Your browser is old and dusty. Try Google Chrome!

Details for slr1330

ORF slr1330
Accession NP_441408.2
Symbol atpE
Category ATP synthase
Definition ATP synthase epsilon chain of CF(1)
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -243 -229 13.4709 0.172
NP_440795.1_7 Forward -51 -44 14.6904 0.0123
NP_440795.1_7 Reverse -44 -51 14.6904 0.0123
NP_441418.1_6 Reverse -43 -62 -10.227 0.0328
NP_441418.1_6 Forward -110 -91 -29.4015 0.224
NP_441418.1_6 Forward -214 -195 -30.7781 0.296
NP_442291.1_5 Forward -53 -37 20.5114 0.0165
NP_442291.1_5 Reverse -42 -58 1.14018 0.152
NP_440897.1_6 Reverse -43 -62 13.0766 0.0611
NP_440897.1_6 Reverse -76 -95 -3.24622 0.237
NP_441453.1_1 Forward -59 -41 6.50823 0.234
NP_441453.1_4 Reverse -43 -51 16.539 0.00633
NP_441453.1_4 Forward -52 -44 16.539 0.00633
NP_442151.1_6 Forward -52 -38 9.83269 0.139
NP_441818.1_1 Forward -51 -40 18.446 0.0046
NP_441818.1_1 Reverse -44 -55 8.90795 0.271
NP_441818.1_7 Reverse -183 -202 18.1898 0.163
NP_441818.1_9 Forward -321 -302 -6.09707 0.259
NP_441818.1_9 Reverse -316 -335 -9.83364 0.291
NP_440226.1_1 Forward -52 -33 19.174 0.012
NP_440226.1_1 Reverse -43 -62 4.62101 0.184
NP_441630.1_3 Reverse -35 -54 1.27776 0.251
NP_440150.1_6 Reverse -40 -59 14.5524 0.0993
NP_442173.1_1 Forward -51 -43 15.4574 0.00633
NP_442173.1_1 Reverse -44 -52 15.4574 0.00633
NP_442752.1_4 Forward -52 -45 13.8055 0.0199
NP_442752.1_4 Reverse -43 -50 13.8055 0.0199
NP_443027.1_4 Forward -54 -44 11.8781 0.0872
NP_443027.1_4 Reverse -41 -51 11.0914 0.107
NP_442975.1_10 Forward -56 -42 4.32555 0.245
NP_441225.1_4 Forward -281 -262 -12.6852 0.291
NP_440784.1_7 Forward -51 -44 15.9687 0.0123
NP_440784.1_7 Reverse -44 -51 15.9687 0.0123
NP_440061.1_9 Reverse -41 -55 14.7486 0.0595
NP_440061.1_9 Forward -54 -40 12.487 0.0964
NP_442062.1_8 Reverse -43 -53 19.4496 0.000558
NP_442062.1_8 Forward -52 -42 17.3846 0.00193
NP_440761.1_4 Forward -189 -170 -20.4534 0.287
NP_441859.1_3 Reverse -291 -310 2.45694 0.258
NP_440304.1_4 Forward -54 -44 1.84832 0.299
NP_440304.1_4 Reverse -41 -51 1.84832 0.299
NP_442242.1_4 Forward -51 -44 14.3954 0.0124
NP_442242.1_4 Reverse -44 -51 14.3954 0.0124
NP_442602.1_3 Forward -24 -5 10.3242 0.0707
NP_442110.1_7 Forward -52 -38 0.0979218 0.267
NP_441925.1_2 Forward -250 -231 4.916 0.262
NP_441083.1_3 Forward -308 -298 13.9425 0.195
NP_441083.1_5 Forward -52 -42 20.3345 0.00053
NP_441083.1_5 Reverse -43 -53 11.3864 0.0159
NP_441434.1_7 Forward -50 -36 4.03116 0.225
NP_441738.1_2 Forward -50 -43 15.28 0.0102
NP_441738.1_2 Reverse -45 -52 15.28 0.0102
NP_441738.1_2 Reverse -246 -253 8.1019 0.204
NP_441558.1_5 Forward -54 -35 11.0125 0.0879
NP_441558.1_5 Reverse -41 -60 8.35759 0.153
NP_440209.1_1 Reverse -43 -51 18.1123 0.00295
NP_440209.1_1 Forward -52 -44 18.1123 0.00295
NP_442889.1_8 Forward -55 -41 5.89884 0.211
NP_440178.1_7 Forward -53 -34 5.11266 0.0199
NP_442570.1_3 Forward -93 -74 -6.78538 0.259
NP_441716.1_1 Reverse -43 -57 13.8643 0.0689
NP_441716.1_1 Reverse -76 -90 10.226 0.0968
NP_442111.1_4 Reverse -42 -56 17.8958 0.00908
NP_440906.1_5 Forward -51 -44 15.8704 0.0124
NP_440906.1_5 Reverse -44 -51 15.8704 0.0124
NP_440747.1_10 Reverse -40 -52 16.8536 0.00143
NP_440747.1_10 Forward -55 -43 7.31547 0.00577
NP_440747.1_10 Forward -280 -268 -11.8591 0.161
NP_441130.1_10 Forward -54 -40 17.6992 0.0162
NP_441130.1_10 Reverse -41 -55 16.1259 0.0261
NP_441486.1_1 Forward -55 -41 4.81781 0.0406
NP_441486.1_1 Reverse -40 -54 4.62115 0.0425
NP_442634.1_2 Forward -58 -39 8.25926 0.159
NP_442848.1_1 Reverse -37 -51 -1.77037 0.263
NP_442848.1_9 Forward -84 -65 -1.27885 0.288
NP_441012.1_4 Reverse -78 -91 9.55739 0.272
NP_443018.1_3 Forward -51 -44 14.8871 0.0123
