Your browser is old and dusty. Try Google Chrome!

Details for slr1332

ORF slr1332
Accession NP_441410.1
Symbol
Category beta ketoacyl-acyl carrier protein synthase
Definition Fatty acid, phospholipid and sterol metabolism
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -83 -97 4.81781 0.143
NP_440795.1_7 Forward -90 -83 14.6904 0.0123
NP_440795.1_7 Reverse -83 -90 14.6904 0.0123
NP_441418.1_1 Reverse -268 -287 7.97315 0.275
NP_441418.1_6 Forward -116 -97 -19.6667 0.093
NP_441418.1_6 Forward -173 -154 -29.6965 0.234
NP_441418.1_6 Reverse -82 -101 -29.9915 0.249
NP_441453.1_4 Reverse -82 -90 16.539 0.00633
NP_441453.1_4 Forward -91 -83 16.539 0.00633
NP_441623.1_1 Forward -388 -370 2.57575 0.206
NP_442151.1_6 Forward -91 -77 16.0275 0.0187
NP_440226.1_1 Forward -91 -72 2.75272 0.253
NP_441630.1_3 Reverse -74 -93 -0.197208 0.285
NP_441098.1_3 Forward -293 -274 -4.20496 0.28
NP_442655.1_10 Forward -110 -91 -10.1286 0.22
NP_442173.1_1 Forward -90 -82 15.4574 0.00633
NP_442173.1_1 Reverse -83 -91 15.4574 0.00633
NP_442752.1_4 Forward -91 -84 13.8055 0.0199
NP_442752.1_4 Reverse -82 -89 13.8055 0.0199
NP_442752.1_4 Forward -179 -172 10.5605 0.1
NP_443027.1_4 Forward -93 -83 16.2046 0.0437
NP_443027.1_4 Reverse -80 -90 7.25653 0.24
NP_442975.1_10 Reverse -78 -92 9.53707 0.068
NP_442975.1_10 Forward -95 -81 4.32555 0.245
NP_440784.1_7 Forward -90 -83 15.9687 0.0123
NP_440784.1_7 Reverse -83 -90 15.9687 0.0123
NP_440928.1_5 Reverse -297 -315 12.6055 0.16
NP_442062.1_8 Reverse -82 -92 10.3048 0.0493
NP_442062.1_8 Forward -91 -81 10.3048 0.0493
NP_442062.1_8 Reverse -246 -256 6.8632 0.116
NP_442062.1_10 Reverse -246 -265 20.8456 0.0316
NP_440761.1_4 Reverse -77 -96 -14.4552 0.263
NP_441900.1_1 Forward -61 -42 11.4342 0.224
NP_441900.1_2 Reverse -163 -181 -6.76639 0.297
NP_442581.1_1 Reverse -368 -382 7.76774 0.262
NP_441859.1_3 Forward -120 -101 4.52188 0.221
NP_441859.1_3 Reverse -97 -116 2.16195 0.266
NP_440304.1_4 Forward -93 -83 19.9412 0.00364
NP_440304.1_4 Reverse -80 -90 10.8948 0.051
NP_440304.1_4 Reverse -27 -37 4.50326 0.261
NP_442242.1_4 Forward -90 -83 14.3954 0.0124
NP_442242.1_4 Reverse -83 -90 14.3954 0.0124
NP_441781.1_7 Forward -38 -19 -2.85214 0.289
NP_441935.1_1 Reverse -46 -65 14.2574 0.154
NP_441619.1_8 Forward -97 -83 6.58715 0.295
NP_441208.1_9 Reverse -79 -93 7.66941 0.22
NP_441594.1_6 Forward -182 -163 5.11266 0.209
NP_442110.1_7 Reverse -82 -96 11.3077 0.061
NP_441925.1_4 Reverse -88 -107 -7.86776 0.202
NP_441083.1_5 Forward -91 -81 11.2881 0.0159
NP_441083.1_5 Reverse -82 -92 11.2881 0.0159
NP_442827.1_8 Reverse -74 -93 0.195343 0.214
NP_442827.1_8 Reverse -162 -181 -2.36125 0.274
NP_441738.1_2 Forward -89 -82 15.28 0.0102
NP_441738.1_2 Reverse -84 -91 15.28 0.0102
NP_441738.1_2 Forward -370 -363 6.52862 0.261
NP_441558.1_5 Forward -93 -74 14.4541 0.0485
NP_440209.1_1 Reverse -82 -90 18.1123 0.00295
NP_440209.1_1 Forward -91 -83 18.1123 0.00295
NP_442889.1_8 Reverse -79 -93 6.0955 0.203
NP_440447.1_1 Forward -96 -78 2.87075 0.274
NP_440447.1_6 Reverse -74 -92 4.73903 0.163
NP_441713.1_1 Forward -261 -242 0.0977854 0.0902
NP_441713.1_1 Forward -97 -78 -8.94866 0.162
NP_441713.1_1 Reverse -76 -95 -13.3736 0.255
NP_442675.1_4 Forward -181 -163 -3.42244 0.257
NP_440178.1_7 Reverse -169 -188 -13.4719 0.136
NP_442445.1_1 Forward -96 -77 14.9458 0.167
NP_441716.1_1 Reverse -82 -96 3.93283 0.259
NP_441716.1_1 Forward -107 -93 3.53951 0.261
NP_442111.1_4 Reverse -81 -95 15.8309 0.0194
NP_442111.1_4 Forward -92 -78 7.27608 0.101
NP_440343.1_3 Reverse -145 -163 7.29487 0.211
NP_440343.1_3 Reverse -310 -328 6.40989 0.234
NP_440906.1_5 Forward -90 -83 15.8704 0.0124
NP_440906.1_5 Reverse -83 -90 15.8704 0.0124
NP_442596.1_10 Forward -109 -90 13.4708 0.234
NP_440747.1_10 Forward -94 -82 7.80712 0.00223
NP_440747.1_10 Reverse -79 -91 5.44718 0.0137
NP_441854.1_10 Forward -319 -300 1.37609 0.282
NP_441486.1_1 Forward -35 -21 -2.26202 0.175
NP_441486.1_1 Forward -94 -80 -2.55701 0.175
NP_441486.1_1 Reverse -79 -93 -4.7203 0.205
NP_441486.1_1 Reverse -26 -40 -5.70361 0.254
NP_442330.1_4 Forward -53 -34 15.922 0.233
NP_442634.1_4 Reverse -80 -94 16.9125 0.01
NP_442634.1_4 Forward -93 -79 -1.77037 0.149
NP_441014.1_10 Forward -33 -14 -2.16459 0.274
