse -123 -142 3.24438 0.235
NP_441594.1_6 Reverse -138 -157 0.0977854 0.293
NP_440370.1_10 Forward -138 -119 10.2259 0.211
NP_442110.1_7 Reverse -120 -134 10.3243 0.0684
NP_442110.1_7 Reverse -338 -352 2.65453 0.222
NP_442110.1_7 Forward -129 -115 1.96621 0.222
NP_442726.1_1 Forward -352 -333 12.1925 0.179
NP_441925.1_4 Reverse -133 -152 -6.49113 0.185
NP_441925.1_4 Reverse -265 -284 -17.6025 0.297
NP_440856.1_1 Forward -357 -338 -3.83545 0.231
NP_441083.1_5 Reverse -120 -130 20.3345 0.00053
NP_441083.1_5 Reverse -338 -348 19.0562 0.00147
NP_441083.1_5 Forward -129 -119 11.2881 0.0159
NP_441083.1_5 Forward -347 -337 10.5998 0.0192
NP_442827.1_8 Forward -137 -118 3.04693 0.152
NP_441434.1_1 Reverse -322 -336 9.17885 0.246
NP_441434.1_1 Reverse -323 -337 7.55548 0.274
NP_441738.1_2 Reverse -340 -347 15.28 0.0102
NP_441738.1_2 Forward -127 -120 15.28 0.0102
NP_441738.1_2 Reverse -122 -129 15.28 0.0102
NP_441738.1_4 Forward -357 -338 15.5357 0.0804
NP_441558.1_5 Reverse -118 -137 24.0905 0.00172
NP_440209.1_1 Reverse -120 -128 18.1123 0.00295
NP_440209.1_1 Forward -347 -339 18.1123 0.00295
NP_440209.1_1 Forward -129 -121 18.1123 0.00295
NP_440209.1_1 Reverse -338 -346 15.1624 0.00583
NP_442889.1_8 Reverse -117 -131 19.0751 0.0084
NP_441713.1_1 Forward -135 -116 -8.26035 0.147
NP_440178.1_7 Forward -130 -111 4.12936 0.0199
NP_440178.1_7 Reverse -119 -138 -20.945 0.204
NP_440053.1_10 Forward -365 -346 23.6972 0.00957
NP_440659.1_9 Forward -356 -337 13.7658 0.161
NP_440659.1_9 Reverse -181 -200 9.14423 0.28
NP_442570.1_3 Forward -157 -138 -3.73712 0.225
NP_442570.1_3 Forward -158 -139 -8.65367 0.291
NP_442570.1_3 Forward -286 -267 -8.85033 0.294
NP_441716.1_1 Reverse -120 -134 3.8345 0.259
NP_442111.1_4 Reverse -337 -351 13.0776 0.0399
NP_442111.1_4 Reverse -119 -133 9.34103 0.0609
NP_442111.1_4 Forward -130 -116 1.96621 0.292
NP_441624.1_7 Reverse -210 -224 7.37441 0.257
NP_441163.1_1 Forward -40 -23 4.36469 0.289
NP_441163.1_9 Forward -293 -274 14.3558 0.236
NP_440343.1_9 Forward -159 -140 7.47261 0.279
NP_440906.1_5 Forward -346 -339 15.8704 0.0124
NP_440906.1_5 Reverse -339 -346 15.8704 0.0124
NP_440906.1_5 Forward -128 -121 15.8704 0.0124
NP_440906.1_5 Reverse -121 -128 15.8704 0.0124
NP_440012.1_6 Forward -140 -121 8.84924 0.247
NP_442801.1_5 Forward -341 -324 16.656 0.116
NP_440747.1_10 Forward -132 -120 24.7201 0.00036
NP_440747.1_10 Forward -350 -338 14.9853 0.00221
NP_440747.1_10 Reverse -335 -347 5.05386 0.019
NP_440747.1_10 Reverse -117 -129 -1.92764 0.0192
NP_440747.1_10 Reverse -38 -50 -12.2524 0.254
NP_441847.1_3 Reverse -3 -21 28.8301 0.000293
NP_442973.1_5 Reverse -111 -130 13.3725 0.169
NP_441486.1_1 Reverse -117 -131 14.5526 0.00628
NP_441486.1_1 Forward -350 -336 7.17775 0.0344
NP_441486.1_1 Reverse -335 -349 6.09611 0.0344
NP_441486.1_1 Forward -132 -118 4.22782 0.0475
NP_442634.1_4 Reverse -118 -132 -1.47537 0.149
NP_442634.1_4 Forward -131 -117 -2.06536 0.149
NP_440403.1_10 Forward -356 -337 5.80098 0.238
NP_441014.1_10 Forward -130 -111 5.60352 0.182
NP_442848.1_1 Forward -135 -121 7.86607 0.0791
NP_442848.1_1 Reverse -114 -128 6.6861 0.0791
NP_442848.1_1 Forward -353 -339 -1.67204 0.263
NP_442848.1_4 Forward -151 -137 7.47274 0.282
NP_442848.1_5 Reverse -140 -158 13.4905 0.232
NP_442848.1_5 Reverse -256 -274 -3.32411 0.291
NP_442848.1_9 Reverse -132 -151 -1.47551 0.291
NP_441012.1_4 Forward -43 -30 6.50913 0.278
NP_443018.1_3 Forward -346 -339 14.8871 0.0123
NP_443018.1_3 Reverse -339 -346 14.8871 0.0123
NP_443018.1_3 Forward -128 -121 14.8871 0.0123
NP_443018.1_3 Reverse -121 -128 14.8871 0.0123
NP_441316.1_7 Reverse -118 -133 2.43817 0.154
NP_441634.1_8 Forward -131 -117 -4.7203 0.295
NP_440376.1_1 Forward -129 -120 19.4693 0.000692
NP_440376.1_1 Reverse -120 -129 19.4693 0.000692
NP_440376.1_1 Forward -347 -338 9.73449 0.0365
NP_440376.1_1 Reverse -338 -347 9.63616 0.0385
NP_440376.1_1 Reverse -30 -39 1.67135 0.243
NP_441588.1_4 Reverse -340 -350 9.02648 0.14
NP_441588.1_4 Reverse -122 -132 9.02648 0.14
NP_441588.1_4 Forward -345 -335 7.74818 0.17
NP_441588.1_4 Forward -127 -117 6.66654 0.185
NP_442687.1_7 Reverse -119 -129 9.02648 0.0994
NP_442687.1_7 Forward -130 -120 8.92815 0.0994
NP_442687.1_7 Reverse -337 -347 6.17489 0.178
NP_441077.1_2 Reverse -51 -70 4.15348 0.228
NP_442485.1_3 Forward -295 -276 7.47261 0.145
NP_442485.1_3 Forward -146 -127 6.39097 0.163
NP_441846.1_10 Forward -283 -264 -11.0136 0.19
NP_441846.1_10 Forward -277 -258 -22.8133 0.266
NP_440042.1_1 Forward -95 -76 7.37428 0.253
NP_440042.1_2 Reverse -328 -347 -2.65548 0.261
NP_441422.1_7 Reverse -118 -135 -0.747806 0.168
NP_441422.1_7 Reverse -336 -353 -9.00761 0.289
NP_442296.1_9 Reverse -24 -43 -5.50708 0.286
NP_442658.1_1 Reverse -118 -128 13.0576 0.04
NP_442658.1_1 Forward -349 -339 6.76441 0.214
NP_442658.1_1 Forward -131 -121 6.76441 0.214
NP_440141.1_4 Reverse -341 -360 -12.1936 0.299
NP_441855.2_4 Forward -355 -336 9.61947 0.275
NP_442782.1_2 Forward -141 -127 6.3911 0.226
NP_442782.1_2 Reverse -179 -193 4.71948 0.25
NP_442782.1_2 Reverse -190 -204 2.45787 0.275
NP_442782.1_2 Forward -155 -141 2.45787 0.275
NP_442782.1_7 Forward -355 -336 2.3594 0.193
NP_442205.1_9 Reverse -114 -130 4.28677 0.156
NP_440656.1_8 Reverse -109 -128 0.884433 0.124
NP_441414.1_9 Forward -347 -328 15.6341 0.0106
NP_441414.1_9 Reverse -120 -139 -10.522 0.287
NP_440800.1_7 Reverse -151 -165 11.0127 0.285
NP_441256.1_10 Forward -374 -356 25.3885 0.0031
NP_442937.1_5 Forward -352 -333 13.4708 0.0906
NP_442937.1_5 Reverse -333 -352 11.5042 0.136
NP_442937.1_5 Forward -134 -115 10.8159 0.152
NP_442321.1_4 Forward -175 -156 -9.047 0.293
NP_441317.1_4 Forward -92 -78 9.46396 0.294
NP_441958.1_5 Reverse -119 -129 21.2195 0.000805
NP_441958.1_5 Forward -130 -120 12.2714 0.00183
NP_441958.1_5 Forward -348 -338 3.12662 0.0364
NP_441958.1_5 Reverse -337 -347 2.43831 0.0422
NP_441127.1_1 Reverse -344 -358 8.06273 0.3
NP_442486.1_4 Reverse -122 -141 12.2908 0.167
NP_440203.1_5 Reverse -341 -351 14.2375 0.0886
NP_440203.1_5 Reverse -123 -133 14.2375 0.0886
NP_440995.1_8 Reverse -328 -347 2.94938 0.264
NP_439990.1_5 Forward -352 -339 11.3273 0.128
NP_439990.1_5 Forward -134 -121 11.3273 0.128
NP_442376.1_5 Forward -386 -372 14.0609 0.145
NP_442911.1_2 Forward -139 -120 15.0441 0.0111
NP_442911.1_2 Reverse -328 -347 -7.27704 0.205
NP_442911.1_2 Reverse -110 -129 -9.63698 0.26
NP_442911.1_2 Forward -357 -338 -10.7186 0.286
NP_441580.1_6 Reverse -264 -283 -6.68705 0.235