NP_443018.1_3 Reverse -44 -51 14.8871 0.0123
NP_441634.1_8 Reverse -41 -55 15.5359 0.0248
NP_441634.1_8 Forward -54 -40 -4.4253 0.295
NP_440376.1_1 Forward -52 -43 19.4693 0.000692
NP_440376.1_1 Reverse -43 -52 19.4693 0.000692
NP_440376.1_1 Reverse -268 -277 3.83464 0.19
NP_441588.1_4 Forward -50 -40 8.73149 0.14
NP_442687.1_7 Forward -53 -43 15.8113 0.0125
NP_442687.1_7 Reverse -42 -52 8.92815 0.0994
NP_442191.1_4 Reverse -44 -58 14.8714 0.073
NP_442485.1_3 Reverse -41 -60 -5.21209 0.287
NP_442485.1_3 Reverse -55 -74 -5.60541 0.293
NP_440642.1_10 Forward -344 -330 12.487 0.134
NP_440642.1_10 Forward -285 -271 2.94893 0.277
NP_440642.1_10 Reverse -10 -24 2.8506 0.277
NP_441013.1_2 Reverse -164 -182 -1.94747 0.282
NP_441422.1_7 Forward -54 -37 -1.82945 0.194
NP_442483.1_6 Reverse -97 -116 12.585 0.286
NP_440533.1_4 Forward -64 -45 14.3558 0.297
NP_441950.1_7 Forward -116 -97 -7.37537 0.278
NP_440360.1_10 Reverse -189 -203 11.2093 0.164
NP_442658.1_1 Forward -54 -44 17.0891 0.00615
NP_442658.1_1 Reverse -41 -51 7.94438 0.199
NP_441414.1_9 Forward -52 -33 5.11266 0.0483
NP_440184.1_7 Reverse -250 -269 13.4144 0.28
NP_440607.1_3 Forward -198 -179 13.3716 0.24
NP_441487.1_9 Forward -53 -34 4.03102 0.153
NP_442321.1_1 Forward -186 -167 -2.26216 0.212
NP_441958.1_2 Forward -61 -42 12.1925 0.212
NP_441958.1_5 Forward -53 -43 12.2714 0.00183
NP_441958.1_5 Reverse -42 -52 12.2714 0.00183
NP_440318.1_1 Reverse -6 -25 0.982764 0.289
NP_442836.1_5 Reverse -37 -56 11.8975 0.084
NP_439905.1_1 Reverse -44 -57 11.0324 0.204
NP_440984.1_7 Reverse -38 -52 15.3392 0.0563
NP_439990.1_5 Forward -61 -48 9.06573 0.153
NP_442911.1_2 Reverse -33 -52 -4.42544 0.134
NP_442911.1_2 Forward -62 -43 -9.047 0.249
NP_440153.1_5 Forward -51 -37 11.0127 0.0806
NP_440153.1_5 Reverse -44 -58 4.22782 0.199
NP_440153.1_8 Reverse -291 -304 -3.71729 0.299
NP_441591.1_10 Reverse -41 -60 13.8641 0.102
NP_442064.1_4 Forward -95 -76 13.8633 0.147
NP_443055.1_3 Reverse -67 -86 11.0271 0.27
NP_443055.1_6 Forward -177 -159 4.54162 0.181
NP_440827.1_3 Forward -189 -170 10.5209 0.298
NP_443044.1_1 Reverse -221 -240 2.55606 0.296
NP_441099.1_5 Reverse -33 -52 -10.4236 0.253
NP_441099.1_5 Forward -62 -43 -11.7019 0.288
NP_442002.1_9 Forward -53 -46 10.7572 0.185
NP_441294.1_7 Forward -56 -42 20.8653 0.00181
NP_440411.1_10 Reverse -166 -185 9.18818 0.293
NP_441646.1_1 Forward -348 -329 3.24438 0.207
NP_441646.1_1 Forward -59 -40 1.47442 0.231
NP_441646.1_7 Forward -306 -292 13.4709 0.28
NP_442438.1_10 Forward -57 -43 5.1128 0.139
NP_442438.1_10 Reverse -38 -52 -0.0987402 0.248
NP_441000.1_6 Reverse -42 -56 14.4542 0.0396
NP_441000.1_6 Forward -53 -39 13.3726 0.0396
NP_441000.1_6 Reverse -359 -373 -5.01529 0.257
NP_441110.1_10 Forward -70 -51 11.0125 0.263
NP_441110.1_10 Forward -71 -52 10.2259 0.293
NP_440147.1_4 Forward -54 -41 17.6205 0.00602
NP_440147.1_4 Reverse -41 -54 15.0639 0.0197
NP_441175.1_7 Forward -52 -33 5.60432 0.276
NP_441550.1_8 Reverse -41 -51 15.1225 0.0132
NP_441550.1_8 Forward -54 -44 8.82935 0.112
NP_441916.1_7 Reverse -43 -53 18.4663 0.00144
NP_441916.1_7 Forward -52 -42 10.3048 0.0261
NP_441916.1_10 Reverse -331 -350 1.76941 0.262
NP_441041.1_4 Forward -52 -33 -12.5869 0.269
NP_441041.1_7 Reverse -40 -52 10.8188 0.0864
NP_441041.1_7 Forward -55 -43 8.58373 0.133
NP_441547.1_2 Forward -63 -45 8.57394 0.212
NP_441725.1_5 Forward -51 -41 2.04498 0.115
NP_441725.1_5 Reverse -44 -54 2.04498 0.115
NP_439966.1_7 Forward -54 -44 17.9741 0.00631
NP_439966.1_7 Reverse -41 -51 15.3192 0.0152
NP_439966.1_9 Forward -54 -45 0.884706 0.253
NP_442941.1_3 Forward -51 -41 19.2529 0.00262
NP_442941.1_3 Reverse -44 -54 10.7964 0.0116
NP_440289.1_2 Forward -55 -42 11.229 0.021
