Your browser is old and dusty. Try Google Chrome!

Details for slr1338

ORF slr1338
Accession NP_441472.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441453.1_4 Reverse -134 -142 11.9175 0.0344
NP_442151.1_6 Forward -115 -101 11.406 0.101
NP_442752.1_4 Forward -136 -129 10.8555 0.0846
NP_442975.1_10 Forward -311 -297 4.71887 0.241
NP_440061.1_9 Reverse -132 -146 5.70218 0.275
NP_442242.1_4 Forward -114 -107 9.47889 0.251
NP_442981.1_10 Forward -73 -54 17.7974 0.274
NP_441208.1_1 Forward -133 -114 -6.49039 0.287
NP_442110.1_7 Forward -149 -135 1.37622 0.23
NP_440300.1_5 Forward -389 -371 12.225 0.271
NP_441772.1_8 Forward -343 -324 20.7464 0.136
NP_441149.1_7 Forward -169 -150 0.491109 0.28
NP_441434.1_1 Forward -47 -33 9.84729 0.237
NP_441434.1_1 Reverse -88 -102 9.36983 0.24
NP_441434.1_1 Reverse -174 -188 7.3645 0.284
NP_441434.1_1 Forward -281 -267 7.26901 0.287
NP_442889.1_8 Forward -303 -289 8.94708 0.107
NP_442889.1_8 Forward -118 -104 5.50552 0.226
NP_441713.1_1 Reverse -117 -136 -13.1769 0.252
NP_441716.1_1 Forward -136 -122 5.60446 0.224
NP_441716.1_2 Forward -366 -347 3.35565 0.229
NP_441327.1_1 Forward -291 -272 3.92505 0.276
NP_441327.1_1 Reverse -272 -291 3.63672 0.277
NP_440438.2_8 Reverse -326 -345 4.62101 0.218
NP_440747.1_10 Reverse -124 -136 -12.2524 0.254
NP_442145.1_4 Reverse -325 -344 4.43995 0.282
NP_442145.1_4 Forward -188 -169 2.91208 0.299
NP_442145.1_4 Forward -248 -229 2.53011 0.299
NP_440470.1_5 Reverse -40 -59 6.06331 0.28
NP_443018.1_3 Reverse -135 -142 10.4622 0.103
NP_443018.1_3 Forward -142 -135 4.36568 0.254
NP_441077.1_2 Forward -248 -229 0.238307 0.299
NP_441077.1_6 Reverse -223 -239 4.05516 0.261
NP_441846.1_10 Forward -137 -118 -20.65 0.256
NP_441013.1_2 Reverse -133 -151 1.39578 0.248
NP_441013.1_2 Forward -154 -136 -3.81576 0.292
NP_441080.1_7 Forward -356 -338 11.7197 0.238
NP_441855.2_4 Reverse -126 -145 14.0542 0.156
NP_442205.1_9 Reverse -292 -308 -3.67804 0.291
NP_441414.1_9 Forward -115 -96 -9.83364 0.269
NP_441137.1_3 Reverse -324 -343 14.3711 0.273
NP_442690.1_1 Forward -353 -334 -15.0452 0.277
NP_442911.1_1 Forward -343 -330 14.0991 0.298
NP_441099.1_5 Forward -206 -187 -8.65367 0.201
NP_441712.1_1 Forward -51 -32 10.1007 0.282
NP_441294.1_7 Forward -119 -105 9.53859 0.241
NP_442438.1_10 Forward -120 -106 9.14437 0.0692
NP_440147.1_4 Reverse -132 -145 4.05085 0.173
NP_441916.1_7 Forward -143 -133 4.60159 0.169
NP_441369.1_1 Reverse -363 -382 38.7419 0.000000157
NP_441369.1_3 Reverse -346 -360 28.5156 0.00021
NP_441568.1_6 Reverse -204 -222 12.034 0.27
NP_442941.1_3 Forward -114 -104 -1.19994 0.288
NP_442941.1_5 Reverse -108 -122 14.716 0.272
NP_441514.1_4 Forward -281 -262 13.9592 0.25
NP_442281.1_1 Reverse -129 -143 4.91554 0.176
NP_441079.1_7 Forward -341 -322 -3.73788 0.238
NP_441079.1_7 Forward -350 -331 -7.96609 0.298
NP_442288.1_5 Reverse -361 -375 16.7159 0.12
NP_441556.1_6 Reverse -365 -383 12.4797 0.296
NP_441644.1_6 Reverse -134 -144 3.51951 0.277