NP_440153.1_5 Forward -128 -114 8.06273 0.149
NP_442064.1_1 Forward -134 -115 -11.7019 0.262
NP_443055.1_3 Reverse -111 -130 18.6664 0.0456
NP_443055.1_6 Reverse -330 -348 -0.276578 0.256
NP_440993.1_2 Reverse -115 -131 5.86006 0.234
NP_440993.1_4 Reverse -338 -355 3.0871 0.294
NP_440602.1_8 Forward -129 -115 13.3726 0.174
NP_441348.1_3 Forward -284 -265 7.37428 0.256
NP_441099.1_5 Forward -309 -290 -0.787193 0.0989
NP_441099.1_5 Forward -357 -338 -1.7705 0.113
NP_441099.1_5 Forward -139 -120 -7.96535 0.183
NP_441294.1_7 Reverse -116 -130 14.914 0.033
NP_441294.1_7 Reverse -334 -348 8.48272 0.298
NP_441646.1_1 Forward -136 -117 14.2574 0.0811
NP_441646.1_1 Reverse -34 -53 -0.0988766 0.259
NP_442438.1_10 Forward -134 -120 10.0294 0.0581
NP_442438.1_10 Forward -352 -338 0.294584 0.232
NP_442431.1_10 Forward -158 -140 -0.374176 0.287
NP_441752.1_6 Reverse -139 -158 4.52268 0.217
NP_441000.1_5 Forward -197 -178 15.0432 0.114
NP_441000.1_6 Forward -130 -116 -4.81863 0.252
NP_442771.1_1 Forward -400 -382 -9.71562 0.231
NP_440484.1_3 Forward -349 -335 8.45605 0.298
NP_440147.1_4 Forward -131 -118 10.7374 0.0355
NP_440147.1_4 Reverse -118 -131 3.75586 0.181
NP_440147.1_4 Forward -349 -336 2.08423 0.21
NP_440147.1_4 Reverse -336 -349 1.9859 0.213
NP_441175.1_7 Reverse -120 -139 16.5191 0.0719
NP_441175.1_7 Reverse -338 -357 6.98095 0.241
NP_441550.1_8 Forward -349 -339 14.6309 0.0132
NP_441550.1_8 Forward -131 -121 14.6309 0.0132
NP_441550.1_8 Reverse -118 -128 13.0576 0.0273
NP_441550.1_8 Reverse -336 -346 10.9926 0.0578
NP_441916.1_7 Forward -129 -119 18.9579 0.00144
NP_441916.1_7 Reverse -120 -130 10.3048 0.0261
NP_441916.1_7 Reverse -338 -348 2.04498 0.265
NP_441916.1_7 Forward -347 -337 0.963343 0.297
NP_441916.1_10 Reverse -112 -131 3.24438 0.236
NP_440206.1_9 Reverse -163 -182 17.699 0.104
NP_441041.1_4 Reverse -120 -139 7.66927 0.0385
NP_441041.1_4 Reverse -338 -357 -1.96717 0.106
NP_441041.1_4 Forward -359 -340 -12.3902 0.265
NP_441041.1_4 Forward -141 -122 -12.4886 0.266
NP_441041.1_7 Reverse -117 -129 9.65268 0.108
NP_441041.1_7 Forward -132 -120 8.58373 0.133
NP_441041.1_7 Forward -350 -338 7.61196 0.162
NP_441547.1_2 Forward -358 -340 7.39397 0.215
NP_442004.1_6 Reverse -338 -352 17.1092 0.0577
NP_442004.1_6 Reverse -120 -134 15.5359 0.0577
NP_440703.1_3 Forward -31 -12 15.5907 0.297
NP_441725.1_4 Forward -352 -338 4.42388 0.278
NP_441725.1_4 Forward -134 -120 2.8506 0.279
NP_441725.1_5 Forward -128 -118 11.1898 0.0247
NP_441725.1_5 Reverse -339 -349 2.04498 0.115
NP_441725.1_5 Reverse -121 -131 2.04498 0.115
NP_441725.1_5 Forward -346 -336 0.0783647 0.215
NP_439966.1_7 Reverse -118 -128 14.8275 0.0177
NP_439966.1_7 Reverse -336 -346 7.94438 0.145
NP_439966.1_7 Forward -349 -339 7.25606 0.15
NP_439966.1_7 Forward -131 -121 7.25606 0.15
NP_439966.1_7 Reverse -273 -283 4.60114 0.265
NP_442941.1_3 Forward -128 -118 19.9412 0.00262
NP_442941.1_3 Reverse -339 -349 11.0914 0.0116
NP_442941.1_3 Reverse -121 -131 11.0914 0.0116
NP_442941.1_3 Forward -346 -336 1.65166 0.147
NP_440289.1_2 Reverse -117 -130 13.3923 0.0132
NP_440260.1_8 Forward -356 -338 3.95239 0.158
NP_440260.1_8 Forward -138 -120 -4.70074 0.273
NP_441678.1_9 Forward -141 -122 10.4225 0.17
NP_441678.1_9 Forward -278 -259 -1.67217 0.257
NP_442281.1_1 Reverse -115 -129 17.8952 0.00513
NP_442281.1_1 Forward -134 -120 16.3219 0.00832
NP_442281.1_1 Forward -352 -338 7.07881 0.108
NP_442281.1_1 Reverse -333 -347 1.5723 0.296
NP_441334.1_7 Reverse -336 -355 -20.3551 0.275
NP_440177.1_9 Reverse -330 -349 12.7825 0.229
NP_442256.1_2 Reverse -336 -354 1.39578 0.107
NP_442256.1_2 Forward -349 -331 -2.93078 0.214
NP_441556.1_10 Forward -134 -120 14.2126 0.178
NP_441556.1_10 Forward -352 -338 10.4165 0.27
NP_441644.1_6 Forward -129 -119 19.0557 0.000803
NP_441644.1_6 Reverse -120 -130 17.3841 0.00127
NP_441644.1_6 Reverse -338 -348 14.7292 0.0105
NP_441644.1_6 Forward -347 -337 13.6475 0.0181
NP_443049.1_6 Forward -348 -338 13.8856 0.139
NP_442215.1_2 Reverse -336 -352 6.05672 0.074
NP_442215.1_2 Forward -131 -115 -2.10475 0.192
NP_442215.1_2 Reverse -118 -134 -2.10475 0.192
NP_442247.1_8 Forward -349 -335 7.76774 0.294
NP_440253.1_2 Forward -129 -111 4.05072 0.107
NP_440253.1_2 Forward -347 -329 0.412472 0.188
NP_440253.1_2 Reverse -338 -356 -1.94747 0.254
NP_440929.1_8 Forward -129 -120 19.2726 0.000701
NP_440929.1_8 Reverse -120 -129 19.2726 0.000701
NP_440929.1_8 Forward -347 -338 9.93116 0.0249
NP_440929.1_8 Reverse -338 -347 9.83282 0.0254
NP_440929.1_8 Forward -50 -41 2.94966 0.246
NP_442933.1_10 Forward -129 -120 17.601 0.00325
NP_442933.1_10 Reverse -120 -129 17.601 0.00325
NP_442933.1_10 Forward -347 -338 9.04618 0.063
NP_442933.1_10 Reverse -338 -347 8.94785 0.0643
NP_441751.2_8 Forward -128 -114 5.50613 0.0423
NP_441751.2_8 Reverse -339 -353 -2.16369 0.132
NP_441751.2_8 Reverse -121 -135 -2.26202 0.132
NP_442554.1_8 Forward -128 -118 16.9913 0.0065
NP_442554.1_8 Reverse -339 -349 15.3197 0.00882
NP_442554.1_8 Reverse -121 -131 15.3197 0.00882
NP_442554.1_8 Forward -346 -336 5.78156 0.138
NP_441762.1_7 Forward -348 -336 2.49725 0.0676
NP_441762.1_7 Reverse -119 -131 0.530633 0.0747
NP_441762.1_7 Forward -130 -118 -6.94252 0.284
NP_441762.1_7 Reverse -337 -349 -7.04085 0.285
NP_442142.1_4 Reverse -117 -130 13.5883 0.0348
NP_442142.1_4 Forward -132 -119 12.8017 0.0409
NP_442142.1_4 Forward -350 -337 8.96682 0.106
NP_442142.1_4 Reverse -335 -348 5.62358 0.187
NP_442292.1_1 Reverse -339 -348 18.486 0.00229
NP_442292.1_1 Reverse -121 -130 18.486 0.00229
NP_442292.1_1 Forward -128 -119 17.5026 0.00435
NP_442292.1_1 Forward -346 -337 9.63616 0.0183
NP_440895.1_6 Forward -135 -122 10.1474 0.202
NP_440895.1_6 Forward -353 -340 10.049 0.202
NP_442381.1_8 Forward -350 -331 -14.3569 0.28
NP_441711.1_4 Reverse -111 -130 5.60432 0.173
NP_443009.1_5 Forward -130 -119 14.5128 0.02
NP_443009.1_5 Reverse -119 -130 10.1862 0.0792
NP_441715.1_4 Forward -128 -118 14.238 0.0295
NP_441715.1_4 Reverse -339 -349 7.94484 0.107
NP_441715.1_4 Reverse -121 -131 7.94484 0.107
NP_441715.1_4 Reverse -355 -365 5.78156 0.18
NP_441088.1_7 Forward -325 -306 21.4356 0.0673
NP_441448.1_1 Forward -201 -182 11.0125 0.188
NP_441198.1_8 Reverse -118 -128 13.2713 0.108
NP_440379.1_5 Forward -144 -125 -9.34199 0.263
NP_440464.1_10 Reverse -339 -349 13.0082 0.169
NP_440464.1_10 Reverse -121 -131 13.0082 0.169
NP_441468.1_1 Forward -346 -339 15.8704 0.0124
NP_441468.1_1 Reverse -339 -346 15.8704 0.0124
NP_441468.1_1 Forward -128 -121 15.8704 0.0124