NP_440289.1_2 Reverse -40 -53 5.91914 0.0605
NP_440983.1_6 Forward -233 -214 15.0441 0.255
NP_440260.1_8 Reverse -165 -183 -6.66736 0.294
NP_441678.1_9 Reverse -304 -323 -4.22878 0.292
NP_442281.1_1 Reverse -38 -52 16.8135 0.00698
NP_442256.1_2 Forward -54 -36 -8.33898 0.221
NP_440437.1_1 Forward -58 -39 3.04771 0.127
NP_439983.1_1 Forward -339 -321 11.0314 0.289
NP_441556.1_7 Forward -63 -44 -1.27961 0.3
NP_441644.1_6 Forward -52 -42 17.3841 0.00127
NP_441644.1_6 Reverse -43 -53 10.1076 0.0628
NP_441644.1_6 Forward -85 -75 4.50281 0.235
NP_442215.1_2 Forward -54 -38 -1.3181 0.183
NP_442215.1_2 Forward -276 -260 -5.74299 0.256
NP_442029.1_6 Reverse -38 -57 10.6192 0.177
NP_440253.1_2 Forward -52 -34 4.14905 0.106
NP_440253.1_2 Reverse -43 -61 -1.35749 0.238
NP_440929.1_8 Forward -52 -43 19.2726 0.000701
NP_440929.1_8 Reverse -43 -52 19.2726 0.000701
NP_442933.1_5 Forward -67 -48 16.2241 0.0806
NP_442933.1_10 Forward -52 -43 17.601 0.00325
NP_442933.1_10 Reverse -43 -52 17.601 0.00325
NP_441751.2_8 Reverse -44 -58 -3.24533 0.137
NP_441751.2_8 Forward -51 -37 -4.62196 0.176
NP_442926.1_1 Reverse -47 -66 9.63589 0.151
NP_442554.1_8 Forward -51 -41 16.2046 0.0065
NP_442554.1_8 Reverse -44 -54 14.1397 0.0144
NP_441762.1_7 Reverse -42 -54 2.98891 0.0676
NP_441762.1_7 Forward -53 -41 2.39892 0.0676
NP_442142.1_4 Reverse -40 -53 14.7683 0.0302
NP_442142.1_4 Forward -55 -42 6.0169 0.175
NP_442142.1_4 Forward -88 -75 3.46031 0.255
NP_442292.1_1 Forward -51 -42 18.486 0.00229
NP_442292.1_1 Reverse -44 -53 9.63616 0.0183
NP_442476.1_6 Reverse -44 -58 3.63784 0.155
NP_442476.1_6 Forward -51 -37 1.57289 0.211
NP_442381.1_8 Reverse -40 -59 -15.0452 0.292
NP_441711.1_4 Reverse -34 -53 2.65439 0.271
NP_443009.1_5 Reverse -42 -53 18.3477 0.00265
NP_443009.1_5 Forward -111 -100 7.03967 0.141
NP_443009.1_5 Forward -86 -75 5.56471 0.197
NP_441715.1_4 Reverse -44 -54 18.8596 0.00741
NP_441715.1_4 Forward -51 -41 17.3846 0.0106
NP_440730.1_4 Reverse -76 -95 -4.13045 0.298
NP_440183.1_9 Reverse -45 -64 -19.0768 0.277
NP_441198.1_8 Forward -112 -102 12.783 0.116
NP_440379.1_5 Reverse -43 -62 -8.16202 0.25
NP_441468.1_1 Forward -51 -44 15.8704 0.0124
NP_441468.1_1 Reverse -44 -51 15.8704 0.0124
NP_441015.1_10 Reverse -286 -305 -7.67036 0.27
NP_441673.1_1 Forward -52 -43 20.8459 0.000698
NP_441673.1_1 Reverse -43 -52 20.8459 0.000698
NP_441731.1_3 Forward -64 -45 -1.96717 0.284
NP_441826.1_2 Reverse -37 -51 5.30946 0.0977
NP_441826.1_2 Forward -91 -77 -3.44199 0.285
NP_442868.1_6 Reverse -41 -51 19.2529 0.00563
NP_442868.1_6 Forward -54 -44 10.3048 0.038
NP_442719.1_2 Forward -313 -295 -3.22649 0.2
NP_442719.1_2 Forward -84 -66 -5.97975 0.224
NP_442719.1_2 Forward -184 -166 -9.42131 0.264
NP_441251.1_8 Forward -266 -253 16.6774 0.254
NP_441612.1_2 Forward -52 -42 8.54929 0.21
NP_441612.1_2 Forward -91 -81 6.61303 0.283
NP_442808.1_1 Forward -53 -43 18.4657 0.00201
NP_442808.1_1 Reverse -42 -52 8.63269 0.0481
NP_441101.1_10 Reverse -39 -58 -7.86702 0.293
NP_440145.1_3 Reverse -66 -85 3.44104 0.104
NP_440145.1_3 Reverse -33 -52 0.58944 0.135
NP_442542.1_2 Forward -54 -41 15.6539 0.0793
NP_442542.1_9 Forward -59 -45 6.48882 0.235
NP_442050.1_5 Reverse -41 -51 14.3359 0.0206
NP_442050.1_5 Forward -54 -44 6.96107 0.27
NP_441114.1_3 Reverse -77 -86 6.39124 0.277
NP_441518.1_3 Reverse -33 -52 -13.6686 0.264
NP_441878.1_6 Forward -53 -43 10.4031 0.0176
NP_441878.1_6 Reverse -42 -52 10.4031 0.0176
NP_441878.1_6 Reverse -75 -85 -7.49312 0.231
NP_441036.1_8 Forward -53 -43 17.7779 0.000554
NP_441036.1_8 Reverse -42 -52 8.33817 0.174
NP_441557.1_5 Forward -52 -43 19.9609 0.000699
NP_441557.1_5 Reverse -43 -52 19.9609 0.000699