NP_442029.1_6 Forward -148 -129 17.404 0.0883
NP_442247.1_5 Forward -390 -376 14.4865 0.234
NP_442933.1_10 Forward -143 -134 4.62128 0.227
NP_442671.1_2 Reverse -371 -390 24.6829 0.000359
NP_442970.1_1 Reverse -373 -387 9.56081 0.269
NP_443009.1_5 Reverse -105 -116 5.95804 0.18
NP_441865.1_3 Forward -358 -340 13.8838 0.242
NP_441741.1_6 Forward -52 -33 8.55425 0.249
NP_440620.1_4 Forward -104 -90 15.2903 0.236
NP_442076.1_5 Reverse -367 -386 9.93088 0.186
NP_441468.1_1 Forward -142 -135 4.07068 0.263
NP_441015.1_10 Forward -148 -129 -2.55715 0.178
NP_441764.1_10 Reverse -222 -241 18.8592 0.231
NP_440871.1_3 Forward -367 -353 15.905 0.166
NP_440111.2_2 Forward -154 -135 -4.81876 0.292
NP_442593.1_9 Reverse -89 -108 14.327 0.278
NP_441036.1_9 Reverse -274 -292 8.96727 0.22
NP_441739.1_2 Reverse -232 -248 12.5458 0.132
NP_441739.1_2 Forward -105 -89 2.61447 0.288
NP_441458.1_10 Forward -152 -133 8.55425 0.186
NP_441819.1_5 Forward -342 -323 10.7424 0.261
NP_441819.1_5 Reverse -271 -290 10.074 0.261
NP_441819.1_5 Forward -253 -234 8.35512 0.295
NP_441574.1_5 Reverse -220 -239 11.7992 0.186
NP_442590.1_10 Forward -143 -124 4.03102 0.282
NP_442998.1_5 Reverse -194 -204 12.5664 0.165
NP_440899.1_8 Forward -386 -367 -9.14533 0.258
NP_440299.1_1 Reverse -130 -143 2.18201 0.294
NP_441799.1_1 Reverse -130 -144 10.1271 0.0797
NP_440256.1_1 Reverse -131 -150 -5.99873 0.198
NP_441362.1_2 Reverse -369 -388 5.55684 0.243
NP_440915.1_6 Forward -147 -133 -1.67204 0.243
NP_440733.1_2 Reverse -339 -357 18.8139 0.102
NP_442452.1_8 Forward -196 -182 12.0937 0.273
NP_440537.1_7 Reverse -347 -366 16.6629 0.0599
NP_441464.1_2 Forward -151 -141 12.9597 0.299
NP_440695.1_6 Reverse -150 -164 14.7744 0.208
NP_440695.1_6 Forward -159 -145 11.3809 0.265
NP_441939.1_4 Forward -314 -295 17.8088 0.137
NP_442386.1_9 Reverse -133 -142 11.4057 0.0942
NP_441340.1_5 Forward -142 -135 4.07068 0.239
NP_440586.1_8 Reverse -135 -142 7.61025 0.227
NP_440027.1_3 Reverse -124 -142 8.3765 0.193
NP_443051.1_1 Reverse -105 -114 -0.0986038 0.256
NP_440372.1_2 Forward -142 -135 4.07068 0.262
NP_440372.1_3 Reverse -374 -388 15.0039 0.165
NP_442493.1_6 Reverse -73 -91 15.2604 0.261
NP_442085.1_1 Forward -334 -315 10.265 0.278
NP_441877.1_9 Forward -344 -327 2.79211 0.285
NP_441018.1_7 Reverse -102 -121 6.09597 0.299
NP_442262.1_10 Reverse -135 -142 10.6589 0.14
NP_442917.1_1 Forward -109 -90 7.66846 0.254
NP_442129.1_6 Reverse -372 -391 13.9464 0.246
NP_440888.1_2 Reverse -134 -148 9.93039 0.11
NP_442454.1_2 Forward -187 -168 12.5568 0.251
NP_440792.1_4 Reverse -132 -151 10.7175 0.189
NP_441543.1_2 Forward -114 -105 9.83282 0.0818
NP_441543.1_2 Reverse -299 -308 4.91628 0.213
NP_442710.1_7 Reverse -370 -389 -7.22274 0.294
NP_443064.1_6 Reverse -127 -137 12.1791 0.0975
NP_442578.1_7 Reverse -299 -306 9.38056 0.138
NP_442578.1_7 Forward -114 -107 9.28223 0.152
NP_440936.1_2 Forward -244 -225 23.5989 0.0113
NP_442204.1_2 Reverse -177 -196 7.96426 0.263