NP_441468.1_1 Reverse -121 -128 15.8704 0.0124
NP_442099.1_1 Reverse -339 -357 15.5554 0.274
NP_441020.2_6 Forward -131 -114 9.08529 0.18
NP_441020.2_6 Reverse -118 -135 9.08529 0.18
NP_441020.2_6 Reverse -336 -353 7.31533 0.235
NP_441015.1_9 Reverse -155 -168 16.6366 0.246
NP_441015.1_10 Forward -352 -333 -5.21209 0.219
NP_441015.1_10 Reverse -339 -358 -9.63698 0.282
NP_441673.1_1 Forward -129 -120 20.8459 0.000698
NP_441673.1_1 Reverse -120 -129 20.8459 0.000698
NP_441673.1_1 Forward -347 -338 11.1111 0.0121
NP_441673.1_1 Reverse -338 -347 11.0128 0.018
NP_441826.1_2 Forward -135 -121 5.01447 0.0978
NP_441826.1_2 Reverse -114 -128 2.06454 0.136
NP_441826.1_2 Forward -353 -339 -2.55701 0.273
NP_441330.1_1 Reverse -115 -134 -3.14714 0.0791
NP_441330.1_1 Reverse -333 -352 -12.8819 0.183
NP_442490.1_9 Reverse -338 -357 -6.39206 0.273
NP_442868.1_6 Forward -349 -339 9.81313 0.038
NP_442868.1_6 Forward -131 -121 9.81313 0.038
NP_442868.1_6 Reverse -336 -346 9.51814 0.0447
NP_442868.1_6 Reverse -118 -128 1.06167 0.205
NP_442719.1_2 Reverse -216 -234 0.313405 0.162
NP_441056.1_1 Reverse -338 -357 20.4523 0.0151
NP_441056.1_1 Reverse -120 -139 -4.22878 0.249
NP_441056.1_1 Forward -50 -31 -8.35868 0.282
NP_441612.1_2 Reverse -120 -130 8.54929 0.21
NP_442361.1_3 Forward -353 -340 16.7355 0.0568
NP_442361.1_3 Forward -135 -122 13.0973 0.159
NP_442427.1_3 Forward -134 -116 4.6407 0.171
NP_442427.1_8 Reverse -111 -130 6.29264 0.244
NP_442427.1_8 Reverse -329 -348 6.19431 0.247
NP_442808.1_1 Reverse -337 -347 9.02601 0.0481
NP_442808.1_1 Reverse -119 -129 8.73102 0.0481
NP_442808.1_1 Forward -130 -120 8.63269 0.0481
NP_442808.1_1 Forward -142 -132 3.51951 0.238
NP_442808.1_1 Reverse -139 -149 3.51951 0.238
NP_442808.1_1 Reverse -145 -155 1.45457 0.285
NP_440145.1_3 Forward -139 -120 2.65439 0.115
NP_440145.1_3 Reverse -110 -129 -0.197208 0.14
NP_442050.1_1 Reverse -180 -199 7.66927 0.264
NP_442050.1_5 Reverse -118 -128 18.0724 0.00365
NP_442050.1_5 Forward -349 -339 7.64939 0.243
NP_442050.1_5 Forward -131 -121 7.64939 0.243
NP_442050.1_5 Reverse -336 -346 6.66608 0.286
NP_440346.1_6 Reverse -318 -328 16.5767 0.142
NP_440558.1_2 Forward -356 -337 1.86774 0.175
NP_440558.1_2 Reverse -123 -142 -3.04881 0.232
NP_440558.1_2 Reverse -32 -51 -4.42544 0.245
NP_442792.1_5 Forward -140 -123 8.49531 0.296
NP_441878.1_6 Reverse -119 -129 10.5014 0.0176
NP_441878.1_6 Forward -130 -120 10.4031 0.0176
NP_441878.1_6 Forward -348 -338 0.668351 0.139
NP_441878.1_6 Reverse -337 -347 0.57002 0.14
NP_441036.1_3 Reverse -179 -198 11.2092 0.0925
NP_441036.1_8 Reverse -119 -129 15.713 0.00724
NP_441036.1_8 Forward -130 -120 8.33817 0.174
NP_441036.1_8 Reverse -337 -347 5.97822 0.246
NP_442650.1_2 Reverse -120 -134 17.9942 0.0526
NP_442650.1_2 Reverse -338 -352 15.9292 0.066
NP_441557.1_5 Forward -129 -120 19.9609 0.000699
NP_441557.1_5 Reverse -120 -129 19.9609 0.000699
NP_441557.1_5 Forward -347 -338 10.8161 0.00464
NP_441557.1_5 Reverse -338 -347 10.4228 0.00915
NP_441557.1_8 Reverse -147 -157 13.5492 0.216
NP_441445.1_1 Forward -356 -337 4.916 0.183
NP_441445.1_1 Reverse -111 -130 1.57275 0.252
NP_440084.1_8 Reverse -60 -74 9.27434 0.29
NP_441308.1_8 Reverse -118 -128 13.353 0.218
NP_441458.1_10 Forward -356 -337 10.1275 0.14
NP_442830.1_5 Reverse -257 -271 -1.77094 0.299
NP_442183.1_1 Forward -129 -115 18.5841 0.00743
NP_442183.1_1 Forward -347 -333 7.76774 0.131
NP_442183.1_1 Reverse -120 -134 5.21113 0.226
NP_441407.1_5 Reverse -328 -347 3.34271 0.279
NP_442166.1_7 Reverse -339 -353 9.83269 0.19
NP_442397.1_9 Reverse -120 -139 3.34271 0.264
NP_442397.1_9 Forward -142 -123 1.47442 0.283
NP_440440.1_2 Reverse -129 -148 13.9616 0.281
NP_441819.1_5 Reverse -64 -83 9.21455 0.27
NP_441574.1_1 Forward -359 -340 -6.49039 0.277
NP_440414.1_8 Forward -100 -81 10.2259 0.228
NP_442347.1_2 Reverse -339 -348 12.4878 0.056
NP_442347.1_2 Reverse -121 -130 12.4878 0.056
NP_442347.1_2 Forward -49 -40 8.1612 0.108
NP_442347.1_2 Forward -128 -119 3.34298 0.284
NP_442347.1_2 Forward -346 -337 3.04799 0.289
NP_442347.1_8 Forward -23 -4 6.09597 0.187
NP_442645.1_2 Forward -137 -118 -3.93378 0.0525
NP_442645.1_2 Forward -355 -336 -12.6852 0.144
NP_442645.1_2 Reverse -112 -131 -14.3569 0.173
NP_441037.1_4 Forward -349 -339 7.9999 0.237
NP_441037.1_4 Forward -131 -121 7.9999 0.237
NP_441037.1_4 Reverse -118 -128 7.31769 0.237
NP_442594.1_8 Forward -285 -266 10.7175 0.175
NP_442317.1_6 Forward -134 -115 1.67108 0.298
NP_441633.1_3 Forward -131 -118 1.00259 0.11
NP_441633.1_3 Reverse -336 -349 -6.2739 0.242
NP_441633.1_3 Reverse -39 -52 -6.66722 0.265
NP_440136.1_2 Forward -346 -339 15.9687 0.0123
NP_440136.1_2 Reverse -339 -346 15.9687 0.0123
NP_440136.1_2 Forward -128 -121 15.9687 0.0123
NP_440136.1_2 Reverse -121 -128 15.9687 0.0123
NP_442590.1_10 Forward -366 -347 11.0125 0.172
NP_442590.1_10 Reverse -120 -139 3.53937 0.29
NP_442998.1_5 Forward -226 -216 10.6981 0.206
NP_442998.1_5 Reverse -221 -231 7.15819 0.299
NP_442998.1_10 Reverse -340 -347 15.5754 0.0102
NP_442998.1_10 Forward -127 -120 15.5754 0.0102
NP_442998.1_10 Reverse -122 -129 15.5754 0.0102
NP_442998.1_10 Forward -345 -338 5.84064 0.235
NP_442998.1_10 Forward -357 -350 4.07068 0.276
NP_442998.1_10 Forward -197 -190 4.07068 0.276
NP_440731.1_2 Forward -141 -122 7.7676 0.275
NP_440299.1_1 Forward -133 -120 22.3398 0.000547
NP_440299.1_1 Forward -351 -338 13.785 0.0292
NP_440299.1_1 Reverse -334 -347 3.85363 0.228
NP_440299.1_1 Forward -297 -284 2.47701 0.288
NP_441799.1_1 Reverse -116 -130 11.2087 0.0606
NP_441799.1_1 Reverse -334 -348 10.422 0.0747
NP_441799.1_1 Forward -133 -119 9.83206 0.0838
NP_441799.1_1 Forward -351 -337 7.07881 0.153
NP_441007.1_10 Reverse -115 -128 2.47756 0.186
NP_441007.1_10 Forward -352 -339 1.29759 0.203
NP_441007.1_10 Forward -134 -121 1.29759 0.203
NP_440256.1_1 Forward -132 -113 13.7658 0.00982
NP_440256.1_1 Forward -350 -331 -6.39206 0.21
NP_440256.1_1 Reverse -117 -136 -8.55534 0.263
NP_443042.1_5 Reverse -60 -79 10.7249 0.296
NP_441559.1_8 Reverse -127 -141 -4.62196 0.231
NP_441559.1_8 Reverse -152 -166 -5.50694 0.264
NP_441559.1_8 Forward -134 -120 -6.78525 0.279
NP_441559.1_8 Forward -171 -157 -7.17857 0.287
NP_440915.1_6 Forward -133 -119 12.7826 0.0206
NP_440915.1_6 Forward -351 -337 2.16287 0.124
NP_442158.1_4 Forward -327 -317 14.4347 0.182
NP_442158.1_4 Forward -163 -153 11.1898 0.28
NP_442785.1_7 Reverse -118 -132 10.4227 0.228
NP_441704.1_8 Forward -358 -339 17.0099 0.0736