NP_441557.1_8 Reverse -212 -222 11.3859 0.252
NP_441445.1_1 Forward -61 -42 3.14605 0.218
NP_442066.2_9 Reverse -39 -52 8.47575 0.185
NP_442419.1_2 Forward -300 -281 -1.96717 0.246
NP_440101.1_3 Forward -57 -38 4.32602 0.22
NP_442347.1_2 Forward -51 -42 12.4878 0.056
NP_442347.1_2 Reverse -44 -53 11.1111 0.056
NP_442645.1_2 Reverse -35 -54 -2.75381 0.0487
NP_441037.1_4 Forward -54 -44 6.92787 0.237
NP_441633.1_3 Reverse -41 -54 10.8357 0.0286
NP_441633.1_3 Forward -54 -41 5.72248 0.0481
NP_441633.1_3 Forward -77 -64 -4.11062 0.181
NP_440136.1_2 Forward -51 -44 15.9687 0.0123
NP_440136.1_2 Reverse -44 -51 15.9687 0.0123
NP_442590.1_10 Forward -59 -40 8.06259 0.215
NP_442998.1_10 Forward -50 -43 15.5754 0.0102
NP_442998.1_10 Reverse -45 -52 15.5754 0.0102
NP_440731.1_1 Forward -165 -146 16.3224 0.163
NP_440299.1_1 Forward -56 -43 12.0151 0.0427
NP_440299.1_1 Reverse -171 -184 9.16348 0.0774
NP_440299.1_1 Forward -89 -76 2.47701 0.288
NP_440299.1_1 Reverse -39 -52 2.37867 0.291
NP_441799.1_1 Forward -56 -42 15.0436 0.0206
NP_441799.1_1 Reverse -39 -53 13.8636 0.0293
NP_441007.1_10 Reverse -38 -51 0.707601 0.219
NP_440256.1_1 Reverse -40 -59 18.879 0.00424
NP_440256.1_1 Forward -55 -36 -6.39206 0.21
NP_441229.1_10 Forward -94 -75 19.0757 0.0373
NP_441559.1_8 Forward -57 -43 19.4691 0.044
NP_441559.1_8 Forward -80 -66 -5.50694 0.264
NP_441559.1_8 Forward -79 -65 -7.08024 0.283
NP_440915.1_6 Forward -56 -42 1.96621 0.128
NP_440915.1_6 Reverse -39 -53 1.76955 0.131
NP_440997.1_6 Forward -177 -158 8.45592 0.271
NP_441296.1_5 Forward -70 -51 13.8641 0.244
NP_442785.1_7 Reverse -41 -55 10.816 0.228
NP_442452.1_3 Reverse -48 -67 0.687771 0.282
NP_441939.1_3 Forward -51 -32 12.6841 0.0997
NP_441494.1_6 Reverse -292 -305 6.1158 0.289
NP_440677.1_6 Forward -61 -42 11.9958 0.21
NP_442386.1_9 Forward -53 -44 15.7322 0.0144
NP_442386.1_9 Reverse -42 -51 13.8639 0.0289
NP_442054.1_3 Reverse -93 -112 -2.85214 0.274
NP_441340.1_5 Forward -51 -44 15.6737 0.0124
NP_441340.1_5 Reverse -44 -51 15.6737 0.0124
NP_442484.1_2 Reverse -164 -183 -0.39387 0.262
NP_442791.1_5 Forward -60 -41 -8.35868 0.279
NP_442240.1_2 Forward -51 -32 -19.9617 0.295
NP_442240.1_6 Forward -263 -244 14.8474 0.236
NP_440586.1_8 Forward -51 -44 13.2151 0.026
NP_440586.1_8 Reverse -44 -51 13.2151 0.026
NP_442251.1_6 Forward -51 -44 15.2804 0.0124
NP_442251.1_6 Reverse -44 -51 15.2804 0.0124
NP_441262.1_3 Reverse -43 -50 14.7888 0.0223
NP_441262.1_3 Forward -52 -45 14.7888 0.0223
NP_440027.1_3 Forward -62 -44 3.65664 0.267
NP_440027.1_3 Reverse -43 -61 2.87 0.284
NP_443051.1_1 Reverse -42 -51 10.4228 0.00754
NP_443051.1_1 Forward -53 -44 10.4228 0.00754
NP_439937.1_9 Reverse -42 -59 -6.64833 0.157
NP_439937.1_9 Reverse -359 -376 -11.7615 0.264
NP_440439.1_1 Forward -55 -42 12.5073 0.0244
NP_440439.1_1 Reverse -40 -53 1.9859 0.138
NP_440372.1_2 Forward -51 -44 16.3621 0.0124
NP_440372.1_2 Reverse -44 -51 16.3621 0.0124
NP_441572.1_7 Reverse -37 -56 1.47442 0.149
NP_440267.1_2 Reverse -38 -52 11.307 0.125
NP_442384.1_10 Reverse -43 -56 19.7838 0.00338
NP_442384.1_10 Forward -52 -39 4.54251 0.153
NP_442384.1_10 Forward -184 -171 3.26421 0.197
NP_442114.1_4 Reverse -43 -54 9.20345 0.17
NP_441877.1_7 Reverse -257 -276 1.96529 0.241
NP_442262.1_10 Forward -51 -44 14.1988 0.0123
NP_442262.1_10 Reverse -44 -51 14.1988 0.0123
NP_441689.1_5 Reverse -41 -51 5.78111 0.197
NP_441689.1_5 Reverse -336 -346 5.58445 0.23
NP_440344.1_10 Forward -59 -42 -0.354483 0.0414
NP_440531.1_6 Forward -60 -41 2.55606 0.154
NP_440531.1_6 Reverse -35 -54 -3.63879 0.269
NP_441965.1_10 Reverse -40 -56 2.71347 0.284
NP_440297.1_9 Forward -51 -41 -0.118297 0.282
NP_440297.1_9 Reverse -44 -54 -0.118297 0.282