NP_441014.1_10 Reverse -28 -47 -3.44288 0.3
NP_442848.1_1 Forward -97 -83 -3.83532 0.273
NP_443018.1_3 Forward -90 -83 14.8871 0.0123
NP_443018.1_3 Reverse -83 -90 14.8871 0.0123
NP_441316.1_7 Forward -93 -78 11.583 0.06
NP_440376.1_1 Forward -91 -82 19.4693 0.000692
NP_440376.1_1 Reverse -82 -91 19.4693 0.000692
NP_440376.1_1 Reverse -246 -255 1.86802 0.238
NP_441588.1_4 Forward -89 -79 13.943 0.0841
NP_442687.1_7 Forward -92 -82 9.02648 0.0994
NP_442687.1_7 Reverse -81 -91 9.02648 0.0994
NP_442687.1_7 Forward -256 -246 5.28991 0.211
NP_442485.1_3 Forward -102 -83 -3.44213 0.274
NP_442583.1_8 Forward -102 -83 9.63589 0.238
NP_441422.1_7 Reverse -80 -97 -5.36936 0.247
NP_440529.1_7 Forward -102 -83 8.94757 0.293
NP_442658.1_1 Reverse -80 -90 13.0576 0.04
NP_442658.1_1 Forward -93 -83 13.0576 0.04
NP_442658.1_1 Forward -257 -247 8.73102 0.181
NP_442782.1_2 Reverse -82 -96 13.7659 0.173
NP_442782.1_2 Reverse -241 -255 9.43936 0.198
NP_442782.1_2 Forward -255 -241 3.14618 0.267
NP_442782.1_2 Reverse -242 -256 1.67122 0.281
NP_442205.1_9 Forward -97 -81 16.7748 0.0219
NP_441414.1_9 Forward -91 -72 15.2408 0.0114
NP_442937.1_5 Reverse -162 -181 6.39097 0.28
NP_442321.1_1 Forward -22 -3 -8.55534 0.292
NP_441958.1_5 Forward -92 -82 21.2195 0.000805
NP_441958.1_5 Reverse -81 -91 21.2195 0.000805
NP_442836.1_5 Reverse -138 -157 10.1275 0.117
NP_440203.1_5 Reverse -85 -95 11.2876 0.2
NP_439905.1_1 Forward -90 -77 8.57408 0.232
NP_439905.1_5 Reverse -272 -286 11.406 0.288
NP_440984.1_7 Reverse -77 -91 21.1407 0.00311
NP_442690.1_1 Forward -286 -267 -14.2585 0.271
NP_442911.1_2 Reverse -72 -91 -1.86883 0.091
NP_440153.1_5 Reverse -83 -97 1.96621 0.241
NP_440153.1_5 Reverse -171 -185 0.392915 0.299
NP_442064.1_1 Reverse -77 -96 -5.21209 0.21
NP_442536.1_7 Forward -97 -78 6.88262 0.28
NP_442536.1_8 Forward -113 -94 11.7008 0.253
NP_440993.1_2 Forward -96 -80 1.33684 0.284
NP_442210.1_7 Reverse -381 -400 15.7324 0.178
NP_442002.1_9 Forward -256 -249 12.2322 0.185
NP_440809.1_9 Reverse -73 -91 -8.04399 0.225
NP_441938.1_10 Forward -105 -87 8.96727 0.236
NP_441646.1_1 Forward -262 -243 5.11266 0.184
NP_441646.1_1 Reverse -16 -35 1.37609 0.231
NP_442438.1_10 Forward -96 -82 13.6676 0.0338
NP_442566.1_2 Reverse -93 -112 1.17943 0.289
NP_442771.1_1 Reverse -80 -98 4.73903 0.0672
NP_440147.1_4 Reverse -80 -93 12.3107 0.0326
NP_440147.1_4 Forward -93 -80 3.16588 0.193
NP_441550.1_8 Reverse -80 -90 15.3192 0.0132
NP_441550.1_8 Forward -93 -83 13.0576 0.0273
NP_441916.1_7 Forward -91 -81 18.9579 0.00144
NP_441916.1_7 Reverse -82 -92 18.9579 0.00144
NP_441916.1_10 Forward -99 -80 7.47261 0.193
NP_440465.1_10 Forward -182 -163 9.43923 0.173
NP_441041.1_4 Reverse -82 -101 -8.45701 0.203
NP_441041.1_4 Forward -91 -72 -8.55534 0.204
NP_441041.1_4 Forward -329 -310 -13.3736 0.285
NP_441041.1_7 Reverse -79 -91 8.2922 0.139
NP_441041.1_7 Forward -94 -82 6.34865 0.211
NP_442396.1_5 Reverse -78 -91 11.9173 0.0913
NP_440569.1_6 Reverse -305 -324 6.78429 0.228
NP_442004.1_6 Reverse -82 -96 15.9292 0.0577
NP_441725.1_4 Forward -96 -82 2.5556 0.284
NP_441725.1_5 Reverse -83 -93 11.1898 0.0247
NP_441725.1_5 Forward -90 -80 1.94665 0.115
NP_439966.1_7 Forward -93 -83 14.8275 0.0177
NP_439966.1_7 Reverse -80 -90 6.27276 0.185
NP_439966.1_7 Forward -132 -122 4.60114 0.265
NP_442941.1_3 Reverse -83 -93 19.9412 0.00262
NP_442941.1_3 Forward -90 -80 11.0914 0.0116
NP_440289.1_2 Forward -94 -81 -2.93064 0.262
NP_440983.1_5 Forward -176 -157 -3.73712 0.24
NP_440983.1_5 Reverse -89 -108 -9.14533 0.3
NP_440260.1_8 Forward -100 -82 -4.60241 0.273
NP_442281.1_1 Reverse -77 -91 8.25877 0.0832
NP_442281.1_1 Forward -96 -82 7.66879 0.0949
NP_441334.1_7 Reverse -80 -99 -12.1936 0.142
NP_441079.1_7 Forward -290 -271 1.57197 0.178
NP_442256.1_2 Forward -93 -75 -7.15901 0.214
NP_001035871.2_7 Reverse -361 -371 14.1397 0.218
NP_440647.1_9 Forward -93 -75 6.60732 0.219
NP_442012.1_1 Reverse -145 -164 -1.18052 0.279
NP_441860.1_1 Reverse -199 -213 14.2889 0.281
NP_441556.1_4 Reverse -98 -117 11.7404 0.247
NP_440498.1_1 Reverse -73 -91 9.36059 0.0786
NP_440498.1_1 Forward -100 -82 7.68896 0.0827
NP_442982.1_5 Forward -101 -82 -0.983855 0.263
NP_442068.1_1 Reverse -360 -379 8.16093 0.269
NP_441644.1_6 Forward -91 -81 19.0557 0.000803