NP_440329.1_4 Forward -232 -218 17.0159 0.255
NP_440134.1_2 Forward -234 -215 6.39097 0.296
NP_440748.1_4 Forward -283 -264 12.0933 0.292
NP_440748.1_5 Forward -42 -23 -2.95047 0.286
NP_441464.1_10 Forward -158 -144 9.83269 0.262
NP_440306.1_8 Forward -80 -61 -2.16459 0.245
NP_440695.1_5 Reverse -338 -357 -1.96717 0.293
NP_440695.1_6 Forward -307 -293 9.24786 0.292
NP_441939.1_3 Reverse -121 -140 7.7676 0.19
NP_439985.1_7 Forward -285 -266 12.1925 0.163
NP_442993.1_1 Forward -129 -113 -0.334789 0.0725
NP_440677.1_6 Forward -175 -156 7.17762 0.298
NP_442386.1_9 Reverse -337 -346 15.8305 0.0144
NP_442386.1_9 Forward -348 -339 13.8639 0.0289
NP_442386.1_9 Forward -130 -121 13.8639 0.0289
NP_442386.1_9 Reverse -343 -352 10.2257 0.136
NP_442386.1_9 Reverse -125 -134 10.2257 0.136
NP_442386.1_9 Reverse -119 -128 6.39082 0.219
NP_440570.1_5 Forward -357 -338 -2.75381 0.28
NP_440570.1_5 Forward -363 -344 -3.73712 0.292
NP_441340.1_5 Forward -346 -339 15.6737 0.0124
NP_441340.1_5 Reverse -339 -346 15.6737 0.0124
NP_441340.1_5 Forward -128 -121 15.6737 0.0124
NP_441340.1_5 Reverse -121 -128 15.6737 0.0124
NP_441947.1_8 Reverse -300 -319 18.4055 0.251
NP_442484.1_2 Forward -358 -339 9.3409 0.131
NP_442484.1_2 Forward -140 -121 0.982764 0.24
NP_440168.1_2 Reverse -22 -41 -2.85214 0.276
NP_442240.1_2 Forward -128 -109 -13.4719 0.169
NP_442240.1_2 Reverse -121 -140 -19.4701 0.295
NP_440586.1_8 Forward -346 -339 13.2151 0.026
NP_440586.1_8 Forward -128 -121 13.2151 0.026
NP_440586.1_8 Reverse -339 -346 13.2151 0.026
NP_440586.1_8 Reverse -121 -128 13.2151 0.026
NP_442251.1_6 Forward -346 -339 15.2804 0.0124
NP_442251.1_6 Reverse -339 -346 15.2804 0.0124
NP_442251.1_6 Forward -128 -121 15.2804 0.0124
NP_442251.1_6 Reverse -121 -128 15.2804 0.0124
NP_441262.1_3 Reverse -120 -127 14.7888 0.0223
NP_441262.1_3 Forward -347 -340 14.7888 0.0223
NP_441262.1_3 Forward -129 -122 14.7888 0.0223
NP_441262.1_3 Reverse -338 -345 6.52896 0.0809
NP_440027.1_3 Reverse -344 -362 1.88669 0.295
NP_443051.1_1 Reverse -119 -128 19.5676 0.00335
NP_443051.1_1 Forward -348 -339 10.4228 0.00754
NP_443051.1_1 Forward -130 -121 10.4228 0.00754
NP_443051.1_1 Reverse -337 -346 0.983037 0.125
NP_443051.1_5 Reverse -75 -94 5.60432 0.256
NP_441232.1_10 Forward -358 -339 6.29264 0.162
NP_439937.1_9 Reverse -307 -324 -8.02495 0.173
NP_439937.1_9 Reverse -308 -325 -16.7764 0.287
NP_440408.1_7 Reverse -338 -357 10.5209 0.247
NP_440439.1_1 Reverse -117 -130 1.88757 0.139
NP_440439.1_1 Forward -132 -119 0.0192843 0.203
NP_439943.1_7 Reverse -333 -352 8.55425 0.181
NP_440372.1_2 Forward -346 -339 16.3621 0.0124
NP_440372.1_2 Reverse -339 -346 16.3621 0.0124
NP_440372.1_2 Forward -128 -121 16.3621 0.0124
NP_440372.1_2 Reverse -121 -128 16.3621 0.0124
NP_441181.1_6 Reverse -339 -357 3.26407 0.283
NP_440819.1_5 Reverse -81 -89 8.08256 0.185
NP_440819.1_5 Forward -142 -134 7.98423 0.228
NP_441803.1_2 Reverse -345 -364 5.11266 0.171
NP_441803.1_2 Reverse -115 -134 0.294447 0.255
NP_439977.1_5 Forward -135 -116 -0.295539 0.222
NP_439977.1_5 Reverse -23 -42 -0.590531 0.229
NP_440267.1_2 Reverse -115 -129 18.7801 0.0237
NP_442384.1_10 Reverse -120 -133 17.4239 0.00585
NP_442384.1_10 Reverse -338 -351 8.47575 0.0656
NP_441877.1_7 Reverse -115 -134 3.83357 0.218
NP_441877.1_7 Reverse -333 -352 3.04693 0.218
NP_441877.1_7 Reverse -279 -298 0.392004 0.266
NP_441018.1_7 Forward -160 -141 13.1758 0.14
NP_441018.1_7 Forward -159 -140 11.5042 0.185
NP_440530.1_5 Forward -263 -244 8.16093 0.258
NP_442262.1_10 Forward -346 -339 14.1988 0.0123
NP_442262.1_10 Reverse -339 -346 14.1988 0.0123
NP_442262.1_10 Forward -128 -121 14.1988 0.0123
NP_442262.1_10 Reverse -121 -128 14.1988 0.0123
NP_441689.1_5 Reverse -118 -128 17.8758 0.0158
NP_441689.1_5 Forward -349 -339 5.78111 0.197
NP_441689.1_5 Forward -131 -121 5.78111 0.197
NP_440344.1_10 Forward -354 -337 -0.649475 0.0444
NP_440344.1_10 Reverse -331 -348 -1.33779 0.0527
NP_440344.1_10 Reverse -113 -130 -7.23765 0.116
NP_440531.1_6 Reverse -112 -131 0.294447 0.195
NP_440531.1_6 Reverse -276 -295 -5.01543 0.291
NP_442910.1_1 Forward -354 -335 -8.45701 0.296
NP_440189.1_10 Reverse -327 -346 8.55425 0.241
NP_440487.1_1 Forward -39 -20 -5.80207 0.224
NP_441965.1_3 Forward -139 -120 -1.86883 0.297
NP_441965.1_10 Reverse -117 -133 11.1699 0.107
NP_441965.1_10 Reverse -335 -351 6.15506 0.185
NP_441898.1_2 Reverse -364 -383 13.7649 0.288
NP_442556.1_10 Forward -102 -83 18.6664 0.115
NP_440297.1_9 Forward -128 -118 9.22315 0.0917
NP_440297.1_9 Reverse -339 -349 -0.118297 0.282
NP_440297.1_9 Reverse -121 -131 -0.118297 0.282
NP_442187.1_3 Forward -348 -338 17.188 0.0619
NP_442280.1_10 Forward -357 -339 7.49983 0.268
NP_442280.1_10 Reverse -265 -283 5.64923 0.283
NP_441896.1_3 Forward -150 -131 1.67108 0.212
NP_440700.1_8 Forward -141 -127 10.7177 0.291
NP_441894.1_1 Forward -302 -283 -4.03212 0.191
NP_440999.1_2 Reverse -345 -364 8.65258 0.288
NP_440999.1_9 Forward -133 -119 0.687908 0.177
NP_440888.1_2 Forward -129 -115 13.5686 0.027
NP_440888.1_2 Reverse -120 -134 8.94708 0.142
NP_440888.1_2 Reverse -338 -352 6.98048 0.212
NP_440600.1_4 Reverse -330 -348 14.4738 0.0557
NP_440600.1_4 Reverse -112 -130 -4.99573 0.272
NP_440179.1_6 Reverse -339 -358 16.4207 0.0681
NP_440052.1_5 Forward -358 -339 0.687771 0.175
NP_442225.1_10 Forward -357 -338 6.68515 0.281
NP_441543.1_2 Reverse -339 -348 16.9127 0.00359
NP_441543.1_2 Reverse -121 -130 16.9127 0.00359
NP_441543.1_2 Forward -128 -119 15.9293 0.00518
NP_441543.1_2 Forward -346 -337 7.37455 0.127
NP_441543.1_2 Forward -292 -283 7.07956 0.131
NP_442845.1_2 Forward -135 -121 7.47274 0.195
NP_442845.1_2 Forward -353 -339 7.37441 0.195
NP_442845.1_2 Forward -141 -127 7.07942 0.199
NP_442845.1_2 Reverse -120 -134 6.98109 0.199
NP_441918.1_7 Reverse -119 -138 -0.295539 0.297
NP_441469.1_8 Reverse -119 -128 6.5879 0.227
NP_441469.1_8 Forward -348 -339 6.48957 0.227
NP_441469.1_8 Forward -130 -121 6.48957 0.227
NP_441469.1_8 Reverse -337 -346 5.80125 0.253
NP_442315.1_2 Forward -160 -148 11.7404 0.291
NP_442315.1_3 Forward -141 -122 7.37428 0.233
NP_443064.1_6 Reverse -120 -130 12.5669 0.0796
NP_443064.1_6 Forward -129 -119 10.8217 0.13
NP_443064.1_6 Reverse -338 -348 9.46426 0.219
NP_442337.1_8 Forward -289 -270 0.58944 0.246
NP_442578.1_7 Forward -346 -339 14.5921 0.026
NP_442578.1_7 Forward -128 -121 14.5921 0.026
NP_442578.1_7 Reverse -339 -346 14.5921 0.026
NP_442578.1_7 Reverse -121 -128 14.5921 0.026