NP_442428.1_5 Forward -142 -135 4.46401 0.267
NP_440673.1_3 Reverse -136 -143 13.2155 0.0426
NP_441884.1_8 Forward -144 -125 -5.70374 0.194
NP_442694.1_8 Forward -387 -369 12.3105 0.191
NP_441851.1_9 Reverse -53 -72 10.8159 0.234
NP_440338.1_4 Reverse -166 -185 7.37347 0.28
NP_442689.1_8 Forward -387 -370 -8.61428 0.294
NP_442843.1_1 Forward -142 -123 2.45773 0.161
NP_442843.1_3 Reverse -75 -94 10.6192 0.0878
NP_441124.1_5 Forward -343 -333 13.6766 0.215
NP_441124.1_5 Reverse -366 -376 12.7217 0.215
NP_441031.1_1 Reverse -273 -292 6.82273 0.259
NP_441570.1_1 Reverse -106 -124 -11.0923 0.187
NP_441570.1_1 Forward -136 -118 -17.7788 0.291
NP_441078.1_4 Reverse -106 -115 -1.47524 0.266
NP_441432.1_8 Reverse -105 -114 5.70292 0.144
NP_441432.1_9 Reverse -91 -104 9.27706 0.28
NP_440760.1_1 Forward -115 -96 -23.305 0.293
NP_442400.1_10 Forward -38 -25 10.5659 0.26
NP_442400.1_10 Forward -339 -326 7.31916 0.29
NP_441659.2_8 Reverse -134 -144 1.06167 0.251
NP_442749.1_5 Forward -250 -233 11.9836 0.174
NP_441040.1_5 Reverse -129 -148 5.70265 0.229
NP_440315.1_7 Forward -104 -85 17.1382 0.233
NP_442346.1_5 Reverse -105 -115 6.8632 0.188
NP_440545.1_2 Forward -61 -42 13.4819 0.296
NP_441856.1_3 Forward -118 -99 -3.73712 0.299
NP_440743.1_8 Reverse -242 -261 15.3382 0.215
NP_441047.1_2 Reverse -135 -154 10.7175 0.113
NP_441329.1_1 Forward -345 -326 13.7027 0.175
NP_441329.1_6 Forward -279 -260 -1.67153 0.293
NP_441973.1_6 Reverse -323 -341 14.8015 0.271
NP_442943.1_1 Forward -290 -275 15.26 0.0725
NP_440830.1_4 Forward -20 -2 20.6832 0.279
NP_442140.1_3 Forward -142 -132 5.68323 0.198
NP_442140.1_3 Reverse -135 -145 4.10993 0.261
NP_442254.1_1 Reverse -178 -197 -6.29373 0.297
NP_440227.1_6 Forward -292 -278 14.6219 0.263
NP_441239.1_9 Reverse -132 -144 5.93884 0.202
NP_440156.1_4 Reverse -233 -243 12.9592 0.176
NP_442643.1_5 Reverse -74 -93 -1.18052 0.265
NP_441541.1_1 Forward -344 -326 -3.91318 0.27
NP_441541.1_7 Reverse -202 -220 9.22679 0.294
NP_440546.1_4 Forward -143 -133 14.7 0.0459
NP_440546.1_4 Reverse -134 -144 8.20381 0.199
NP_442479.1_9 Forward -50 -31 -7.08038 0.266
NP_441672.1_10 Forward -141 -122 21.8289 0.0526
NP_441959.1_8 Reverse -373 -386 8.61288 0.286
NP_441102.1_2 Forward -249 -230 5.70265 0.298
NP_441252.1_2 Reverse -326 -344 17.9835 0.208
NP_442532.1_1 Forward -280 -266 15.5556 0.215
NP_442532.1_2 Reverse -339 -358 -0.143661 0.299
NP_442532.1_4 Reverse -322 -340 22.6055 0.0155
NP_442532.1_4 Forward -250 -232 9.32234 0.273
NP_441011.1_8 Forward -142 -133 11.1111 0.0855
NP_440068.1_1 Forward -130 -111 -3.63879 0.249
NP_442533.1_6 Reverse -134 -143 2.75299 0.241
NP_442541.1_10 Forward -159 -145 1.47397 0.286
NP_440263.1_5 Forward -247 -233 17.4042 0.172
NP_440854.1_5 Forward -51 -37 14.5264 0.274
NP_441697.1_5 Reverse -331 -350 -10.6478 0.28
NP_441697.1_5 Reverse -197 -216 -11.4117 0.295
NP_440116.1_8 Forward -131 -112 -9.83364 0.29
NP_441680.1_4 Reverse -135 -154 -0.787193 0.256