NP_441644.1_6 Reverse -82 -92 19.0557 0.000803
NP_442215.1_1 Forward -95 -76 4.916 0.247
NP_442215.1_2 Forward -40 -24 -0.236458 0.164
NP_442215.1_2 Forward -313 -297 -4.95634 0.242
NP_442215.1_2 Reverse -80 -96 -5.05468 0.244
NP_442029.1_1 Forward -109 -90 -17.7001 0.272
NP_440929.1_8 Forward -91 -82 19.2726 0.000701
NP_440929.1_8 Reverse -82 -91 19.2726 0.000701
NP_442933.1_10 Forward -91 -82 17.601 0.00325
NP_442933.1_10 Reverse -82 -91 17.601 0.00325
NP_441751.2_8 Reverse -83 -97 25.7623 0.00368
NP_441751.2_8 Forward -37 -23 -5.80194 0.239
NP_442554.1_8 Reverse -83 -93 16.9913 0.0065
NP_442554.1_8 Forward -90 -80 16.4013 0.0065
NP_441762.1_7 Forward -92 -80 0.432302 0.0747
NP_441762.1_7 Reverse -81 -93 -6.84419 0.284
NP_442142.1_4 Forward -94 -81 15.4566 0.0264
NP_442142.1_4 Reverse -95 -108 7.78685 0.13
NP_442142.1_4 Reverse -79 -92 2.96866 0.269
NP_442292.1_1 Forward -90 -81 17.5026 0.00435
NP_442292.1_1 Reverse -83 -92 17.5026 0.00435
NP_443009.1_5 Reverse -81 -92 15.7911 0.0107
NP_443009.1_5 Forward -92 -81 15.7911 0.0107
NP_443009.1_5 Forward -256 -245 3.8931 0.274
NP_441715.1_4 Reverse -83 -93 14.238 0.0295
NP_441715.1_4 Forward -90 -80 7.35486 0.108
NP_440357.1_6 Forward -341 -322 5.50599 0.279
NP_441198.1_8 Forward -93 -83 13.2713 0.108
NP_441198.1_8 Reverse -80 -90 12.783 0.116
NP_440379.1_5 Reverse -45 -64 -9.44032 0.264
NP_441468.1_1 Forward -90 -83 15.8704 0.0124
NP_441468.1_1 Reverse -83 -90 15.8704 0.0124
NP_439939.1_3 Reverse -287 -306 -2.95047 0.224
NP_441020.2_6 Forward -93 -76 14.1002 0.0613
NP_441020.2_6 Reverse -80 -97 6.62702 0.26
NP_441015.1_10 Forward -109 -90 -0.39387 0.169
NP_441015.1_10 Reverse -165 -184 -5.11376 0.217
NP_441673.1_1 Forward -91 -82 20.8459 0.000698
NP_441673.1_1 Reverse -82 -91 20.8459 0.000698
NP_441339.1_4 Reverse -295 -314 -5.21209 0.28
NP_441826.1_2 Forward -97 -83 5.1128 0.0978
NP_441330.1_1 Reverse -77 -96 -13.5702 0.195
NP_442868.1_6 Forward -257 -247 2.33998 0.205
NP_442868.1_6 Forward -93 -83 1.06167 0.205
NP_442868.1_6 Reverse -80 -90 0.963343 0.205
NP_442427.1_8 Reverse -363 -382 7.37428 0.215
NP_442808.1_1 Reverse -81 -91 8.73102 0.0481
NP_442808.1_1 Forward -92 -82 8.73102 0.0481
NP_440145.1_3 Forward -101 -82 2.16274 0.12
NP_442050.1_5 Forward -93 -83 18.0724 0.00365
NP_442050.1_5 Reverse -80 -90 9.22267 0.193
NP_440342.1_1 Reverse -14 -33 13.9625 0.203
NP_440558.1_2 Forward -100 -81 0.786102 0.185
NP_440558.1_2 Forward -41 -22 -4.81876 0.249
NP_440558.1_2 Reverse -249 -268 -4.91709 0.249
NP_441878.1_6 Forward -92 -82 10.5014 0.0176
NP_441878.1_6 Reverse -81 -91 10.5014 0.0176
NP_441878.1_8 Reverse -162 -176 20.2558 0.184
NP_441036.1_3 Forward -394 -375 4.32602 0.168
NP_441036.1_8 Forward -92 -82 15.713 0.00724
NP_441036.1_8 Reverse -81 -91 15.713 0.00724
NP_441557.1_5 Forward -91 -82 19.9609 0.000699
NP_441557.1_5 Reverse -82 -91 19.9609 0.000699
NP_441557.1_8 Reverse -90 -100 12.7626 0.235
NP_441520.1_4 Forward -71 -52 20.4417 0.0527
NP_441445.1_10 Forward -190 -171 14.3558 0.277
NP_442066.2_4 Reverse -82 -101 -8.45701 0.294
NP_442066.2_9 Reverse -78 -91 12.9006 0.154
NP_441308.1_8 Forward -93 -83 13.353 0.218
NP_440101.1_3 Reverse -77 -96 1.0811 0.284
NP_440101.1_5 Reverse -157 -176 3.04771 0.206
NP_441458.1_10 Reverse -14 -33 2.3594 0.269
NP_442192.1_8 Reverse -242 -261 14.5524 0.18
NP_442183.1_1 Reverse -82 -96 8.45605 0.115
NP_442183.1_1 Reverse -363 -377 4.52282 0.26
NP_442183.1_1 Forward -91 -77 4.22782 0.271
NP_442397.1_9 Reverse -22 -41 3.24438 0.264
NP_441574.1_1 Forward -119 -100 2.55606 0.157
NP_441574.1_1 Reverse -320 -339 0.196116 0.196
NP_441549.1_9 Reverse -78 -96 6.11567 0.0925
NP_442347.1_2 Forward -90 -81 3.34298 0.284
NP_442347.1_2 Reverse -83 -92 3.34298 0.284
NP_442645.1_2 Forward -99 -80 -7.37537 0.106
NP_442645.1_2 Forward -319 -300 -9.14533 0.136
NP_442645.1_2 Reverse -21 -40 -19.1751 0.285
NP_442645.1_2 Forward -40 -21 -20.5517 0.288
NP_441037.1_4 Reverse -80 -90 15.0168 0.028
NP_441037.1_4 Forward -93 -83 7.31769 0.237
NP_441037.1_4 Forward -257 -247 6.05075 0.283
NP_441633.1_3 Reverse -96 -109 2.47756 0.0954
NP_441633.1_3 Reverse -80 -93 -6.17557 0.238
NP_440136.1_2 Forward -90 -83 15.9687 0.0123
NP_440136.1_2 Reverse -83 -90 15.9687 0.0123
NP_442998.1_5 Forward -50 -40 11.2881 0.189