NP_440710.1_1 Reverse -112 -130 4.14905 0.113
NP_440220.1_4 Reverse -317 -336 -2.8529 0.282
NP_441462.1_2 Forward -129 -119 20.2362 0.000805
NP_441462.1_2 Reverse -120 -130 11.5831 0.00406
NP_441462.1_2 Forward -347 -337 9.32148 0.0234
NP_441462.1_2 Reverse -338 -348 1.74999 0.0811
NP_441462.1_5 Reverse -168 -187 3.6377 0.285
NP_443062.1_1 Forward -129 -111 11.6662 0.0955
NP_443062.1_1 Reverse -338 -356 7.37584 0.177
NP_441601.1_4 Forward -183 -164 -5.11376 0.293
NP_442204.1_1 Forward -351 -340 8.7118 0.0852
NP_442204.1_1 Forward -133 -122 8.7118 0.0852
NP_442204.1_1 Reverse -346 -357 1.7303 0.266
NP_442204.1_1 Reverse -116 -127 0.157002 0.283
NP_442204.1_2 Reverse -340 -359 10.2259 0.223
NP_441560.1_8 Reverse -12 -31 14.1422 0.18
NP_441560.1_8 Forward -134 -115 12.9735 0.239
NP_440255.1_8 Reverse -331 -350 13.0738 0.298
NP_440516.1_8 Forward -347 -338 18.9776 0.00442
NP_440516.1_8 Forward -129 -120 16.9127 0.00442
NP_440516.1_8 Reverse -120 -129 16.9127 0.00442
NP_440516.1_8 Reverse -338 -347 7.07956 0.0867
NP_440516.1_8 Reverse -290 -299 -0.393597 0.255
NP_441033.1_2 Reverse -328 -347 10.5209 0.0464
NP_442428.1_5 Forward -346 -339 15.8704 0.0124
NP_442428.1_5 Reverse -339 -346 15.8704 0.0124
NP_442428.1_5 Forward -128 -121 15.8704 0.0124
NP_442428.1_5 Reverse -121 -128 15.8704 0.0124
NP_442428.1_5 Forward -49 -42 3.67736 0.298
NP_440673.1_2 Reverse -180 -199 11.0725 0.188
NP_440673.1_3 Forward -345 -338 13.1171 0.0426
NP_440673.1_3 Forward -127 -120 12.4288 0.0426
NP_440673.1_3 Reverse -340 -347 12.4288 0.0426
NP_440673.1_3 Reverse -122 -129 12.4288 0.0426
NP_440865.1_9 Reverse -114 -133 -6.49039 0.226
NP_441052.1_2 Reverse -338 -348 20.5312 0.00106
NP_441052.1_2 Reverse -120 -130 19.9412 0.00106
NP_441052.1_2 Forward -129 -119 10.4031 0.0285
NP_441052.1_2 Forward -347 -337 10.2065 0.0295
NP_441052.1_2 Forward -210 -200 -0.216628 0.269
NP_442219.1_8 Forward -357 -338 12.5156 0.157
NP_442219.1_9 Forward -346 -337 18.3876 0.00718
NP_442219.1_9 Reverse -339 -348 17.7976 0.00718
NP_442219.1_9 Reverse -121 -130 17.7976 0.00718
NP_442219.1_9 Forward -128 -119 8.25953 0.0681
NP_440436.1_4 Reverse -339 -348 17.2072 0.00233
NP_440436.1_4 Reverse -121 -130 17.2072 0.00233
NP_440436.1_4 Forward -128 -119 9.24241 0.0871
NP_440436.1_4 Forward -346 -337 8.06244 0.118
NP_441893.1_8 Forward -286 -267 17.699 0.191
NP_440041.1_10 Reverse -23 -41 24.7977 0.0141
NP_442907.1_9 Reverse -345 -364 -5.01543 0.282
NP_442577.1_1 Forward -167 -148 1.96607 0.192
NP_441719.1_4 Forward -346 -339 16.3621 0.0124
NP_441719.1_4 Reverse -339 -346 16.3621 0.0124
NP_441719.1_4 Forward -128 -121 16.3621 0.0124
NP_441719.1_4 Reverse -121 -128 16.3621 0.0124
NP_441004.1_1 Reverse -24 -43 -17.4051 0.291
NP_442366.1_3 Reverse -337 -355 -4.30741 0.268
NP_442366.1_3 Reverse -119 -137 -4.8974 0.278
NP_442366.1_3 Forward -348 -330 -5.58572 0.289
NP_442366.1_5 Forward -350 -340 14.0409 0.0497
NP_442366.1_5 Forward -132 -122 14.0409 0.0497
NP_442206.1_1 Forward -362 -343 -14.6519 0.278
NP_442206.1_10 Reverse -338 -353 2.92983 0.196
NP_442206.1_10 Reverse -120 -135 1.06154 0.238
NP_442854.1_6 Reverse -120 -139 1.67108 0.279
NP_443054.1_2 Reverse -118 -132 1.57289 0.245
NP_441851.1_10 Forward -130 -120 15.8113 0.00552
NP_441851.1_10 Reverse -119 -129 8.53483 0.114
NP_441851.1_10 Forward -348 -338 8.33817 0.118
NP_441851.1_10 Reverse -337 -347 6.46988 0.167
NP_442208.1_3 Forward -204 -185 16.6329 0.293
NP_441668.1_4 Forward -139 -120 8.35759 0.144
NP_441668.1_5 Reverse -170 -189 6.29264 0.288
NP_442515.1_1 Forward -348 -334 2.85119 0.129
NP_442515.1_1 Forward -130 -116 2.65453 0.131
NP_441396.1_5 Forward -326 -317 8.1612 0.224
NP_440593.1_3 Reverse -333 -352 5.11266 0.125
NP_440593.1_3 Forward -358 -339 -4.6221 0.251
NP_442689.1_8 Reverse -216 -233 -7.33598 0.292
NP_440940.1_7 Reverse -110 -128 3.26332 0.274
NP_440940.1_7 Forward -139 -121 2.87 0.29
NP_441349.1_10 Reverse -110 -129 7.07928 0.0326
NP_441349.1_10 Forward -139 -120 -7.96535 0.262
NP_441349.1_10 Reverse -328 -347 -8.55534 0.278
NP_441409.1_6 Forward -135 -116 -0.39387 0.0692
NP_440432.1_9 Forward -128 -113 13.9429 0.017
NP_442843.1_1 Forward -283 -264 -10.6203 0.279
NP_439960.1_4 Forward -354 -335 15.4366 0.153
NP_440474.1_8 Forward -128 -114 5.60385 0.246
NP_440474.1_8 Reverse -42 -56 5.30886 0.251
NP_440431.1_3 Reverse -119 -138 -2.85214 0.175
NP_442450.1_5 Reverse -118 -128 9.41981 0.115
NP_442450.1_5 Reverse -336 -346 7.84651 0.13
NP_442450.1_5 Forward -349 -339 7.55152 0.13
NP_442450.1_5 Forward -131 -121 7.55152 0.13
NP_442168.1_5 Reverse -339 -358 -3.83545 0.293
NP_440588.1_2 Forward -356 -337 -2.75381 0.172
NP_442006.1_2 Reverse -344 -361 1.61214 0.117
NP_443047.1_7 Forward -128 -109 14.3558 0.0827
NP_442243.1_1 Reverse -23 -41 -3.22649 0.299
NP_441570.1_1 Forward -129 -111 10.0489 0.0099
NP_441570.1_1 Forward -347 -329 -7.35568 0.0887
NP_441570.1_1 Reverse -120 -138 -9.32229 0.134
NP_440078.1_10 Reverse -120 -139 5.60432 0.224
NP_441078.1_4 Forward -129 -120 19.6659 0.0007
NP_441078.1_4 Reverse -120 -129 19.6659 0.0007
NP_441078.1_4 Forward -347 -338 9.93116 0.0203
NP_441078.1_4 Reverse -338 -347 9.83282 0.0226
NP_442348.1_2 Forward -166 -157 12.2911 0.218
NP_442443.1_1 Forward -157 -138 -2.85214 0.264
NP_442443.1_1 Forward -197 -178 -5.31042 0.282
NP_440526.1_3 Reverse -339 -350 8.02298 0.126
NP_440526.1_3 Reverse -121 -132 8.02298 0.126
NP_440526.1_3 Forward -128 -117 1.82816 0.267
NP_441432.1_8 Reverse -119 -128 16.8143 0.00595
NP_441432.1_8 Forward -348 -339 16.8143 0.00595
NP_441432.1_8 Forward -130 -121 16.8143 0.00595
NP_441432.1_8 Reverse -337 -346 6.98123 0.112
NP_441432.1_8 Reverse -289 -298 3.24465 0.252
NP_442320.1_8 Reverse -114 -128 3.8345 0.0578
NP_442320.1_8 Forward -135 -121 -2.26202 0.0871
NP_442320.1_8 Forward -353 -339 -2.36035 0.0871
NP_442320.1_8 Reverse -332 -346 -5.21195 0.209
NP_442344.1_7 Forward -346 -327 -6.68705 0.172
NP_442344.1_7 Reverse -339 -358 -7.86702 0.196
NP_441732.1_2 Reverse -116 -132 -6.92296 0.0558
NP_441732.1_2 Forward -351 -335 -7.70961 0.0885
NP_441732.1_2 Forward -133 -117 -7.70961 0.0885
NP_441732.1_2 Reverse -346 -362 -17.5427 0.27
NP_442447.1_1 Reverse -173 -192 9.24257 0.258
NP_442003.1_9 Forward -155 -136 12.1925 0.17
NP_440760.1_1 Reverse -120 -139 -4.22878 0.0407
NP_440760.1_1 Reverse -338 -357 -21.9284 0.246
NP_442797.1_7 Reverse -22 -40 12.1139 0.157
NP_440199.1_10 Reverse -117 -127 14.238 0.0861
NP_440913.1_1 Forward -157 -139 6.214 0.229
NP_440913.1_1 Forward -131 -113 4.83737 0.254