NP_442280.1_10 Reverse -165 -183 15.3893 0.113
NP_441896.1_3 Forward -61 -42 1.37609 0.217
NP_440894.1_10 Reverse -84 -103 4.12936 0.258
NP_442078.1_9 Forward -277 -260 12.4285 0.264
NP_440999.1_2 Reverse -359 -378 10.5209 0.245
NP_440999.1_9 Forward -56 -42 9.43936 0.0639
NP_440888.1_2 Forward -52 -38 17.4035 0.00402
NP_440888.1_2 Reverse -43 -57 16.4202 0.00685
NP_442892.1_9 Reverse -106 -120 11.9953 0.296
NP_440179.1_6 Reverse -44 -63 3.44104 0.269
NP_442277.1_4 Forward -61 -42 14.6499 0.0423
NP_441543.1_2 Reverse -44 -53 18.486 0.00236
NP_441543.1_2 Forward -51 -42 16.9127 0.00359
NP_441304.1_10 Forward -17 -8 13.5694 0.239
NP_441551.1_5 Forward -56 -40 7.53099 0.245
NP_441319.1_8 Forward -62 -44 4.9357 0.285
NP_442966.1_1 Forward -246 -232 14.9459 0.241
NP_441469.1_8 Forward -53 -44 16.126 0.00797
NP_441469.1_8 Reverse -42 -51 6.48957 0.227
NP_443064.1_6 Forward -52 -42 12.5669 0.0796
NP_442337.1_8 Forward -284 -265 4.81767 0.21
NP_442337.1_8 Forward -63 -44 4.03102 0.21
NP_442578.1_7 Forward -51 -44 14.5921 0.026
NP_442578.1_7 Reverse -44 -51 14.5921 0.026
NP_440710.1_1 Forward -60 -42 -8.04399 0.254
NP_440148.1_1 Forward -121 -102 4.52268 0.186
NP_441462.1_2 Forward -52 -42 11.5831 0.00406
NP_441462.1_2 Reverse -43 -53 11.5831 0.00406
NP_443062.1_1 Forward -52 -34 13.8113 0.0569
NP_443062.1_6 Forward -60 -41 9.3409 0.128
NP_443062.1_6 Reverse -35 -54 3.44104 0.237
NP_440889.1_4 Forward -367 -348 7.17762 0.224
NP_442204.1_1 Forward -56 -45 0.0586712 0.284
NP_440504.1_7 Reverse -327 -346 1.57275 0.238
NP_442487.1_5 Reverse -5 -24 6.09517 0.209
NP_440516.1_2 Forward -58 -40 -1.25915 0.282
NP_440516.1_8 Forward -52 -43 16.9127 0.00442
NP_440516.1_8 Reverse -43 -52 16.9127 0.00442
NP_442428.1_4 Forward -53 -34 4.12936 0.238
NP_442428.1_5 Forward -51 -44 15.8704 0.0124
NP_442428.1_5 Reverse -44 -51 15.8704 0.0124
NP_441267.1_1 Forward -58 -39 3.24438 0.234
NP_442120.1_10 Reverse -298 -317 -11.3086 0.262
NP_442120.1_10 Reverse -175 -194 -12.9802 0.279
NP_441867.1_2 Forward -364 -345 -16.2252 0.291
NP_440673.1_2 Reverse -165 -184 7.95079 0.286
NP_440673.1_3 Forward -50 -43 12.4288 0.0426
NP_440673.1_3 Reverse -45 -52 12.4288 0.0426
NP_440673.1_3 Forward -83 -76 8.98723 0.203
NP_440673.1_3 Forward -323 -316 6.62729 0.281
NP_440865.1_9 Forward -220 -201 -8.94866 0.273
NP_441052.1_2 Forward -52 -42 19.9412 0.00106
NP_441052.1_2 Reverse -43 -53 10.5014 0.0285
NP_442219.1_9 Forward -51 -42 17.7976 0.00718
NP_442219.1_9 Reverse -44 -53 8.35786 0.0681
NP_440436.1_4 Reverse -44 -53 18.1905 0.00233
NP_440436.1_4 Forward -51 -42 17.2072 0.00233
NP_441884.1_9 Reverse -40 -59 -21.4367 0.245
NP_440314.1_9 Forward -84 -65 -9.83364 0.278
NP_441719.1_2 Forward -350 -336 14.5017 0.278
NP_441719.1_4 Forward -51 -44 16.3621 0.0124
NP_441719.1_4 Reverse -44 -51 16.3621 0.0124
NP_441733.1_10 Reverse -40 -53 9.85238 0.106
NP_441004.1_1 Forward -116 -97 -7.76869 0.2
NP_440328.1_4 Reverse -37 -56 1.17943 0.232
NP_442312.1_1 Reverse -154 -173 14.7491 0.211
NP_443054.1_2 Forward -54 -40 1.47456 0.245
NP_443054.1_2 Reverse -41 -55 1.08123 0.251
NP_442430.1_10 Reverse -33 -52 10.3234 0.262
NP_441851.1_10 Forward -53 -43 16.008 0.00552
NP_441851.1_10 Reverse -42 -52 15.8113 0.00552
NP_442856.1_7 Forward -61 -42 -2.75381 0.237
NP_442515.1_1 Reverse -42 -56 2.35953 0.137
NP_442515.1_1 Forward -53 -39 0.982901 0.174
NP_442515.1_1 Reverse -65 -79 -1.37704 0.253
NP_441683.1_7 Reverse -322 -341 -4.72043 0.244
NP_440463.1_8 Reverse -159 -178 6.53177 0.269
NP_441349.1_10 Reverse -33 -52 -1.96717 0.112
NP_441349.1_10 Forward -62 -43 -7.76869 0.258
NP_441409.1_6 Forward -58 -39 -8.06369 0.162
NP_441409.1_6 Forward -91 -72 -11.1119 0.215
NP_440432.1_9 Forward -51 -36 12.6646 0.0232