NP_442998.1_5 Forward -257 -247 8.23984 0.267
NP_442998.1_10 Forward -89 -82 15.5754 0.0102
NP_442998.1_10 Reverse -84 -91 15.5754 0.0102
NP_440299.1_1 Forward -95 -82 9.45847 0.0709
NP_440299.1_1 Reverse -78 -91 3.85363 0.228
NP_441799.1_1 Reverse -78 -92 17.9935 0.00957
NP_441799.1_1 Forward -95 -81 15.3386 0.0187
NP_441799.1_1 Forward -42 -28 6.0955 0.183
NP_441799.1_1 Reverse -166 -180 5.21053 0.218
NP_441007.1_10 Reverse -77 -90 10.5407 0.0656
NP_441007.1_10 Forward -96 -83 3.46087 0.182
NP_440256.1_1 Forward -94 -75 6.98095 0.0279
NP_440256.1_1 Reverse -305 -324 -9.14533 0.275
NP_440256.1_1 Reverse -79 -98 -9.73531 0.287
NP_440256.1_1 Forward -35 -16 -9.73531 0.287
NP_441512.1_4 Forward -95 -76 6.88262 0.295
NP_441559.1_8 Forward -96 -82 -0.983719 0.18
NP_441559.1_8 Reverse -93 -107 -6.58858 0.279
NP_440915.1_6 Forward -95 -81 10.1277 0.0346
NP_440915.1_6 Reverse -78 -92 2.85119 0.111
NP_440997.1_3 Forward -97 -78 11.8975 0.264
NP_442866.1_1 Reverse -77 -96 -7.37537 0.266
NP_440702.1_2 Forward -115 -96 -5.01543 0.257
NP_440695.1_5 Forward -91 -72 -0.295539 0.284
NP_442993.1_1 Reverse -82 -98 8.61333 0.0244
NP_440677.1_6 Forward -100 -81 11.3075 0.234
NP_442386.1_9 Reverse -22 -31 8.35743 0.201
NP_442386.1_9 Forward -92 -83 6.39082 0.219
NP_442386.1_9 Reverse -81 -90 6.39082 0.219
NP_442386.1_10 Forward -107 -94 5.23083 0.262
NP_440570.1_5 Reverse -292 -311 0.687771 0.254
NP_441750.1_1 Forward -158 -139 1.27776 0.182
NP_441340.1_5 Forward -90 -83 15.6737 0.0124
NP_441340.1_5 Reverse -83 -90 15.6737 0.0124
NP_441947.1_10 Reverse -80 -98 -0.472507 0.276
NP_442484.1_2 Reverse -71 -90 2.26107 0.226
NP_442240.1_2 Reverse -171 -190 -19.7651 0.295
NP_440586.1_8 Forward -90 -83 13.2151 0.026
NP_440586.1_8 Reverse -83 -90 13.2151 0.026
NP_442251.1_6 Forward -90 -83 15.2804 0.0124
NP_442251.1_6 Reverse -83 -90 15.2804 0.0124
NP_440192.1_4 Forward -109 -90 9.49463 0.276
NP_441262.1_3 Reverse -82 -89 14.7888 0.0223
NP_441262.1_3 Forward -91 -84 14.7888 0.0223
NP_443051.1_1 Reverse -81 -90 19.5676 0.00335
NP_443051.1_1 Forward -92 -83 19.5676 0.00335
NP_439937.1_8 Forward -181 -162 -4.32711 0.283
NP_440439.1_1 Forward -94 -81 15.9489 0.0132
NP_440439.1_1 Reverse -79 -92 1.69091 0.147
NP_439943.1_1 Reverse -247 -266 -10.6203 0.29
NP_440372.1_2 Forward -90 -83 16.3621 0.0124
NP_440372.1_2 Reverse -83 -90 16.3621 0.0124
NP_441138.1_5 Forward -280 -267 9.89744 0.238
NP_441789.1_7 Reverse -139 -158 -0.00131823 0.251
NP_441572.1_7 Forward -97 -78 -5.50708 0.263
NP_441572.1_7 Reverse -76 -95 -6.39206 0.29
NP_440267.1_2 Forward -96 -82 8.75042 0.162
NP_442384.1_10 Reverse -82 -95 14.4739 0.0148
NP_442384.1_10 Forward -91 -78 13.884 0.018
NP_441018.1_7 Reverse -78 -97 14.5524 0.118
NP_441018.1_7 Forward -42 -23 10.1275 0.217
NP_441018.1_7 Forward -114 -95 6.4893 0.286
NP_442790.1_4 Forward -116 -97 -9.83364 0.195
NP_442790.1_4 Forward -100 -81 -13.1769 0.259
NP_442262.1_10 Forward -90 -83 14.1988 0.0123
NP_442262.1_10 Reverse -83 -90 14.1988 0.0123
NP_441689.1_5 Forward -93 -83 17.8758 0.0158
NP_441689.1_5 Reverse -80 -90 8.3377 0.132
NP_440163.1_10 Reverse -360 -370 8.1415 0.287
NP_440282.1_10 Reverse -72 -91 -6.39206 0.25
NP_442123.1_3 Forward -91 -72 12.3892 0.2
NP_441965.1_10 Forward -182 -166 3.89344 0.253
NP_441965.1_10 Forward -94 -78 3.10679 0.274
NP_442529.1_4 Reverse -73 -92 11.7008 0.175
NP_440297.1_9 Reverse -83 -93 9.22315 0.0917
NP_440297.1_9 Forward -90 -80 -0.216628 0.282
NP_441592.1_4 Reverse -82 -101 3.93269 0.161
NP_440888.1_2 Reverse -82 -96 14.0603 0.0211
NP_440888.1_2 Forward -91 -77 7.86545 0.179
NP_440888.1_2 Forward -250 -236 7.76712 0.184
NP_441771.1_4 Reverse -93 -112 -0.295539 0.292
NP_440600.1_4 Reverse -74 -92 7.98396 0.0775
NP_440491.1_1 Forward -94 -75 9.25599 0.218
NP_442948.1_2 Reverse -51 -70 2.94938 0.296
NP_442871.1_4 Reverse -84 -103 -0.39464 0.18
NP_441543.1_2 Forward -90 -81 15.9293 0.00518
NP_441543.1_2 Reverse -83 -92 15.9293 0.00518
NP_442845.1_2 Forward -97 -83 17.8958 0.0608
NP_442845.1_2 Reverse -76 -90 6.3911 0.21
NP_442845.1_2 Reverse -82 -96 4.42448 0.259
NP_441469.1_8 Forward -92 -83 6.5879 0.227
NP_441469.1_8 Reverse -81 -90 6.5879 0.227
NP_443064.1_6 Forward -91 -81 10.8217 0.13
NP_443064.1_6 Reverse -82 -92 10.8217 0.13
