Your browser is old and dusty. Try Google Chrome!

Details for slr1319

ORF slr1319
Accession NP_439913.1
Symbol
Category iron(III) dicitrate transport system substrate-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -102 -116 14.6509 0.127
NP_441061.1_2 Forward -335 -321 4.42448 0.148
NP_441061.1_2 Forward -341 -327 0.786239 0.199
NP_441061.1_2 Forward -68 -54 0.0979218 0.218
NP_441061.1_2 Forward -358 -344 -1.27871 0.255
NP_440795.1_7 Reverse -159 -166 10.8555 0.132
NP_441418.1_6 Reverse -368 -387 -19.6667 0.093
NP_441418.1_6 Forward -389 -370 -22.3217 0.175
NP_441418.1_6 Forward -111 -92 -30.7781 0.296
NP_440897.1_6 Forward -111 -92 -3.44288 0.244
NP_441453.1_4 Reverse -102 -110 7.19758 0.0757
NP_441453.1_4 Forward -111 -103 6.70593 0.121
NP_441453.1_4 Forward -53 -45 4.93597 0.224
NP_441453.1_4 Reverse -327 -335 4.24765 0.259
NP_441453.1_4 Forward -359 -351 4.14932 0.264
NP_441453.1_4 Forward -167 -159 3.85433 0.284
NP_441453.1_7 Reverse -120 -127 12.9205 0.23
NP_442151.1_1 Reverse -107 -126 4.12936 0.287
NP_442151.1_6 Forward -336 -322 10.0294 0.133
NP_442151.1_6 Forward -111 -97 9.43936 0.148
NP_440561.1_4 Forward -338 -319 12.7242 0.241
NP_441818.1_9 Reverse -33 -52 4.916 0.153
NP_440226.1_1 Forward -167 -148 7.96426 0.0959
NP_440150.1_2 Forward -334 -315 8.94676 0.221
NP_440996.1_3 Reverse -320 -338 11.8189 0.221
NP_442287.1_1 Forward -391 -381 13.7459 0.277
NP_442655.1_10 Forward -114 -95 -12.2919 0.261
NP_442173.1_1 Reverse -381 -389 6.3126 0.191
NP_442173.1_1 Reverse -103 -111 5.82095 0.2
NP_442173.1_1 Forward -110 -102 5.72262 0.203
NP_442752.1_4 Forward -111 -104 13.8055 0.0199
NP_442752.1_4 Reverse -44 -51 5.25066 0.256
NP_443027.1_4 Reverse -156 -166 10.0098 0.144
NP_443027.1_4 Forward -113 -103 9.41981 0.163
NP_443027.1_4 Forward -338 -328 7.55152 0.24
NP_442975.1_10 Reverse -98 -112 9.93039 0.0607
NP_441225.1_1 Forward -69 -50 -9.53865 0.297
NP_440784.1_7 Forward -166 -159 9.67555 0.104
NP_440784.1_7 Reverse -103 -110 6.23397 0.241
NP_440784.1_7 Forward -110 -103 6.13563 0.241
NP_442909.1_7 Forward -68 -54 6.19383 0.255
NP_440061.1_9 Forward -113 -99 11.602 0.107
NP_440061.1_9 Forward -391 -377 6.0955 0.261
NP_440061.1_9 Forward -46 -32 5.99717 0.264
NP_440110.1_8 Reverse -100 -119 -1.86883 0.252
NP_441054.1_4 Reverse -340 -358 -3.91409 0.288
NP_442062.1_8 Forward -111 -101 7.84651 0.0871
NP_442062.1_8 Forward -359 -349 4.60159 0.206
NP_442062.1_8 Reverse -327 -337 4.10993 0.232
NP_440761.1_4 Reverse -97 -116 -13.5702 0.257
NP_441859.1_3 Forward -112 -93 1.08032 0.296
NP_440304.1_4 Reverse -325 -335 7.74818 0.101
NP_442242.1_4 Forward -110 -103 12.4288 0.0393
NP_440044.1_8 Reverse -351 -370 1.86774 0.161
NP_440044.1_8 Reverse -159 -178 -3.3438 0.282
NP_441781.1_7 Forward -342 -323 2.85105 0.199
NP_441208.1_9 Reverse -99 -113 15.6342 0.0815
NP_441594.1_6 Reverse -324 -343 4.62101 0.216
NP_441594.1_6 Forward -130 -111 1.37609 0.268
NP_442276.1_2 Reverse -315 -334 2.3594 0.299
NP_441109.1_3 Forward -61 -42 16.6165 0.101
NP_442110.1_7 Reverse -102 -116 2.65453 0.222
NP_440856.1_7 Forward -158 -139 -8.26035 0.27