NP_441602.1_3 Forward -148 -129 -5.60541 0.291
NP_441420.1_4 Forward -133 -114 11.6025 0.282
NP_442881.1_1 Forward -53 -34 17.5015 0.123
NP_441930.1_2 Forward -121 -111 12.3697 0.262
NP_439940.1_1 Reverse -345 -364 31.957 0.00000438
NP_440387.1_1 Reverse -298 -314 -5.448 0.232
NP_441431.1_1 Forward -388 -370 5.06306 0.245
NP_442224.1_1 Reverse -132 -151 6.09597 0.164
NP_440766.1_4 Reverse -183 -197 1.96621 0.205
NP_440422.1_10 Reverse -310 -329 9.24252 0.212
NP_442930.1_1 Forward -50 -40 14.0409 0.239
NP_442930.1_1 Reverse -232 -242 13.0576 0.239
NP_440987.1_6 Forward -342 -323 11.3948 0.247
NP_440798.1_1 Forward -241 -223 11.7014 0.294
NP_440798.1_6 Forward -142 -129 2.2809 0.182
NP_441489.1_3 Forward -247 -233 8.31942 0.244
NP_441489.1_3 Reverse -90 -104 6.98253 0.287
NP_440081.1_4 Forward -222 -203 16.9008 0.183
NP_442582.1_3 Forward -249 -235 12.903 0.284
NP_442582.1_3 Reverse -333 -347 12.6166 0.284
NP_440554.1_4 Reverse -135 -145 5.09324 0.162
NP_440478.1_10 Reverse -132 -146 6.58777 0.288
NP_441173.1_9 Reverse -238 -246 10.9338 0.242
NP_440191.1_6 Reverse -270 -284 13.3805 0.294
NP_440191.1_6 Forward -388 -374 13.1895 0.294
NP_440091.1_1 Forward -119 -107 7.11881 0.0874
NP_442451.1_7 Reverse -368 -387 12.9791 0.113
NP_441389.1_5 Forward -256 -237 10.7175 0.265
NP_440804.1_7 Forward -103 -86 12.2311 0.175
NP_441226.1_7 Reverse -135 -142 11.2485 0.0971
NP_443052.1_8 Forward -125 -106 -2.95047 0.0955
NP_442116.1_6 Reverse -273 -290 8.93289 0.238
NP_442116.1_6 Forward -389 -372 7.50051 0.254
NP_442116.1_6 Reverse -333 -350 5.87715 0.289
NP_442154.1_1 Forward -142 -124 -15.4188 0.218
NP_441430.1_2 Reverse -108 -127 2.26107 0.132
NP_440261.1_7 Forward -302 -283 -1.96717 0.19
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTGTACACTCCATAATTTTACATTAAATTCTCTCATCGTTAATTGAAATGACTATATTTTTAAAATTTCTAGAAACTTAGCTATAAAGTCTTAATTTATCGCCTCTAGCTAAATTGTTTAAAAATAATATAAGTAGGCGTAGTCAGAACTACAATTTGGAGAAATTTTAACTGATTATGTTATTTCATTATTATCTAAATCTGTCCCGGTCGAAATTGAGAATCTTTTAACTGTTCTAGGCGGAAATTTCCAGCTCTAGCGATGGGTGAGCGTGAGGCAGGGAACTGCGATAACCTAAAATTTGACTAAATTAACCCCTGAAGAATCAGAATTATCTCACTGACAGGCCTAAAAAATTTCCTATAATTGACAACAAGCTCATTTTACAAGCAGGTTCAGC

CDS

ATGTCAAACCAACGGGATTACACGCTCATTATTGATAAAAGCGGTAGCATGTCCATCATTGAGCCAAAATTCCAAAAAAGCCGATGGGAGCTAGTTCAAGAATCAACCCTCGCCCTTGCCAGAAAATGTGACCAGCTAGATGCTAACGGAATCACAGTGTACACTTTCTCCGGCAAATTCCGCCGTTATGACAACGTTAACGCATCTAAAGTGGAGCAAATTTTTCAAGAAAATGAACCAGTGGGTGGTACTAATCTCACCGCTGTGTTACAAGATGCGCTCAATAATTTTTTACAACGAAAAAAATCTAATCAGGCTCCAACAGGAGAAACTATTTTAGTCATTACGGATGGAGAACCCAATGACCGTAGATCCGTTTTTGAAATCATTATCCAAGCCAGTAAGTGTCTAGATGCGGATGAAGAATTAGCTATTTCATTCATGCAAATTGGGAATGATCCCAGTGCCACCAAGTTTCTCCAGGCCCTTGATGATCAATTAATGGAAGTAGGAGCCAAGTTTGATATTGTTGATACGGTAACCTTTGATGAAATGGAAGACCTAACTTTAACTGAAGTTTTATTAAATGCTATTGAGGATTGA

Protein

MSNQRDYTLIIDKSGSMSIIEPKFQKSRWELVQESTLALARKCDQLDANGITVYTFSGKFRRYDNVNASKVEQIFQENEPVGGTNLTAVLQDALNNFLQRKKSNQAPTGETILVITDGEPNDRRSVFEIIIQASKCLDADEELAISFMQIGNDPSATKFLQALDDQLMEVGAKFDIVDTVTFDEMEDLTLTEVLLNAIED