NP_441072.1_2 Forward -160 -141 8.16093 0.24
NP_442400.1_10 Reverse -101 -114 15.3405 0.173
NP_440713.1_9 Forward -152 -133 15.8307 0.197
NP_442489.1_2 Reverse -327 -346 1.0811 0.296
NP_442489.1_7 Forward -129 -120 20.1576 0.000695
NP_442489.1_7 Reverse -120 -129 20.1576 0.000695
NP_442489.1_7 Forward -347 -338 10.4228 0.0151
NP_442489.1_7 Reverse -338 -347 10.3245 0.0193
NP_440565.1_8 Forward -148 -129 21.2381 0.201
NP_440559.1_1 Reverse -339 -348 17.4043 0.00658
NP_440559.1_1 Reverse -121 -130 17.4043 0.00658
NP_440559.1_1 Forward -346 -337 9.24284 0.0586
NP_440559.1_1 Forward -128 -119 8.65285 0.0586
NP_441659.2_8 Forward -129 -119 20.9245 0.000805
NP_441659.2_8 Reverse -120 -130 18.1713 0.00133
NP_441659.2_8 Forward -347 -337 8.63316 0.0405
NP_441659.2_8 Reverse -338 -348 8.63316 0.0405
NP_442913.1_10 Reverse -329 -348 -2.75381 0.192
NP_440336.1_1 Reverse -70 -89 10.7175 0.286
NP_441968.1_1 Reverse -81 -89 14.1787 0.286
NP_439956.1_7 Forward -146 -127 1.67108 0.283
NP_439956.1_7 Forward -161 -142 0.786102 0.296
NP_440779.1_5 Forward -347 -330 -14.8091 0.274
NP_442346.1_5 Forward -130 -120 16.6963 0.00248
NP_442346.1_5 Reverse -119 -129 16.303 0.00248
NP_442346.1_5 Reverse -337 -347 12.8614 0.0349
NP_442346.1_5 Forward -348 -338 8.23984 0.143
NP_440352.1_5 Reverse -73 -92 10.3196 0.278
NP_440545.1_3 Forward -133 -116 2.89044 0.0923
NP_440545.1_3 Reverse -26 -43 -5.36936 0.247
NP_440025.1_1 Forward -133 -114 9.63589 0.192
NP_441786.1_10 Reverse -281 -300 14.9458 0.121
NP_441710.1_9 Forward -136 -117 10.52 0.26
NP_440010.1_4 Reverse -116 -135 -2.06626 0.273
NP_442828.1_2 Forward -78 -59 16.09 0.239
NP_441833.1_4 Forward -346 -339 15.9687 0.0124
NP_441833.1_4 Reverse -339 -346 15.9687 0.0124
NP_441833.1_4 Forward -128 -121 15.9687 0.0124
NP_441833.1_4 Reverse -121 -128 15.9687 0.0124
NP_441329.1_1 Reverse -72 -91 4.43995 0.291
NP_441329.1_6 Reverse -97 -116 5.96782 0.191
NP_441329.1_6 Reverse -100 -119 -2.62645 0.294
NP_442162.1_9 Forward -346 -339 16.2637 0.0124
NP_442162.1_9 Reverse -339 -346 16.2637 0.0124
NP_442162.1_9 Forward -128 -121 16.2637 0.0124
NP_442162.1_9 Reverse -121 -128 16.2637 0.0124
NP_440671.1_4 Reverse -114 -128 13.7659 0.0748
NP_440671.1_4 Forward -135 -121 10.7177 0.151
NP_442140.1_3 Forward -346 -336 14.0414 0.0508
NP_442140.1_3 Reverse -339 -349 12.2714 0.0632
NP_442140.1_3 Reverse -121 -131 12.2714 0.0632
NP_441671.1_10 Forward -146 -127 5.99764 0.215
NP_440875.1_9 Forward -127 -117 7.59334 0.255
NP_441813.1_5 Reverse -118 -128 15.9097 0.01
NP_441813.1_5 Reverse -336 -346 8.63316 0.0367
NP_441813.1_5 Forward -349 -339 8.63316 0.0367
NP_441813.1_5 Forward -131 -121 8.63316 0.0367
NP_442089.1_1 Forward -350 -331 0.786102 0.252
NP_440590.1_4 Reverse -339 -352 10.934 0.0235
NP_440590.1_4 Reverse -121 -134 10.934 0.0235
NP_440567.1_1 Reverse -339 -353 14.0609 0.0191
NP_440567.1_1 Reverse -121 -135 6.58777 0.0816
NP_440567.1_1 Forward -346 -332 4.91614 0.109
NP_440035.1_10 Reverse -149 -167 17.56 0.229
NP_442497.1_2 Reverse -1 -20 13.5691 0.206
NP_442497.1_10 Forward -128 -119 17.601 0.00813
NP_442497.1_10 Reverse -339 -348 10.4228 0.0087
NP_442497.1_10 Reverse -121 -130 10.4228 0.0087
NP_442497.1_10 Forward -346 -337 1.37636 0.111
NP_440821.1_4 Reverse -118 -128 11.0914 0.0146
NP_440821.1_4 Forward -349 -339 9.41981 0.0286
NP_440821.1_4 Forward -131 -121 9.41981 0.0286
NP_440821.1_4 Reverse -336 -346 7.05986 0.0753
NP_441239.1_9 Reverse -118 -130 12.1337 0.0494
NP_441239.1_9 Forward -131 -119 3.38223 0.285
NP_441239.1_9 Reverse -336 -348 3.08724 0.296
NP_441951.1_4 Reverse -338 -357 1.0811 0.288
NP_441951.1_9 Forward -198 -179 -0.39387 0.276
NP_441009.1_4 Reverse -338 -357 15.1424 0.167
NP_441727.1_3 Reverse -331 -350 9.93088 0.174
NP_441727.1_3 Forward -354 -335 3.6377 0.284
NP_441727.1_8 Reverse -179 -198 10.1275 0.144
NP_441892.1_1 Reverse -111 -128 8.29864 0.0819
NP_441892.1_1 Forward -138 -121 -1.53445 0.208
NP_441892.1_1 Forward -356 -339 -4.87771 0.269
NP_442193.1_1 Forward -272 -254 8.27895 0.272
NP_442193.1_1 Forward -283 -265 8.08229 0.275
NP_442193.1_8 Reverse -117 -136 11.995 0.244
NP_442270.1_9 Forward -358 -339 -7.67036 0.214
NP_441017.1_6 Reverse -116 -130 12.192 0.224
NP_440833.1_6 Forward -192 -178 9.53707 0.261
NP_441567.1_4 Forward -231 -212 2.65439 0.297
NP_441617.1_6 Forward -136 -117 -0.688862 0.256
NP_442809.1_6 Forward -141 -122 1.96607 0.269
NP_440546.1_4 Forward -129 -119 13.5365 0.0459
NP_440546.1_4 Forward -347 -337 11.2095 0.0923
NP_440546.1_4 Reverse -120 -130 10.046 0.109
NP_440546.1_4 Reverse -338 -348 7.33119 0.246
NP_441230.1_5 Reverse -115 -134 7.07928 0.166
NP_441230.1_5 Reverse -30 -49 -0.983855 0.295
NP_440462.1_6 Reverse -118 -128 16.893 0.00853
NP_440462.1_6 Forward -349 -339 1.35667 0.294
NP_440462.1_6 Forward -131 -121 1.35667 0.294
NP_442340.1_7 Forward -166 -147 18.584 0.175
NP_442144.1_1 Reverse -335 -351 18.4464 0.119
NP_440868.1_4 Reverse -334 -346 7.11881 0.0756
NP_440868.1_4 Forward -351 -339 6.1355 0.0878
NP_440868.1_4 Forward -133 -121 6.1355 0.0878
NP_440868.1_4 Reverse -116 -128 5.93884 0.0879
NP_440374.1_1 Forward -251 -232 9.43923 0.298
NP_442479.1_9 Reverse -172 -191 -12.3902 0.281
NP_442479.1_9 Forward -167 -148 -12.3902 0.281
NP_442402.1_4 Reverse -124 -143 -9.63771 0.292
NP_440696.1_3 Forward -363 -345 6.31233 0.188
NP_440843.1_3 Forward -146 -127 8.75091 0.29
NP_442039.1_4 Forward -346 -339 15.1821 0.0124
NP_442039.1_4 Reverse -339 -346 15.1821 0.0124
NP_442039.1_4 Forward -128 -121 15.1821 0.0124
NP_442039.1_4 Reverse -121 -128 15.1821 0.0124
NP_441811.1_8 Forward -135 -121 5.99778 0.289
NP_442679.1_1 Reverse -94 -113 -5.01543 0.288
NP_440008.1_9 Forward -135 -116 10.1275 0.256
NP_441926.1_3 Forward -129 -113 16.2831 0.0428
NP_440825.1_7 Reverse -339 -349 12.9096 0.152
NP_440825.1_7 Reverse -121 -131 12.9096 0.152
NP_442696.1_2 Forward -348 -330 9.36059 0.25
NP_442837.1_3 Forward -346 -339 15.7721 0.0124
NP_442837.1_3 Reverse -339 -346 15.7721 0.0124
NP_442837.1_3 Forward -128 -121 15.7721 0.0124
NP_442837.1_3 Reverse -121 -128 15.7721 0.0124
NP_442053.1_1 Forward -129 -120 18.3876 0.0007
NP_442053.1_1 Reverse -120 -129 18.3876 0.0007
NP_442053.1_1 Forward -347 -338 17.601 0.00138
NP_442053.1_1 Reverse -338 -347 16.2243 0.00451
NP_440505.1_3 Reverse -118 -128 15.123 0.014
NP_440505.1_3 Forward -349 -339 9.22315 0.122
NP_440505.1_3 Forward -131 -121 9.22315 0.122
NP_441102.1_2 Reverse -58 -77 5.01433 0.298
NP_441252.1_6 Reverse -178 -185 11.9372 0.25