NP_442578.1_7 Forward -90 -83 14.5921 0.026
NP_442578.1_7 Reverse -83 -90 14.5921 0.026
NP_440710.1_2 Reverse -33 -52 25.3688 0.016
NP_441462.1_2 Forward -91 -81 20.2362 0.000805
NP_441462.1_2 Reverse -82 -92 20.2362 0.000805
NP_441621.1_7 Reverse -80 -94 -5.21195 0.248
NP_443062.1_1 Forward -91 -73 12.4462 0.0796
NP_443062.1_1 Reverse -82 -100 6.69328 0.194
NP_441601.1_2 Reverse -23 -42 -2.85214 0.273
NP_441410.1_1 Forward -320 -301 22.3206 0.0231
NP_441410.1_3 Forward -100 -81 20.649 0.121
NP_441410.1_4 Forward -41 -22 18.6815 0.153
NP_441410.1_10 Forward -186 -167 20.7473 0.0807
NP_442204.1_1 Forward -95 -84 9.49844 0.0759
NP_442204.1_6 Forward -188 -169 8.16093 0.228
NP_442487.1_5 Reverse -81 -100 7.96345 0.198
NP_442537.1_3 Reverse -380 -399 16.9124 0.231
NP_440516.1_8 Forward -91 -82 16.9127 0.00442
NP_440516.1_8 Reverse -82 -91 16.9127 0.00442
NP_442428.1_5 Forward -90 -83 15.8704 0.0124
NP_442428.1_5 Reverse -83 -90 15.8704 0.0124
NP_442120.1_10 Reverse -23 -42 -7.17871 0.217
NP_442120.1_10 Reverse -302 -321 -11.0136 0.262
NP_441867.1_2 Reverse -362 -381 -15.8318 0.291
NP_440673.1_3 Forward -89 -82 12.4288 0.0426
NP_440673.1_3 Reverse -84 -91 12.4288 0.0426
NP_440673.1_3 Forward -114 -107 8.20058 0.234
NP_441052.1_2 Forward -179 -169 11.1898 0.0285
NP_441052.1_2 Forward -91 -81 10.4031 0.0285
NP_441052.1_2 Reverse -82 -92 10.4031 0.0285
NP_441052.1_2 Forward -217 -207 -0.511621 0.282
NP_442219.1_9 Forward -90 -81 8.25953 0.0681
NP_442219.1_9 Reverse -83 -92 8.25953 0.0681
NP_440436.1_4 Forward -90 -81 9.24241 0.0871
NP_440436.1_4 Reverse -83 -92 9.24241 0.0871
NP_440436.1_4 Forward -31 -22 9.04574 0.092
NP_441884.1_9 Forward -182 -163 -23.7966 0.284
NP_440648.1_1 Forward -91 -72 18.0924 0.058
NP_442907.1_9 Forward -96 -77 11.5042 0.0985
NP_441719.1_4 Forward -90 -83 16.3621 0.0124
NP_441719.1_4 Reverse -83 -90 16.3621 0.0124
NP_441004.1_1 Forward -113 -94 -10.4236 0.219
NP_441004.1_2 Forward -328 -309 1.67108 0.217
NP_442813.1_2 Forward -42 -23 -0.4922 0.273
NP_442366.1_3 Reverse -81 -99 3.06741 0.117
NP_442366.1_5 Reverse -79 -89 15.4175 0.0374
NP_440296.1_10 Forward -94 -75 -5.01543 0.214
NP_441115.1_4 Forward -92 -74 19.4878 0.00795
NP_442206.1_10 Forward -310 -295 4.69978 0.178
NP_443054.1_2 Forward -93 -79 1.47456 0.245
NP_441851.1_10 Forward -92 -82 8.53483 0.114
NP_441851.1_10 Reverse -81 -91 8.53483 0.114
NP_441851.1_10 Forward -256 -246 4.50326 0.266
NP_440347.1_9 Forward -76 -57 17.0107 0.173
NP_441273.1_1 Reverse -325 -344 12.2908 0.269
NP_442515.1_1 Forward -92 -78 -2.06536 0.268
NP_440165.1_5 Reverse -81 -100 -7.96535 0.286
NP_440940.1_7 Forward -101 -83 3.65664 0.274
NP_441349.1_10 Forward -101 -82 13.4708 0.0181
NP_440432.1_9 Reverse -174 -189 -1.39674 0.167
NP_440432.1_9 Forward -90 -75 -1.69173 0.167
NP_442843.1_1 Reverse -364 -383 -6.49039 0.245
NP_440474.1_8 Reverse -83 -97 8.84875 0.175
NP_440474.1_8 Forward -90 -76 5.1122 0.257
NP_441124.1_5 Reverse -337 -347 10.7163 0.286
NP_440431.1_4 Reverse -274 -293 -5.87318 0.248
NP_440431.1_4 Reverse -273 -292 -9.02441 0.275
NP_440431.1_7 Forward -288 -269 1.37609 0.215
NP_442450.1_5 Forward -93 -83 9.41981 0.115
NP_442450.1_5 Reverse -80 -90 7.64985 0.13
NP_440588.1_2 Forward -100 -81 11.1109 0.035
NP_442006.1_2 Forward -188 -171 -6.64766 0.167
NP_443047.1_7 Reverse -108 -127 9.83255 0.188
NP_441570.1_1 Reverse -82 -100 -0.0791831 0.0433
NP_441570.1_1 Forward -116 -98 -16.5988 0.249
NP_441570.1_1 Forward -91 -73 -16.5988 0.249
NP_440078.1_10 Reverse -82 -101 5.30933 0.226
NP_441078.1_4 Forward -91 -82 19.6659 0.0007
NP_441078.1_4 Reverse -82 -91 19.6659 0.0007
NP_442388.1_3 Reverse -289 -308 6.39097 0.282
NP_440707.1_7 Forward -114 -95 3.34271 0.284
NP_441432.1_8 Reverse -81 -90 16.8143 0.00595
NP_441432.1_8 Forward -92 -83 16.8143 0.00595
NP_441432.1_8 Reverse -301 -310 2.85133 0.281
NP_441432.1_8 Forward -318 -309 2.55633 0.298
NP_443024.1_3 Reverse -370 -380 17.4829 0.251
NP_443024.1_3 Forward -77 -67 16.2046 0.255
NP_441333.1_1 Forward -276 -266 17.2143 0.153
NP_442344.1_7 Forward -90 -71 16.5191 0.0196
NP_442344.1_7 Reverse -83 -102 -6.88371 0.172
NP_441732.1_2 Forward -95 -79 -7.70961 0.0885
NP_441732.1_2 Reverse -78 -94 -16.7561 0.195
NP_442003.1_10 Forward -187 -168 14.1591 0.266