NP_441083.1_3 Forward -331 -321 15.0242 0.138
NP_441083.1_5 Forward -111 -101 10.6981 0.0184
NP_441083.1_5 Forward -69 -59 3.22496 0.178
NP_441083.1_5 Reverse -102 -112 2.04498 0.195
NP_441083.1_5 Forward -359 -349 1.06167 0.218
NP_442827.1_8 Reverse -94 -113 -1.27961 0.245
NP_441149.1_7 Reverse -65 -84 0.294447 0.284
NP_441738.1_2 Reverse -104 -111 15.28 0.0102
NP_441738.1_4 Forward -63 -44 12.3892 0.122
NP_441558.1_5 Forward -113 -94 8.55425 0.147
NP_441558.1_5 Forward -361 -342 5.40766 0.251
NP_440209.1_1 Forward -111 -103 14.8674 0.012
NP_440209.1_1 Reverse -102 -110 8.57422 0.0425
NP_441713.1_1 Reverse -96 -115 -7.4737 0.13
NP_441713.1_2 Reverse -150 -169 14.7491 0.291
NP_441770.1_5 Forward -350 -331 2.0644 0.238
NP_440178.1_7 Reverse -349 -368 -20.5517 0.194
NP_442570.1_3 Forward -344 -325 -1.18052 0.212
NP_442570.1_3 Reverse -111 -130 -2.26216 0.212
NP_442570.1_3 Reverse -110 -129 -2.85214 0.215
NP_442570.1_3 Forward -338 -319 -7.08038 0.265
NP_441716.1_1 Forward -111 -97 20.8458 0.00829
NP_441716.1_1 Reverse -327 -341 12.291 0.0807
NP_441716.1_1 Reverse -51 -65 7.86607 0.156
NP_442111.1_4 Reverse -101 -115 13.4709 0.0383
NP_441624.1_7 Forward -336 -322 17.6008 0.121
NP_440851.1_6 Reverse -222 -239 5.25038 0.288
NP_440906.1_5 Forward -110 -103 12.0355 0.0724
NP_440906.1_5 Reverse -103 -110 12.0355 0.0724
NP_440747.1_10 Forward -114 -102 7.31547 0.00577
NP_440747.1_10 Reverse -99 -111 -2.22263 0.026
NP_440747.1_10 Reverse -347 -359 -2.51763 0.0509
NP_440747.1_10 Forward -333 -321 -11.8591 0.161
NP_441130.1_10 Reverse -348 -362 8.25939 0.139
NP_441130.1_10 Forward -113 -99 6.58777 0.183
NP_441486.1_1 Forward -339 -325 6.58777 0.0344
NP_440944.1_2 Reverse -321 -340 1.67108 0.25
NP_442634.1_4 Reverse -100 -114 -3.147 0.161
NP_442634.1_4 Forward -113 -99 -4.03198 0.179
NP_442634.1_4 Reverse -348 -362 -5.01529 0.228
NP_441639.1_3 Reverse -349 -368 2.94938 0.264
NP_440403.1_10 Reverse -318 -337 1.96607 0.282
NP_440842.1_10 Reverse -318 -332 3.14618 0.266
NP_441014.1_5 Reverse -316 -334 10.8356 0.263
NP_442848.1_1 Reverse -96 -110 -2.16369 0.263
NP_442848.1_1 Reverse -158 -172 -3.24533 0.263
NP_442848.1_4 Reverse -117 -131 6.29277 0.284
NP_441012.1_4 Reverse -323 -336 15.7522 0.163
NP_441012.1_4 Forward -334 -321 9.75405 0.272
NP_441012.1_4 Forward -171 -158 6.50913 0.278
NP_443018.1_3 Forward -335 -328 12.5271 0.0523
NP_443018.1_3 Reverse -328 -335 12.5271 0.0523
NP_443018.1_3 Forward -110 -103 5.34899 0.212
NP_443018.1_3 Reverse -103 -110 5.34899 0.212
NP_443018.1_3 Reverse -351 -358 4.26735 0.267
NP_443018.1_3 Forward -358 -351 4.16902 0.278
NP_443018.1_3 Reverse -159 -166 4.07068 0.299
NP_441634.1_8 Reverse -331 -345 7.07942 0.114
NP_441634.1_8 Reverse -348 -362 6.78443 0.114
NP_441634.1_8 Forward -113 -99 -3.54032 0.295
NP_440376.1_1 Reverse -350 -359 14.356 0.01
NP_440376.1_1 Forward -111 -102 9.73449 0.0365
NP_440376.1_1 Reverse -102 -111 9.73449 0.0365
NP_440376.1_1 Reverse -44 -53 3.34298 0.206
NP_440376.1_1 Reverse -380 -389 3.14632 0.207
NP_440376.1_1 Reverse -170 -179 1.86802 0.238
NP_440376.1_1 Forward -359 -350 0.393051 0.279