NP_441203.1_1 Reverse -121 -140 -10.7186 0.137
NP_441203.1_1 Forward -128 -109 -13.3736 0.163
NP_440013.1_2 Forward -354 -340 12.7826 0.294
NP_442532.1_7 Forward -347 -333 2.45787 0.24
NP_441408.2_7 Reverse -118 -137 -0.197208 0.23
NP_440914.1_1 Reverse -120 -130 17.5935 0.000537
NP_440914.1_1 Forward -347 -337 16.3248 0.00196
NP_440914.1_1 Forward -129 -119 16.3248 0.00196
NP_440914.1_1 Reverse -338 -348 15.0561 0.00832
NP_441011.1_8 Forward -128 -119 16.6177 0.00602
NP_441011.1_8 Reverse -339 -348 8.25953 0.144
NP_441011.1_8 Reverse -121 -130 8.25953 0.144
NP_441011.1_8 Forward -346 -337 6.68623 0.184
NP_442533.1_1 Forward -276 -257 -7.86702 0.201
NP_442533.1_6 Forward -129 -120 17.2076 0.00137
NP_442533.1_6 Reverse -120 -129 17.2076 0.00137
NP_442533.1_6 Forward -347 -338 7.86621 0.0862
NP_442533.1_6 Reverse -338 -347 7.37455 0.0898
NP_442533.1_6 Forward -39 -30 4.32629 0.184
NP_441089.1_5 Forward -143 -124 18.7807 0.241
NP_442322.1_4 Reverse -256 -273 -9.89323 0.297
NP_443016.1_1 Reverse -332 -351 -4.72043 0.235
NP_441482.1_7 Forward -135 -121 10.4227 0.0135
NP_441482.1_7 Reverse -114 -128 6.19444 0.0332
NP_441482.1_7 Forward -353 -339 0.88457 0.0554
NP_441482.1_7 Reverse -344 -358 -11.4068 0.262
NP_439944.1_9 Forward -128 -118 17.6796 0.00347
NP_439944.1_9 Reverse -339 -349 10.5014 0.0887
NP_439944.1_9 Reverse -121 -131 10.5014 0.0887
NP_440816.1_2 Forward -343 -324 7.01583 0.27
NP_441028.1_6 Forward -114 -104 5.19112 0.265
NP_440116.1_5 Forward -132 -115 8.39697 0.155
NP_440116.1_5 Forward -350 -333 5.54538 0.176
NP_440116.1_8 Reverse -339 -358 -0.885524 0.114
NP_441527.1_4 Reverse -99 -118 -11.1252 0.278
NP_440115.1_6 Forward -350 -340 9.32148 0.115
NP_440115.1_6 Forward -132 -122 9.32148 0.115
NP_440007.1_9 Forward -351 -337 8.25939 0.18
NP_440007.1_9 Reverse -116 -130 2.85119 0.277
NP_440007.1_9 Forward -133 -119 1.37622 0.285
NP_442492.1_2 Forward -347 -328 19.2723 0.0121
NP_441961.1_4 Forward -143 -124 3.93269 0.277
NP_441972.1_5 Reverse -121 -140 2.26107 0.121
NP_441972.1_5 Reverse -339 -358 -6.09707 0.228
NP_441106.1_1 Reverse -119 -128 18.486 0.0028
NP_441106.1_1 Forward -348 -339 9.63616 0.0311
NP_441106.1_1 Forward -130 -121 9.63616 0.0311
NP_440429.1_2 Reverse -339 -358 8.84924 0.272
NP_439903.1_6 Reverse -117 -136 19.8614 0.0452
NP_439903.1_6 Forward -138 -119 5.99684 0.173
NP_441286.1_1 Forward -130 -118 14.3953 0.00424
NP_441286.1_1 Forward -348 -336 11.937 0.0108
NP_441286.1_1 Reverse -337 -349 3.67722 0.0467
NP_441286.1_1 Reverse -119 -131 3.48056 0.0467
NP_442674.1_3 Forward -355 -336 9.7334 0.174
NP_440670.1_8 Forward -129 -120 18.3876 0.000699
NP_440670.1_8 Reverse -120 -129 18.3876 0.000699
NP_440670.1_8 Forward -347 -338 9.04618 0.0606
NP_440670.1_8 Reverse -338 -347 8.75118 0.0606
NP_440886.1_7 Reverse -119 -129 8.04271 0.0805
NP_440886.1_7 Reverse -337 -347 7.94438 0.0805
NP_440886.1_7 Forward -130 -120 7.94438 0.0805
NP_440886.1_7 Forward -348 -338 6.66608 0.115
NP_440828.1_4 Reverse -136 -155 -6.78612 0.279
NP_442614.1_2 Reverse -120 -134 7.17775 0.275
NP_442382.1_7 Forward -142 -123 9.53756 0.22
NP_442717.1_2 Forward -338 -319 -2.0655 0.217
NP_442717.1_2 Forward -337 -318 -4.42544 0.243
NP_442072.1_9 Forward -130 -112 -13.4522 0.112
NP_442072.1_9 Reverse -119 -137 -13.8455 0.123
NP_441753.1_10 Reverse -111 -130 2.26107 0.241
NP_441403.1_4 Reverse -187 -205 7.59063 0.282
NP_440907.2_8 Forward -128 -118 9.51767 0.103
NP_440907.2_8 Reverse -339 -349 7.64939 0.117
NP_440907.2_8 Reverse -121 -131 7.64939 0.117
NP_442264.1_5 Reverse -120 -134 14.7492 0.222
NP_441021.1_1 Reverse -121 -140 -3.73712 0.16
NP_440326.1_5 Forward -131 -118 15.2606 0.179
NP_440841.1_4 Forward -349 -330 6.98095 0.0787
NP_440841.1_4 Reverse -336 -355 -11.4069 0.3
NP_441463.1_3 Reverse -328 -347 12.2908 0.0405
NP_441463.1_3 Reverse -25 -44 -9.047 0.276
NP_441463.1_6 Reverse -118 -132 10.088 0.242
NP_441626.1_2 Forward -346 -339 15.7721 0.0124
NP_441626.1_2 Reverse -339 -346 15.7721 0.0124
NP_441626.1_2 Forward -128 -121 15.7721 0.0124
NP_441626.1_2 Reverse -121 -128 15.7721 0.0124
NP_442365.1_7 Forward -351 -332 -1.47551 0.191
NP_442365.1_7 Reverse -266 -285 -4.81876 0.25
NP_442365.1_7 Forward -133 -114 -5.01543 0.256
NP_440107.1_5 Reverse -337 -356 -0.787193 0.178
NP_442794.1_1 Forward -351 -339 21.9668 0.00123
NP_442794.1_1 Forward -133 -121 21.9668 0.00123
NP_442794.1_1 Reverse -334 -346 10.3637 0.0721
NP_441401.1_1 Reverse -311 -330 8.35759 0.293
NP_442615.1_1 Forward -356 -338 7.98396 0.0301
NP_442615.1_1 Forward -138 -120 0.510803 0.101
NP_442615.1_1 Reverse -329 -347 -1.16082 0.125
NP_441962.1_4 Forward -134 -115 -7.96535 0.195
NP_441962.1_4 Forward -352 -333 -8.35868 0.199
NP_441962.1_4 Reverse -339 -358 -11.5053 0.241
NP_440387.1_1 Reverse -120 -136 19.3314 0.00373
NP_440387.1_1 Forward -129 -113 6.54838 0.0282
NP_440387.1_1 Reverse -338 -354 2.51681 0.0784
NP_440387.1_1 Forward -347 -331 -3.38305 0.158
NP_441431.1_2 Forward -350 -336 5.99717 0.281
NP_442020.1_1 Reverse -322 -341 1.86696 0.255
NP_441488.1_3 Forward -158 -140 18.1766 0.239
NP_441488.1_8 Forward -352 -338 21.73 0.00323
NP_441488.1_8 Forward -134 -120 13.077 0.146
NP_442647.1_3 Forward -216 -198 18.3087 0.238
NP_441836.1_1 Forward -358 -339 23.1874 0.00512
NP_441993.1_1 Forward -260 -241 7.79413 0.16
NP_441993.1_1 Forward -135 -116 1.65431 0.273
NP_442224.1_1 Reverse -336 -355 -0.983855 0.233
NP_440467.1_3 Forward -358 -339 14.5767 0.158
NP_440114.1_10 Forward -129 -115 19.0758 0.00367
NP_441425.1_3 Reverse -174 -184 15.5163 0.273
NP_442323.1_7 Reverse -152 -171 2.45694 0.265
NP_440287.1_6 Forward -138 -119 6.09597 0.17
NP_440766.1_4 Forward -351 -337 0.786239 0.268
NP_440766.1_5 Forward -227 -215 15.8681 0.18
NP_440766.1_5 Forward -196 -184 8.7062 0.277
NP_441237.1_9 Reverse -339 -349 14.828 0.0242
NP_441237.1_9 Reverse -121 -131 14.828 0.0242
NP_441237.1_9 Forward -346 -336 14.4347 0.0376
NP_442743.1_4 Forward -35 -16 -7.67036 0.28
NP_442743.1_5 Reverse -333 -352 7.7676 0.163
NP_441311.1_2 Forward -353 -339 11.9953 0.236
NP_440643.1_6 Reverse -115 -134 4.52268 0.22
NP_439910.1_2 Reverse -112 -129 -4.09106 0.0692
NP_442867.1_3 Forward -129 -110 1.27776 0.223
NP_442867.1_8 Reverse -276 -295 10.3242 0.21
NP_440457.1_1 Forward -271 -259 1.61227 0.232
NP_440457.1_1 Reverse -116 -128 0.137309 0.25
NP_440457.1_1 Forward -351 -339 -0.452677 0.263
NP_440457.1_1 Forward -133 -121 -0.452677 0.263
NP_440213.1_5 Forward -140 -121 10.0292 0.259