NP_440474.1_8 Reverse -44 -58 5.99717 0.235
NP_440588.1_2 Forward -61 -42 0.58944 0.146
NP_442006.1_2 Reverse -53 -70 -15.8908 0.23
NP_442006.1_2 Reverse -52 -69 -16.8741 0.265
NP_440483.1_4 Reverse -41 -60 2.75272 0.288
NP_441570.1_1 Forward -52 -34 -0.472507 0.0472
NP_441570.1_1 Reverse -43 -61 -14.8288 0.227
NP_441078.1_4 Forward -52 -43 19.6659 0.0007
NP_441078.1_4 Reverse -43 -52 19.6659 0.0007
NP_441078.1_4 Reverse -76 -85 -1.6719 0.266
NP_440526.1_3 Forward -51 -40 10.2846 0.0646
NP_440526.1_3 Reverse -102 -113 1.82816 0.267
NP_441432.1_8 Reverse -42 -51 16.8143 0.00595
NP_441432.1_8 Forward -53 -44 8.25953 0.0755
NP_441432.1_8 Reverse -75 -84 5.40793 0.158
NP_442320.1_8 Reverse -37 -51 4.03116 0.0559
NP_442344.1_7 Forward -51 -32 -10.227 0.291
NP_441732.1_2 Forward -56 -40 -16.3627 0.165
NP_440760.1_1 Forward -52 -33 -2.95047 0.0334
NP_440199.1_10 Reverse -40 -50 7.25653 0.231
NP_440199.1_10 Reverse -79 -89 6.66654 0.287
NP_442624.1_5 Forward -296 -277 11.3075 0.268
NP_442353.1_4 Reverse -37 -56 0.0970122 0.281
NP_440913.1_1 Forward -54 -36 6.50899 0.224
NP_441072.1_2 Reverse -32 -51 7.57094 0.256
NP_440713.1_4 Forward -62 -43 5.40766 0.21
NP_442489.1_2 Forward -63 -44 4.916 0.203
NP_442489.1_7 Forward -52 -43 20.1576 0.000695
NP_442489.1_7 Reverse -43 -52 20.1576 0.000695
NP_442489.1_7 Reverse -76 -85 -1.6719 0.235
NP_442489.1_7 Forward -85 -76 -1.77023 0.247
NP_440559.1_1 Forward -51 -42 17.4043 0.00658
NP_440559.1_1 Reverse -44 -53 8.75118 0.0586
NP_441659.2_8 Forward -52 -42 18.1713 0.00133
NP_441659.2_8 Reverse -43 -53 11.9764 0.0147
NP_442913.1_10 Reverse -34 -53 8.94757 0.0464
NP_442913.1_10 Reverse -67 -86 -5.11376 0.257
NP_440708.1_6 Forward -287 -268 -3.83545 0.225
NP_440708.1_6 Forward -66 -47 -4.81876 0.232
NP_442776.1_1 Forward -168 -149 4.62101 0.274
NP_442776.1_2 Forward -397 -378 9.43923 0.258
NP_442346.1_5 Reverse -42 -52 16.6963 0.00248
NP_442346.1_5 Reverse -75 -85 11.3864 0.0681
NP_442346.1_5 Forward -53 -43 9.02648 0.118
NP_440545.1_3 Reverse -39 -56 1.41547 0.119
NP_440831.1_3 Reverse -50 -69 6.48422 0.273
NP_440459.1_2 Reverse -34 -51 10.6586 0.193
NP_441653.1_2 Reverse -32 -51 19.1843 0.0274
NP_441888.1_7 Forward -57 -43 4.12949 0.225
NP_441888.1_10 Forward -183 -164 19.4619 0.0946
NP_441948.1_4 Forward -59 -41 18.8987 0.0124
NP_441948.1_4 Reverse -36 -54 4.83737 0.0877
NP_441358.1_2 Reverse -316 -335 22.0256 0.0487
NP_441833.1_4 Forward -51 -44 15.9687 0.0124
NP_441833.1_4 Reverse -44 -51 15.9687 0.0124
NP_442162.1_9 Forward -51 -44 16.2637 0.0124
NP_442162.1_9 Reverse -44 -51 16.2637 0.0124
NP_442073.1_6 Forward -193 -174 -3.63879 0.291
NP_442199.1_5 Forward -192 -173 5.50599 0.0951
NP_442140.1_3 Reverse -44 -54 14.238 0.0486
NP_442140.1_3 Forward -51 -41 10.3048 0.0902
NP_440875.1_9 Reverse -45 -55 14.3096 0.0453
NP_440875.1_9 Forward -50 -40 7.69067 0.255
NP_441813.1_5 Forward -54 -44 19.4496 0.00647
NP_441813.1_5 Reverse -41 -51 18.1713 0.00743
NP_440594.1_8 Reverse -44 -57 11.9167 0.152
NP_440590.1_4 Reverse -44 -57 14.1789 0.0112
NP_440590.1_4 Forward -51 -38 11.229 0.0216
NP_440567.1_1 Reverse -44 -58 4.52282 0.118
NP_442497.1_10 Forward -51 -42 10.4228 0.0087
NP_442497.1_10 Reverse -44 -53 10.4228 0.0087
NP_440821.1_4 Forward -54 -44 10.2065 0.0163
NP_440821.1_4 Reverse -41 -51 9.41981 0.0286
NP_441239.1_9 Forward -54 -42 14.1986 0.0288
NP_441239.1_9 Reverse -41 -53 7.80712 0.148
NP_441727.1_3 Forward -191 -172 9.3409 0.189
NP_441892.1_4 Reverse -290 -309 3.93269 0.203
NP_442138.1_10 Forward -52 -33 -6.29373 0.282
NP_440546.1_4 Reverse -43 -53 11.8882 0.0679
NP_440546.1_4 Forward -52 -42 10.046 0.109
NP_441230.1_3 Reverse -41 -60 4.52268 0.269
NP_440462.1_6 Forward -54 -44 17.2863 0.00752