NP_440760.1_1 Forward -91 -72 -19.4701 0.219
NP_440578.1_8 Forward -116 -97 19.3707 0.144
NP_441072.1_2 Forward -102 -83 16.2241 0.113
NP_442400.1_10 Reverse -266 -279 10.7569 0.255
NP_440713.1_4 Forward -101 -82 13.5691 0.0973
NP_442489.1_7 Forward -91 -82 20.1576 0.000695
NP_442489.1_7 Reverse -82 -91 20.1576 0.000695
NP_442489.1_7 Forward -179 -170 -1.6719 0.235
NP_442489.1_7 Forward -38 -29 -1.86856 0.259
NP_442489.1_7 Reverse -29 -38 -1.96689 0.28
NP_440559.1_1 Reverse -83 -92 8.65285 0.0586
NP_440559.1_1 Forward -90 -81 8.65285 0.0586
NP_441659.2_8 Forward -91 -81 20.9245 0.000805
NP_441659.2_8 Reverse -82 -92 20.9245 0.000805
NP_442913.1_10 Reverse -73 -92 4.916 0.0808
NP_442913.1_10 Forward -188 -169 -0.197208 0.157
NP_439912.1_6 Forward -114 -96 15.9488 0.215
NP_441040.1_2 Reverse -136 -155 -6.88371 0.202
NP_441040.1_5 Forward -102 -83 5.50599 0.232
NP_442776.1_6 Forward -93 -74 7.86593 0.277
NP_442346.1_5 Forward -92 -82 16.303 0.00248
NP_442346.1_5 Reverse -81 -91 16.303 0.00248
NP_440545.1_3 Reverse -78 -95 3.48043 0.0834
NP_440545.1_3 Forward -95 -78 -0.0594896 0.147
NP_441856.1_3 Forward -94 -75 -1.67217 0.239
NP_440486.1_4 Forward -397 -379 3.55906 0.226
NP_440486.1_6 Forward -104 -85 8.45592 0.242
NP_440010.1_4 Forward -186 -167 -1.37794 0.267
NP_440010.1_10 Forward -322 -303 1.76941 0.293
NP_440847.1_3 Reverse -67 -81 10.9137 0.279
NP_442603.1_9 Forward -324 -306 0.510803 0.293
NP_440449.1_6 Reverse -74 -92 18.4685 0.065
NP_440449.1_6 Reverse -300 -318 8.25583 0.203
NP_441047.1_2 Forward -53 -34 0.687771 0.239
NP_441833.1_4 Forward -90 -83 15.9687 0.0124
NP_441833.1_4 Reverse -83 -90 15.9687 0.0124
NP_442162.1_9 Forward -90 -83 16.2637 0.0124
NP_442162.1_9 Reverse -83 -90 16.2637 0.0124
NP_440671.1_4 Forward -97 -83 18.7808 0.0118
NP_442546.1_4 Reverse -365 -383 14.1788 0.227
NP_442140.1_3 Forward -90 -80 6.66654 0.159
NP_440875.1_9 Reverse -84 -94 8.27469 0.233
NP_441813.1_5 Forward -93 -83 15.9097 0.01
NP_441813.1_5 Reverse -80 -90 8.63316 0.0367
NP_440590.1_4 Forward -90 -77 -0.472371 0.189
NP_440590.1_4 Forward -159 -146 -4.60227 0.263
NP_440567.1_1 Reverse -83 -97 16.1259 0.0166
NP_440567.1_1 Forward -90 -76 11.6026 0.0277
NP_440567.1_6 Forward -37 -18 4.42435 0.269
NP_442497.1_10 Forward -90 -81 17.601 0.00813
NP_442497.1_10 Reverse -83 -92 17.601 0.00813
NP_440821.1_4 Forward -93 -83 11.0914 0.0146
NP_440821.1_4 Reverse -80 -90 2.24165 0.131
NP_441239.1_9 Forward -93 -81 12.1337 0.0494
NP_441239.1_9 Reverse -80 -92 11.1504 0.0648
NP_441239.1_9 Reverse -85 -97 3.87389 0.272
NP_441951.1_4 Forward -63 -44 10.1275 0.228
NP_441951.1_7 Reverse -362 -376 15.744 0.284
NP_441727.1_3 Reverse -75 -94 8.06259 0.213
NP_441727.1_10 Forward -43 -24 14.6499 0.25
NP_440665.1_1 Forward -176 -157 -13.3736 0.257
NP_440604.1_6 Forward -91 -72 -0.885524 0.191
NP_440604.1_6 Reverse -82 -101 -3.04881 0.225
NP_442772.1_4 Reverse -309 -328 -5.01543 0.282
NP_442138.1_1 Reverse -80 -99 0.981987 0.272
NP_441782.1_5 Forward -124 -105 6.58763 0.289
NP_440546.1_4 Reverse -82 -92 13.5365 0.0459
NP_440546.1_4 Forward -91 -81 13.5365 0.0459
NP_440546.1_6 Forward -101 -82 8.55425 0.256
NP_440462.1_6 Forward -93 -83 16.893 0.00853
NP_440462.1_6 Reverse -80 -90 10.5014 0.0396
NP_442611.1_1 Reverse -82 -101 11.5042 0.076
NP_440868.1_4 Forward -95 -83 13.2153 0.022
NP_440868.1_4 Reverse -78 -90 8.10212 0.0602
NP_441879.1_9 Forward -184 -165 18.3873 0.062
NP_442787.1_7 Reverse -368 -387 16.8634 0.227
NP_441582.1_5 Reverse -168 -187 6.1935 0.2
NP_441084.1_6 Forward -264 -250 12.5437 0.16
NP_441843.2_9 Forward -89 -71 13.0209 0.205
NP_442039.1_4 Forward -90 -83 15.1821 0.0124
NP_442039.1_4 Reverse -83 -90 15.1821 0.0124
NP_442380.1_10 Forward -114 -96 7.09898 0.294
NP_442829.1_2 Forward -75 -59 10.4603 0.287
NP_441926.1_3 Reverse -82 -98 14.8082 0.0429
NP_442837.1_3 Forward -90 -83 15.7721 0.0124
NP_442837.1_3 Reverse -83 -90 15.7721 0.0124
NP_439994.1_3 Reverse -81 -100 9.99938 0.225
NP_442053.1_1 Forward -91 -82 18.3876 0.0007
NP_442053.1_1 Reverse -82 -91 18.3876 0.0007
NP_440505.1_3 Forward -93 -83 15.123 0.014
NP_440505.1_3 Reverse -80 -90 8.04317 0.147
NP_441252.1_6 Forward -99 -92 11.9372 0.25
NP_441203.1_1 Reverse -83 -102 -5.60541 0.102
NP_440914.1_1 Forward -91 -81 16.3248 0.00196