NP_440142.1_7 Reverse -339 -358 17.2074 0.0766
NP_442509.1_6 Forward -296 -277 8.65258 0.294
NP_442509.1_9 Reverse -120 -130 8.14104 0.192
NP_442509.1_9 Forward -129 -119 8.04271 0.192
NP_442509.1_9 Forward -347 -337 6.66608 0.259
NP_442439.1_8 Reverse -283 -302 7.7676 0.273
NP_442514.1_5 Forward -355 -336 -8.85106 0.29
NP_440554.1_4 Forward -128 -118 16.1063 0.0189
NP_441885.1_5 Reverse -120 -130 20.9245 0.000538
NP_441885.1_5 Forward -347 -337 11.7798 0.00668
NP_441885.1_5 Forward -129 -119 11.3864 0.00668
NP_441885.1_5 Reverse -338 -348 11.0914 0.00874
NP_441885.1_5 Reverse -290 -300 -1.29827 0.259
NP_442703.1_9 Reverse -100 -118 4.24738 0.26
NP_442341.1_7 Reverse -119 -133 7.66941 0.0994
NP_442341.1_7 Reverse -337 -351 6.29277 0.13
NP_442341.1_7 Reverse -200 -214 2.16287 0.267
NP_442341.1_9 Reverse -118 -132 18.4851 0.0166
NP_442341.1_9 Reverse -336 -350 8.75042 0.166
NP_442341.1_9 Forward -131 -117 6.39049 0.228
NP_440423.1_6 Reverse -282 -301 -16.0285 0.229
NP_440423.1_6 Reverse -112 -131 -16.1268 0.231
NP_443000.1_7 Reverse -118 -128 17.4829 0.00719
NP_443000.1_7 Forward -349 -339 10.3048 0.0345
NP_443000.1_7 Forward -131 -121 10.3048 0.0345
NP_443000.1_7 Reverse -39 -49 5.48657 0.131
NP_443000.1_7 Reverse -336 -346 1.25834 0.26
NP_440507.2_3 Forward -356 -337 10.7167 0.202
NP_441842.1_10 Forward -354 -340 10.521 0.161
NP_441842.1_10 Reverse -331 -345 9.04604 0.2
NP_441842.1_10 Reverse -343 -357 7.27608 0.264
NP_440275.1_3 Reverse -118 -128 9.12481 0.055
NP_440275.1_3 Forward -349 -339 8.04317 0.0602
NP_440275.1_3 Forward -131 -121 8.04317 0.0602
NP_440091.1_1 Reverse -116 -128 8.9871 0.0567
NP_441207.1_7 Reverse -65 -79 7.80321 0.295
NP_442495.1_2 Reverse -123 -142 14.9458 0.266
NP_440149.1_8 Reverse -120 -139 9.24257 0.0549
NP_440149.1_8 Reverse -338 -357 3.73603 0.0903
NP_441105.1_3 Forward -140 -121 0.687771 0.122
NP_441105.1_3 Reverse -115 -134 -6.78538 0.241
NP_441105.1_3 Forward -358 -339 -9.83364 0.297
NP_440216.1_1 Forward -129 -115 5.99778 0.0166
NP_440216.1_1 Reverse -120 -134 -10.3252 0.145
NP_440216.1_1 Forward -347 -333 -12.4884 0.274
NP_440678.1_7 Reverse -98 -117 20.7473 0.264
NP_440172.1_1 Forward -129 -119 17.5813 0.00421
NP_440172.1_1 Forward -347 -337 16.008 0.009
NP_440172.1_1 Reverse -120 -130 15.0247 0.00945
NP_440172.1_1 Reverse -338 -348 5.19158 0.149
NP_442015.1_10 Forward -133 -120 19.8821 0.00366
NP_442015.1_10 Forward -351 -338 10.1474 0.0402
NP_441226.1_7 Forward -346 -339 14.4934 0.0123
NP_441226.1_7 Reverse -339 -346 14.4934 0.0123
NP_441226.1_7 Forward -128 -121 14.4934 0.0123
NP_441226.1_7 Reverse -121 -128 14.4934 0.0123
NP_441226.1_7 Reverse -276 -283 8.29857 0.205
NP_441111.1_7 Forward -128 -120 18.7023 0.00294
NP_441111.1_7 Reverse -339 -347 18.7023 0.00294
NP_441111.1_7 Reverse -121 -129 18.7023 0.00294
NP_441111.1_7 Forward -346 -338 8.96754 0.0463
NP_442379.1_10 Forward -136 -119 -1.43612 0.223
NP_442379.1_10 Reverse -113 -130 -3.8944 0.272
NP_439971.2_3 Reverse -141 -160 19.4146 0.134
NP_441177.1_7 Reverse -136 -155 12.88 0.199
NP_441766.1_2 Reverse -338 -347 18.2893 0.00297
NP_441766.1_2 Forward -129 -120 17.5026 0.00297
NP_441766.1_2 Reverse -120 -129 17.5026 0.00297
NP_441766.1_2 Forward -347 -338 9.14451 0.0337
NP_441766.1_2 Forward -299 -290 1.76968 0.276
NP_440416.1_9 Forward -354 -335 -5.40875 0.0797
NP_440416.1_9 Forward -136 -117 -15.5368 0.193
NP_440416.1_9 Forward -300 -281 -19.8634 0.279
NP_440416.1_9 Forward -183 -164 -21.24 0.293
NP_440416.1_9 Reverse -343 -362 -21.83 0.297
NP_443052.1_8 Reverse -110 -129 -4.6221 0.119
NP_442116.1_6 Forward -231 -214 7.69149 0.254
NP_442154.1_1 Forward -158 -140 -8.14232 0.157
NP_440261.1_5 Reverse -339 -352 -10.4038 0.201
NP_440261.1_5 Reverse -121 -134 -10.4038 0.201
NP_440988.1_10 Reverse -336 -350 7.80321 0.215
NP_440988.1_10 Reverse -118 -132 6.2542 0.232
NP_440988.1_10 Forward -355 -341 3.54345 0.289
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGATTATCGCTCCTGCTCTGAAACTGACCGGGAACCGGTGCTCTGTCGCCTTGGCGATCGCGAAATTGAAGAATTTTTGGGGGGCACCCTCTGATATTCTCCCGGTAGCCATAACTGGGATGGGATGTGGAGGGGCATAGGAGGTGACTATTTGTTGGTTCACTTAGGAATTTTGGACAGAACTTTGGTGGTTAACCACACACTGTCGCCAAACTTGCCCCATTTTGCTCCGAGGGAATTTTCTGGGGTTGGTGTTGCGGGAAAAGCCTTGGCGATCGCCTTTTTTTGTCCTCAATTTTTGGCCGGATGTTTTTTCCTGTTTAATAAAATCTTTCTAATTGTCTTAAGATGTGAACGCAAGGCCGTCCTCAAGGGCGGGGTTTCAGACCCATTTTTTCG

CDS

ATGAATAACCAACAACTTTGGCAACGTTATCAAGATTGGCTTTATTACCATGGTGGCCTCGATTTTTACCTGGATGTGAGCCGCATGGGATTTAGTGATGCTTTGGTAGAAGATTTGCAACCCAAGTTTGCCAAAGCTTTTCAAGATATGGTGGCGCTGGAAAAAGGGGCGATCGCCAACCCAGACGAACAACGCATGGTGGGGCATTACTGGCTACGCAATCCGGCCCTGGCCCCCAATGATGGGATCCGGGCTGAAATCACTGAACCATTACGGCAAATCAAAGCCTTTGTCGCTGACGTACACCAAGGGAACATAAAACCCCCCACAGCCCCTAAATTTACCGACCTGCTGGCGATCGGCATTGGTGGTTCGGCTCTAGGCCCCCAATTTGTGGCCCAGGCCTTGGCCCCCAATTTCCCTCCCTTGGCGATTCACTTCATCGATAACTCTGACCCCGACGGCATTGACCGGGTGCTGAACTGCTTAAAAGCCCAAGACAAACTAAAAAGTACGCTAGTGGTGACCACTAGTAAATCCGGCGGCACCCCCGAACCCCGCAATGGTCTGGCGGAAACGAAGGCAGTATTTGAAGCCCAGGGCCTTCATTTTGCCGATTATGCGGTGGCGGTGACCATGCCCGGCAGTAAACTTTCCCAGCAGGCCCAGACGGAACAATGGTTACAAGCTTTTCCCATGCAGGATTGGGTGGGTGGGAGAACCTCTGAGTTATCGGCGGTGGGACTATTACCGGCCGCTCTCCAGGGCATTGACATTCAGGCCATGCTCGACGGGGCTAAAACCATGGATGAAGCCACTAGGGTGAGGGAATTAAGACAAAATCCAGCGGCTCTATTGGCGTTAGCTTGGTATTATGCCGGGGATGGCCAAGGGAAAAAAGACATGGTGATTCTCCCCTATAAAGATAGGCTGTTGTTATTTAGTCGCTATTTGCAACAGTTGGTTATGGAATCCCTCGGTAAAGAGCGGGATTTGGATGGCAATGTGGTCCACCAGGGCATTGCAGTCTATGGCAATAAGGGTTCTACGGATCAACATGCCTACGTCCAGCAGTTGCGGGATGGGGTGCCCAACTTTTTTGCCACTTTCATTGAGGTATTGCACGATCGCCAAGGGCCATCCCTAGAGTTAGAGCCGGGGGTCACCAGTGGGGATTATTTATCGGGATTTTTGCAGGGCACCAGGCAAGCGCTATTTGAAAATCAACGGGACTCCATCACTGTCACCATTCCCGAGGTGGACGCTACCAGCGTTGGGGCTTTGATTGCCCTATATGAAAGAGCAGTGAGTTTTTATGGTTCCTTGGTGAACGTCAACGCCTACCATCAACCGGGGGTAGAAGCGGGGAAAAAGGCCGCCGCCTCGATTTTGGAACTACAGAAGGCGATTCTCTCTACCCTACAAAATGAATCCGGGCCCATTGCCCTAGAAGCGTTGGCCACCAAAGTGCAAGCACCAGAACAGGTGGAAACGGTGTATAAAATAGTCCGCCATTTAGCCGCCAATGACCGGGGCGTGACCCTCCAGGGCGATCGCCAATTTCCCCAACGGCTGCAAATCCAGTGGCGGAGTTAA

Protein

MNNQQLWQRYQDWLYYHGGLDFYLDVSRMGFSDALVEDLQPKFAKAFQDMVALEKGAIANPDEQRMVGHYWLRNPALAPNDGIRAEITEPLRQIKAFVADVHQGNIKPPTAPKFTDLLAIGIGGSALGPQFVAQALAPNFPPLAIHFIDNSDPDGIDRVLNCLKAQDKLKSTLVVTTSKSGGTPEPRNGLAETKAVFEAQGLHFADYAVAVTMPGSKLSQQAQTEQWLQAFPMQDWVGGRTSELSAVGLLPAALQGIDIQAMLDGAKTMDEATRVRELRQNPAALLALAWYYAGDGQGKKDMVILPYKDRLLLFSRYLQQLVMESLGKERDLDGNVVHQGIAVYGNKGSTDQHAYVQQLRDGVPNFFATFIEVLHDRQGPSLELEPGVTSGDYLSGFLQGTRQALFENQRDSITVTIPEVDATSVGALIALYERAVSFYGSLVNVNAYHQPGVEAGKKAAASILELQKAILSTLQNESGPIALEALATKVQAPEQVETVYKIVRHLAANDRGVTLQGDRQFPQRLQIQWRS