NP_440462.1_6 Reverse -41 -51 9.61647 0.0429
NP_440868.1_4 Forward -56 -44 20.1968 0.00865
NP_440868.1_4 Reverse -39 -51 7.80712 0.0637
NP_442402.1_4 Reverse -184 -203 -2.55791 0.2
NP_441848.1_4 Forward -130 -114 11.6568 0.216
NP_441084.1_6 Forward -186 -172 16.422 0.0685
NP_441084.1_6 Reverse -74 -88 9.15021 0.292
NP_440653.1_10 Forward -183 -164 4.12936 0.252
NP_440696.1_3 Reverse -43 -61 2.37909 0.216
NP_440696.1_3 Reverse -165 -183 0.510803 0.229
NP_442039.1_4 Forward -51 -44 15.1821 0.0124
NP_442039.1_4 Reverse -44 -51 15.1821 0.0124
NP_441926.1_3 Forward -52 -36 5.46674 0.17
NP_441926.1_3 Forward -294 -278 2.41848 0.276
NP_442837.1_3 Forward -51 -44 15.7721 0.0124
NP_442837.1_3 Reverse -44 -51 15.7721 0.0124
NP_440160.1_9 Reverse -322 -341 9.24257 0.246
NP_442053.1_1 Forward -52 -43 18.3876 0.0007
NP_442053.1_1 Reverse -43 -52 18.3876 0.0007
NP_440505.1_3 Reverse -41 -51 18.3679 0.00213
NP_440505.1_3 Forward -54 -44 15.9097 0.00857
NP_440505.1_3 Reverse -74 -84 5.19158 0.241
NP_442255.1_3 Forward -270 -251 8.45592 0.279
NP_441408.2_1 Forward -336 -317 31.5637 0.000164
NP_441408.2_3 Forward -387 -368 29.7937 0.00048
NP_441408.2_4 Forward -219 -200 31.662 0.0000535
NP_441408.2_5 Forward -303 -284 29.5971 0.000769
NP_441408.2_6 Forward -357 -338 30.2854 0.000339
NP_441408.2_7 Forward -186 -167 25.9588 0.00684
NP_441408.2_8 Forward -273 -254 31.5637 0.0000635
NP_441408.2_9 Forward -249 -230 23.3039 0.0212
NP_440914.1_1 Forward -52 -42 17.5935 0.000537
NP_440914.1_1 Reverse -43 -53 8.6151 0.186
NP_441011.1_8 Reverse -44 -53 16.9127 0.00602
NP_441011.1_8 Forward -51 -42 8.25953 0.144
NP_441011.1_8 Forward -74 -65 5.3096 0.271
NP_442533.1_6 Forward -52 -43 17.2076 0.00137
NP_442533.1_6 Reverse -43 -52 17.2076 0.00137
NP_442232.1_3 Forward -204 -185 -9.34199 0.25
NP_441482.1_7 Reverse -37 -51 -10.2268 0.209
NP_439944.1_9 Forward -51 -41 10.5014 0.0887
NP_439944.1_9 Reverse -77 -87 5.09324 0.277
NP_440816.1_8 Forward -272 -258 16.7152 0.282
NP_440116.1_8 Forward -51 -32 -8.752 0.26
NP_440115.1_6 Reverse -40 -50 6.8632 0.167
NP_440115.1_6 Forward -55 -45 6.66654 0.172
NP_440007.1_4 Forward -195 -176 13.5691 0.19
NP_442673.1_7 Forward -99 -80 12.9387 0.239
NP_441106.1_1 Forward -53 -44 18.191 0.0028
NP_441106.1_1 Reverse -42 -51 9.63616 0.0311
NP_440646.1_9 Reverse -307 -326 14.4541 0.216
NP_442928.1_6 Reverse -268 -281 17.4239 0.263
NP_442306.1_3 Reverse -290 -309 14.1591 0.192
NP_442306.1_10 Forward -57 -38 -10.522 0.11
NP_441286.1_1 Reverse -42 -54 6.03717 0.0258
NP_441286.1_1 Forward -53 -41 3.38223 0.0467
NP_440670.1_8 Forward -52 -43 18.3876 0.000699
NP_440670.1_8 Reverse -43 -52 18.3876 0.000699
NP_440670.1_8 Forward -85 -76 3.44131 0.267
NP_440886.1_7 Forward -53 -43 17.7774 0.0011
NP_440886.1_7 Reverse -42 -52 7.94438 0.0805
NP_442614.1_2 Reverse -50 -64 9.2427 0.242
NP_442614.1_2 Reverse -43 -57 6.48943 0.291
NP_442614.1_2 Forward -52 -38 5.70279 0.298
NP_440767.1_2 Forward -171 -152 -1.57384 0.269
NP_442072.1_9 Forward -53 -35 -2.93078 0.0325
NP_440907.2_8 Reverse -44 -54 7.94438 0.117
NP_440907.2_8 Reverse -102 -112 5.38779 0.203
NP_441463.1_5 Forward -53 -39 13.4709 0.188
NP_441626.1_2 Forward -51 -44 15.7721 0.0124
NP_441626.1_2 Reverse -44 -51 15.7721 0.0124
NP_442365.1_7 Reverse -39 -58 3.14605 0.16
NP_440107.1_2 Forward -57 -38 15.6341 0.286
NP_442615.1_1 Forward -61 -43 -1.55415 0.13
NP_442615.1_1 Reverse -34 -52 -5.68405 0.22
NP_440387.1_1 Reverse -43 -59 -1.02311 0.142
NP_441431.1_2 Forward -55 -41 10.1271 0.169
NP_441836.1_2 Forward -58 -39 8.45592 0.101
NP_441993.1_1 Forward -52 -33 3.11618 0.241
NP_440814.1_8 Reverse -65 -84 4.71934 0.269
NP_440114.1_10 Reverse -43 -57 11.0127 0.127