NP_440914.1_1 Reverse -82 -92 16.3248 0.00196
NP_440914.1_1 Reverse -23 -33 8.02955 0.211
NP_441011.1_8 Forward -90 -81 16.6177 0.00602
NP_441011.1_8 Reverse -83 -92 16.6177 0.00602
NP_442101.1_10 Reverse -74 -93 -6.29373 0.186
NP_442533.1_1 Forward -113 -94 -6.98204 0.184
NP_442533.1_6 Forward -91 -82 17.2076 0.00137
NP_442533.1_6 Reverse -82 -91 17.2076 0.00137
NP_442533.1_6 Reverse -170 -179 5.3096 0.145
NP_442533.1_6 Forward -261 -252 1.86802 0.284
NP_442232.1_3 Forward -99 -80 -13.6686 0.282
NP_443016.1_1 Forward -316 -297 -5.11376 0.244
NP_441482.1_7 Forward -97 -83 7.9644 0.0215
NP_439944.1_9 Reverse -83 -93 17.6796 0.00347
NP_439944.1_9 Forward -90 -80 9.12481 0.1
NP_442269.1_10 Forward -109 -90 3.24438 0.255
NP_441697.1_5 Reverse -279 -298 -8.64244 0.265
NP_440816.1_7 Forward -69 -50 11.4058 0.218
NP_442202.1_4 Reverse -168 -182 19.4284 0.104
NP_440116.1_8 Forward -90 -71 -4.91709 0.182
NP_441527.1_4 Reverse -274 -293 -11.3162 0.281
NP_440115.1_6 Forward -94 -84 7.45319 0.147
NP_440115.1_6 Forward -258 -248 6.37155 0.186
NP_440007.1_9 Forward -95 -81 9.5377 0.171
NP_442728.1_2 Forward -106 -87 13.8641 0.258
NP_442728.1_7 Forward -26 -12 14.2576 0.225
NP_439965.1_1 Forward -100 -81 -1.08219 0.157
NP_441347.1_5 Forward -97 -83 10.1271 0.269
NP_441602.1_3 Reverse -165 -184 0.884433 0.217
NP_441602.1_4 Forward -190 -171 12.7825 0.278
NP_441170.1_4 Reverse -161 -179 12.3105 0.166
NP_441170.1_4 Reverse -73 -91 7.00065 0.194
NP_441106.1_1 Reverse -81 -90 18.486 0.0028
NP_441106.1_1 Forward -92 -83 18.486 0.0028
NP_439903.1_6 Forward -94 -75 12.1917 0.0872
NP_439903.1_6 Reverse -79 -98 6.78348 0.167
NP_439903.1_6 Forward -119 -100 5.30853 0.184
NP_442928.1_3 Forward -98 -79 11.0671 0.3
NP_441286.1_1 Reverse -81 -93 4.95553 0.027
NP_441286.1_1 Forward -92 -80 -3.50094 0.145
NP_440670.1_8 Forward -91 -82 18.3876 0.000699
NP_440670.1_8 Reverse -82 -91 18.3876 0.000699
NP_441930.1_3 Reverse -268 -287 3.54155 0.281
NP_440886.1_7 Reverse -106 -116 10.6976 0.0805
NP_440886.1_7 Forward -92 -82 8.04271 0.0805
NP_440886.1_7 Reverse -81 -91 8.04271 0.0805
NP_440886.1_7 Reverse -97 -107 5.38779 0.185
NP_440828.1_1 Reverse -172 -191 13.47 0.13
NP_442614.1_2 Reverse -82 -96 7.37441 0.275
NP_442717.1_5 Reverse -102 -121 9.73422 0.265
NP_442072.1_9 Forward -92 -74 -20.6304 0.204
NP_442072.1_9 Reverse -81 -99 -21.8103 0.212
NP_442022.1_4 Forward -110 -91 10.9142 0.217
NP_440907.2_8 Forward -90 -80 15.9091 0.0161
NP_440907.2_8 Reverse -83 -93 9.51767 0.103
NP_440193.1_1 Forward -319 -300 14.3768 0.291
NP_442459.1_8 Forward -96 -77 16.0274 0.089
NP_441463.1_3 Reverse -72 -91 0.687771 0.13
NP_441463.1_3 Forward -101 -82 -4.52377 0.207
NP_441463.1_3 Forward -42 -23 -6.09707 0.239
NP_441463.1_6 Reverse -244 -258 8.34861 0.25
NP_441626.1_2 Forward -90 -83 15.7721 0.0124
NP_441626.1_2 Reverse -83 -90 15.7721 0.0124
NP_442238.1_3 Forward -323 -304 4.52268 0.278
NP_442615.1_1 Forward -100 -82 19.0954 0.00504
NP_442615.1_1 Reverse -73 -91 17.1287 0.00711
NP_440387.1_1 Reverse -82 -98 24.248 0.00118
NP_440387.1_1 Forward -91 -75 6.15506 0.0288
NP_441431.1_2 Forward -94 -80 8.06211 0.226
NP_440634.1_10 Reverse -95 -114 6.58682 0.261
NP_441993.1_1 Reverse -302 -321 2.43397 0.259
NP_441174.1_2 Forward -94 -80 13.1759 0.219
NP_440114.1_10 Forward -91 -77 14.4542 0.0401
NP_440114.1_10 Reverse -82 -96 10.9143 0.13
NP_440114.1_10 Forward -318 -304 6.19444 0.282
NP_441272.1_10 Forward -323 -309 13.9626 0.244
NP_440293.1_9 Reverse -247 -261 10.9577 0.261
NP_439988.1_7 Forward -89 -75 12.192 0.292
NP_442743.1_5 Reverse -83 -102 7.86593 0.162
NP_441311.1_2 Reverse -76 -90 22.5167 0.00746
NP_440457.1_1 Forward -95 -83 10.9537 0.092
NP_440798.1_6 Forward -90 -77 4.05085 0.147
NP_440798.1_6 Reverse -83 -96 0.904263 0.242
NP_440942.1_10 Reverse -316 -335 21.5339 0.123
NP_441332.1_4 Reverse -233 -252 8.75091 0.234
NP_442509.1_9 Reverse -82 -92 8.04271 0.192
NP_442509.1_9 Forward -91 -81 8.04271 0.192
NP_440660.1_6 Reverse -27 -46 15.6341 0.228
NP_442514.1_5 Forward -318 -299 -7.57277 0.276
NP_440554.1_4 Reverse -83 -93 16.1063 0.0189
NP_440554.1_4 Forward -90 -80 8.82982 0.0646
NP_441885.1_5 Forward -91 -81 11.3864 0.00668
NP_441885.1_5 Reverse -82 -92 11.3864 0.00668
NP_442703.1_4 Reverse -82 -101 3.24359 0.283