NP_440376.1_1 Reverse -113 -122 -0.295266 0.286
NP_441857.1_5 Reverse -95 -113 4.14905 0.222
NP_441857.1_5 Forward -42 -24 2.18243 0.275
NP_441002.1_3 Reverse -79 -98 18.0915 0.126
NP_443065.1_6 Forward -30 -11 4.62101 0.221
NP_442687.1_7 Forward -112 -102 7.45319 0.132
NP_442687.1_7 Forward -360 -350 4.89658 0.23
NP_442191.1_4 Reverse -103 -117 13.7079 0.132
NP_442485.1_3 Reverse -316 -335 5.70265 0.169
NP_442485.1_3 Reverse -40 -59 -4.52377 0.282
NP_442485.1_3 Forward -71 -52 -5.11376 0.287
NP_442958.1_3 Forward -122 -103 -2.36049 0.293
NP_442658.1_1 Reverse -100 -110 6.27276 0.234
NP_440141.1_4 Forward -339 -320 -6.09707 0.296
NP_441414.1_9 Reverse -380 -399 -9.83364 0.269
NP_441256.1_1 Reverse -195 -214 -7.76869 0.239
NP_441958.1_5 Forward -112 -102 11.6814 0.00361
NP_441958.1_5 Reverse -101 -111 2.53664 0.0409
NP_441958.1_5 Forward -360 -350 1.94665 0.0664
NP_441958.1_5 Reverse -43 -53 -0.609952 0.215
NP_441958.1_5 Reverse -379 -389 -1.00328 0.227
NP_440203.1_5 Forward -339 -329 13.7459 0.111
NP_440203.1_5 Forward -333 -323 8.43603 0.299
NP_439905.1_2 Forward -335 -321 13.8643 0.188
NP_439990.1_5 Forward -116 -103 8.57408 0.168
NP_442376.1_2 Reverse -97 -116 -13.5702 0.297
NP_442911.1_2 Forward -346 -327 -0.197208 0.0727
NP_442911.1_2 Reverse -92 -111 -3.3438 0.111
NP_441580.1_6 Forward -64 -45 2.0644 0.117
NP_440153.1_5 Reverse -351 -365 4.32615 0.199
NP_440153.1_5 Reverse -103 -117 4.22782 0.199
NP_442064.1_4 Forward -340 -321 11.6017 0.174
NP_440993.1_2 Forward -116 -100 3.99177 0.256
NP_440993.1_3 Reverse -92 -111 2.55527 0.203
NP_440993.1_4 Reverse -327 -344 3.28376 0.289
NP_440827.1_3 Reverse -339 -358 10.4225 0.298
NP_441099.1_5 Forward -387 -368 -9.73531 0.231
NP_441099.1_5 Reverse -92 -111 -10.227 0.247
NP_441099.1_5 Reverse -340 -359 -11.8003 0.29
NP_441099.1_5 Reverse -34 -53 -11.9969 0.294
NP_442002.1_9 Reverse -149 -156 12.4288 0.185
NP_441294.1_5 Forward -307 -289 13.7855 0.102
NP_441294.1_7 Forward -363 -349 13.1862 0.0727
NP_441294.1_7 Reverse -98 -112 9.34661 0.249
NP_441646.1_1 Reverse -343 -362 12.0942 0.098
NP_441646.1_1 Reverse -320 -339 5.11266 0.184
NP_442438.1_10 Forward -116 -102 1.86788 0.188
NP_442438.1_10 Reverse -97 -111 -0.393733 0.259
NP_442771.1_1 Forward -338 -320 -8.92897 0.21
NP_440147.1_4 Forward -113 -100 10.2457 0.0355
NP_440147.1_4 Forward -361 -348 -0.37404 0.282
NP_440147.1_4 Reverse -100 -113 -0.570702 0.291
NP_441550.1_8 Reverse -100 -110 7.64939 0.153
NP_441550.1_8 Forward -113 -103 6.46942 0.206
NP_441550.1_8 Forward -361 -351 4.89613 0.281
NP_441916.1_7 Reverse -102 -112 9.41981 0.0357
NP_441916.1_7 Reverse -350 -360 6.66654 0.0875
NP_441916.1_7 Reverse -170 -180 3.32329 0.22
NP_440465.1_10 Reverse -32 -51 -0.4922 0.29
NP_441041.1_4 Reverse -321 -340 -10.3253 0.231
NP_441041.1_4 Reverse -44 -63 -10.7186 0.236
NP_441041.1_4 Reverse -381 -400 -12.0953 0.258
NP_441041.1_7 Forward -56 -44 7.12607 0.176
NP_441547.1_2 Reverse -316 -334 6.31233 0.215
NP_442004.1_6 Forward -342 -328 7.9644 0.15
NP_442004.1_6 Forward -111 -97 6.98109 0.169
NP_442004.1_6 Forward -173 -159 1.37622 0.29