NP_440114.1_10 Forward -52 -38 10.4227 0.148
NP_440114.1_10 Forward -85 -71 8.16106 0.213
NP_441425.1_3 Forward -354 -344 17.7779 0.273
NP_442323.1_7 Reverse -109 -128 2.16195 0.271
NP_442357.1_8 Reverse -241 -260 7.57094 0.241
NP_441720.1_2 Reverse -245 -264 6.88182 0.217
NP_441272.1_8 Forward -170 -152 13.0972 0.296
NP_440293.1_3 Reverse -167 -186 -5.50708 0.279
NP_442743.1_4 Reverse -44 -63 1.86774 0.174
NP_439910.1_2 Reverse -35 -52 -4.28772 0.0697
NP_442867.1_8 Forward -69 -50 5.89931 0.273
NP_440457.1_1 Forward -56 -44 10.7571 0.092
NP_440457.1_1 Reverse -39 -51 -0.649339 0.271
NP_440798.1_6 Reverse -44 -57 5.23083 0.14
NP_442680.1_6 Reverse -145 -159 19.3036 0.0911
NP_440142.1_7 Forward -183 -164 5.50599 0.287
NP_441984.1_3 Forward -188 -170 13.3922 0.153
NP_442509.1_9 Reverse -43 -53 16.2041 0.00739
NP_442509.1_9 Forward -52 -42 8.14104 0.192
NP_441253.1_1 Reverse -276 -295 11.6025 0.202
NP_440554.1_4 Reverse -44 -54 16.4996 0.0189
NP_440554.1_4 Forward -51 -41 8.92815 0.0646
NP_441761.1_8 Forward -348 -329 17.2306 0.296
NP_441885.1_5 Forward -52 -42 20.9245 0.000538
NP_441885.1_5 Reverse -43 -53 11.4848 0.00668
NP_440478.1_10 Forward -54 -40 9.04604 0.257
NP_442341.1_7 Reverse -42 -56 2.75286 0.247
NP_442341.1_7 Forward -53 -39 1.47456 0.288
NP_442341.1_9 Forward -54 -40 9.34041 0.155
NP_443000.1_7 Reverse -41 -51 19.9412 0.00223
NP_443000.1_7 Forward -54 -44 11.5831 0.0344
NP_441842.1_1 Reverse -45 -58 17.1282 0.0356
NP_440275.1_3 Forward -54 -44 15.418 0.0178
NP_440275.1_3 Reverse -41 -51 15.123 0.0182
NP_440091.1_1 Forward -56 -44 10.1671 0.0498
NP_440091.1_1 Reverse -39 -51 8.88877 0.0567
NP_442495.1_5 Reverse -286 -305 11.8975 0.23
NP_440149.1_8 Reverse -43 -62 -5.01543 0.218
NP_441875.1_4 Forward -378 -359 20.3531 0.141
NP_440216.1_1 Forward -52 -38 17.7975 0.00129
NP_440216.1_1 Reverse -43 -57 17.7975 0.00129
NP_440216.1_9 Reverse -275 -284 8.65285 0.286
NP_440172.1_1 Forward -52 -42 15.0247 0.00945
NP_440172.1_1 Reverse -43 -53 8.73149 0.0586
NP_442371.1_1 Forward -359 -349 11.8776 0.273
NP_442015.1_10 Forward -56 -43 12.114 0.0372
NP_442015.1_10 Reverse -39 -52 2.87088 0.187
NP_441226.1_7 Forward -51 -44 14.4934 0.0123
NP_441226.1_7 Reverse -44 -51 14.4934 0.0123
NP_441226.1_7 Forward -335 -328 5.34865 0.289
NP_441111.1_7 Forward -51 -43 18.7023 0.00294
NP_441111.1_7 Reverse -44 -52 18.7023 0.00294
NP_441766.1_2 Forward -52 -43 17.5026 0.00297
NP_441766.1_2 Reverse -43 -52 17.5026 0.00297
NP_440416.1_9 Reverse -36 -55 -8.752 0.12
NP_440416.1_9 Forward -59 -40 -14.5535 0.178
NP_440416.1_9 Forward -63 -44 -17.8968 0.248
NP_440261.1_5 Reverse -44 -57 3.26421 0.0649
NP_440261.1_5 Forward -51 -38 -2.73398 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGATGAATTGTCTGAGGAAGACCGTTTGACCGTAGACCGGGCTCGGAAAATTGAGCGTTTCCTTTCCCAACCCTTCTTCGTCGCCGAAGTATTTACCGGTGCCCCCGGCAAGTACGTTTCCCTGGCTGACACCATCAAAGGTTTCAAAGCGATTTTGGCTGGTGAATTGGATGATTTACCGGAGCAAGCTTTCTACCTGGTGGGAGACATTGAAGAAGCTAAGGCCAAAGGTGCCAAGCTCAAAGAGGGTTAAGTTAATAACCTGGGGTCTAGGTTAGGAAATAGTTAGGGGGAATAGCAGTGGTTTTCTAGGATGACCATTGCCTGTTATCCCCCTTCTTCCTGGCCGGCGATCGCCAGTTGTTTGTATAGAAACGCTATCAAAGGGAAATTCCTAAAA

CDS

ATGACGTTAACAGTACGGGTAATCACACCGGATAAGGTAGTTTGGGATGAGGAAGTGCAGGAACTCATTCTCCCCAGCACCACCGGTCAACTGGGTATCCTCAGTAACCATGCTCCCCTGCTCACCGCTTTGGAAATTGGCGTGATGCGGGTGCGCCCAGGTAAAGACTGGCAGAATATTGCCGTCATGGGGGGTTTTGCCGAGGTAGAAAATAATGAAGTTAAGGTATTGGTCAACGGCGCTGAATTAGGCACCACCATTGATGCTGAATCGGCCCGCCAAGCCTACACCGCAGCCCAGGGGGCTTTGGAAGAGGCCAACCGGGGGGAAGATAAACCCAACCAACTGAAAGCTTCTAACAATTACAAAAAAGCTCGGGCTCGCCTGCAAGCGGCCGGTGGAGCCGTCTAG

Protein

MTLTVRVITPDKVVWDEEVQELILPSTTGQLGILSNHAPLLTALEIGVMRVRPGKDWQNIAVMGGFAEVENNEVKVLVNGAELGTTIDAESARQAYTAAQGALEEANRGEDKPNQLKASNNYKKARARLQAAGGAV