NP_442341.1_7 Reverse -169 -183 12.3893 0.0454
NP_442341.1_9 Reverse -80 -94 17.6002 0.0243
NP_442341.1_9 Forward -93 -79 6.98048 0.208
NP_441756.1_5 Forward -56 -37 4.12936 0.199
NP_442395.2_4 Reverse -81 -100 3.24359 0.207
NP_443000.1_7 Forward -93 -83 17.4829 0.00719
NP_443000.1_7 Reverse -80 -90 10.6981 0.0345
NP_443059.1_10 Reverse -90 -109 -0.591301 0.285
NP_441842.1_10 Reverse -75 -89 16.4209 0.0311
NP_440275.1_3 Forward -93 -83 9.12481 0.055
NP_440275.1_3 Reverse -80 -90 9.02648 0.0563
NP_440091.1_1 Forward -95 -83 1.51394 0.197
NP_442354.1_8 Forward -58 -39 6.39097 0.266
NP_442275.1_1 Reverse -45 -64 3.53937 0.284
NP_440679.1_10 Forward -114 -95 -13.1769 0.221
NP_441359.1_5 Forward -142 -123 3.04771 0.259
NP_441207.1_7 Reverse -265 -279 13.5152 0.21
NP_440149.1_8 Forward -179 -160 -2.75381 0.175
NP_440149.1_8 Forward -38 -19 -3.73712 0.196
NP_441105.1_3 Forward -102 -83 -4.91709 0.209
NP_441105.1_3 Forward -43 -24 -5.80207 0.224
NP_441105.1_3 Reverse -12 -31 -7.76869 0.259
NP_440216.1_1 Forward -91 -77 7.07942 0.01
NP_440216.1_1 Reverse -82 -96 6.58777 0.0145
NP_440216.1_1 Reverse -170 -184 -12.6851 0.296
NP_440172.1_1 Forward -91 -81 17.5813 0.00421
NP_440172.1_1 Reverse -82 -92 17.5813 0.00421
NP_440172.1_1 Reverse -29 -39 6.8632 0.0991
NP_442015.1_10 Forward -243 -230 6.70579 0.108
NP_442015.1_10 Forward -95 -82 1.49425 0.204
NP_441226.1_7 Forward -90 -83 14.4934 0.0123
NP_441226.1_7 Reverse -83 -90 14.4934 0.0123
NP_441757.1_3 Forward -92 -73 0.58944 0.188
NP_441111.1_7 Forward -90 -82 18.7023 0.00294
NP_441111.1_7 Reverse -83 -91 18.7023 0.00294
NP_442379.1_10 Forward -98 -81 15.0835 0.0453
NP_441766.1_2 Forward -91 -82 17.5026 0.00297
NP_441766.1_2 Reverse -82 -91 17.5026 0.00297
NP_442417.1_5 Forward -91 -77 6.3911 0.222
NP_440416.1_9 Reverse -75 -94 -16.8151 0.223
NP_440416.1_9 Reverse -120 -139 -20.3551 0.284
NP_443052.1_8 Forward -101 -82 -11.5053 0.231
NP_442154.1_1 Reverse -381 -399 -15.9105 0.228
NP_442154.1_1 Forward -118 -100 -17.9754 0.273
NP_442564.1_4 Reverse -83 -102 17.5216 0.216
NP_440261.1_5 Forward -90 -77 -0.964025 0.0655
NP_440261.1_5 Reverse -83 -96 -10.6988 0.203
NP_440988.1_10 Reverse -27 -41 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCCGCACGGAAACCACGGTGCAATTTCTCCAATCCCTGTTACAGGAGTTTGAAAAGTTACGCATCACTGAAGTAACCGCTGAGGAATTGGCCTATGCCAAAGATTCAATTTTAAATTCCTTTGTTTTTAATTTTGAAAGGCCGGGGCAAACCCTTTCCCGTTTGATGACCTACGAGTATTACGGTTATCCAGAGGATTTTATTTTCACTTACCAACAGGCGGTGATGGACACCACAGTGGAGGATGTGCAACGGGTAGCGGCTAAGTATCTCCAGCCCGAACAGATGATTGCGGTGATTGTGGGGCAAGGCGATCGCCTAAAGGATGAATTGGAAGCCCTAGACCGGCGGGTGCAAATGTTGGAAATTGCCATTCCCGAAGCTAGTAGTTAATTGGGCC

CDS

ATGGACCGCCAGGGGAAACAAAAAACGGCTCCAATAGAGGCTCTGGCTATGGGAGTGGTGGTCACTGGGCTAGCCCTGGACACTGCCTTGGGAGATCAATTACAAACTTGGACAAAGTTGTTACAGGGAAAAACGGCCATCAAGCCCAAGCAACCTTTTATAAACTTGCCATCGTTCCCCTTGGCATTACAGGGAAATTATCCTCGTTCCCTGGGACAATTGGTTCCGCCCTTGGTGCAGGCCGCCATTGATGATGCCCAACTTGATCCCGCTGAACAACCCTGGGGAGTGGCGATCGGTTCTAGTCGGGCTAACCAATGCCATTGGGAAGATTGGGTTGGGCGCAACATTAAGCCTCCGGTGGCCCCCAACTTTAAGCTTGTGGATTGGTGGCAGACTTTACCTGATCAGGCCGCCCGTTTAGCTGCCCAACTTCTACCGGAAGTAACGGTGATGCAATGCCCCATGGCCGCCTGTGCCACTGGGTTATGGGCGATCGCCCAGGGAGTGGAGTTAATTAGAACAGGCCATTGCCAACGGGTGTTGGCCGGGGCAGTGGAAGCCCCCATTACACCGCTCACATTGGCTGGTTTTAGCAAAATGGCCACGCTAGCACCGGATGGATGTTATCCCTTCGATCGCCAGCGCCAGGGTTTAGTGTTGGGGGAAGGGGGAGCTTTGTTAGTATTGGAAACCCGGGAATTAGCCCAGAAGAGAAAAGCCAGAATTTACGGTGAAATTTTGGGTTGGGGTTTTAGTTGTGATGCACTCCATCGTAGTACTCCTGCCTTTGATAACCACAGTGCCCAGCAAGCCGTGAAGCATTGCCTCACCCGCAGTGGTTTAACCCCAGAGCAAATTGACTTGATTCATCCCCACGGCACTGGCACTCTTTTCAACGATCAACGGGAGGCCGCTTTAATCCAAACTCTTTTTCCTCAAAATCCTCTCATTACTTCCAGCAAAGGGGCCACTGGCCATACCCTGGGCGCTTCCGGGGCGATCGCCGTAGCTTTGACTTTATTAAGCCTTCATCAGCAAAAATTGCCCCCCTGTGTTGGTTTGAAAGAACCTGAATTTCCCCTCAACTTTGTCCGCATTGAATCAGTTCAGCCAGCAACTAGCCCTTTAAACTATGGTCTCTGCCTCAGTTTTGGCTTTGGCGGCCAGAATGGGGCGATCGCCGTGGGACACGCACCACTACCAACAAAATGA

Protein

MDRQGKQKTAPIEALAMGVVVTGLALDTALGDQLQTWTKLLQGKTAIKPKQPFINLPSFPLALQGNYPRSLGQLVPPLVQAAIDDAQLDPAEQPWGVAIGSSRANQCHWEDWVGRNIKPPVAPNFKLVDWWQTLPDQAARLAAQLLPEVTVMQCPMAACATGLWAIAQGVELIRTGHCQRVLAGAVEAPITPLTLAGFSKMATLAPDGCYPFDRQRQGLVLGEGGALLVLETRELAQKRKARIYGEILGWGFSCDALHRSTPAFDNHSAQQAVKHCLTRSGLTPEQIDLIHPHGTGTLFNDQREAALIQTLFPQNPLITSSKGATGHTLGASGAIAVALTLLSLHQQKLPPCVGLKEPEFPLNFVRIESVQPATSPLNYGLCLSFGFGGQNGAIAVGHAPLPTK