NP_441725.1_4 Forward -116 -102 4.12889 0.278
NP_441725.1_5 Forward -335 -325 9.22315 0.0553
NP_441725.1_5 Forward -158 -148 -0.216628 0.241
NP_441725.1_5 Forward -110 -100 -0.806614 0.271
NP_439966.1_7 Forward -55 -45 6.37109 0.185
NP_439966.1_7 Reverse -100 -110 5.87944 0.204
NP_439966.1_7 Forward -113 -103 4.50281 0.269
NP_439966.1_9 Reverse -42 -51 7.37455 0.253
NP_439966.1_9 Forward -344 -335 4.42462 0.253
NP_440202.1_9 Forward -236 -217 23.0089 0.0157
NP_442941.1_3 Reverse -103 -113 9.51814 0.0306
NP_442941.1_3 Reverse -159 -169 5.09324 0.126
NP_442941.1_3 Forward -110 -100 1.16001 0.15
NP_442941.1_3 Forward -358 -348 -0.0199663 0.244
NP_440260.1_8 Forward -339 -321 -2.63579 0.245
NP_442281.1_1 Reverse -322 -336 11.7003 0.0438
NP_442281.1_1 Forward -116 -102 6.78381 0.115
NP_441334.1_7 Reverse -100 -119 -11.8003 0.126
NP_442847.1_3 Reverse -209 -228 4.81688 0.279
NP_441566.1_3 Forward -227 -208 13.5691 0.24
NP_440177.1_1 Forward -115 -97 3.55906 0.291
NP_001035871.2_7 Reverse -323 -333 12.0747 0.272
NP_440437.1_1 Forward -117 -98 11.8975 0.0366
NP_442012.1_1 Forward -117 -98 2.26107 0.202
NP_441556.1_10 Reverse -344 -358 9.73513 0.293
NP_442982.1_5 Forward -132 -113 1.57275 0.231
NP_441644.1_6 Forward -111 -101 13.0576 0.0244
NP_441644.1_6 Reverse -327 -337 11.4843 0.0481
NP_441644.1_6 Reverse -102 -112 10.206 0.0628
NP_441644.1_6 Reverse -350 -360 8.04271 0.11
NP_441644.1_6 Forward -359 -349 6.17443 0.165
NP_441644.1_6 Forward -53 -43 5.38779 0.194
NP_441644.1_6 Reverse -321 -331 4.50281 0.235
NP_442215.1_1 Reverse -323 -342 3.24438 0.288
NP_442215.1_2 Reverse -100 -116 -3.57971 0.218
NP_442215.1_2 Reverse -318 -334 -3.67804 0.22
NP_442215.1_2 Forward -338 -322 -5.93965 0.262
NP_442177.1_5 Reverse -42 -56 8.06273 0.288
NP_442247.1_8 Forward -55 -41 15.4376 0.247
NP_440253.1_2 Forward -359 -341 -0.177514 0.204
NP_440253.1_2 Forward -53 -35 -2.83245 0.278
NP_440929.1_8 Reverse -102 -111 9.73449 0.0257
NP_440929.1_8 Forward -111 -102 9.4395 0.0326
NP_440929.1_8 Forward -359 -350 6.68623 0.0887
NP_442933.1_2 Reverse -241 -259 15.9491 0.227
NP_442933.1_10 Forward -111 -102 13.9627 0.0192
NP_442933.1_10 Reverse -102 -111 8.1612 0.0885
NP_442933.1_10 Reverse -350 -359 5.01461 0.204
NP_442933.1_10 Reverse -158 -167 4.52295 0.24
NP_442933.1_10 Forward -167 -158 4.12963 0.28
NP_441751.2_8 Forward -335 -321 -4.03198 0.158
NP_441751.2_8 Forward -341 -327 -5.50694 0.214
NP_442926.1_1 Forward -56 -37 -4.6221 0.278
NP_442926.1_3 Forward -178 -159 2.75272 0.295
NP_442554.1_8 Forward -335 -325 12.6647 0.0234
NP_442554.1_8 Reverse -328 -338 10.4031 0.0466
NP_442554.1_8 Reverse -351 -361 8.53483 0.074
NP_442554.1_8 Forward -110 -100 8.53483 0.074
NP_442554.1_8 Reverse -103 -113 7.55152 0.0893
NP_442554.1_8 Forward -358 -348 5.68323 0.141
NP_442554.1_8 Reverse -322 -332 4.3066 0.189
NP_442554.1_8 Forward -329 -319 2.53664 0.268
NP_441762.1_7 Forward -54 -42 -5.86088 0.246
NP_441762.1_7 Forward -112 -100 -7.04085 0.285
NP_442142.1_4 Forward -63 -50 8.67183 0.111
NP_442142.1_4 Reverse -99 -112 5.23026 0.197
NP_442142.1_4 Reverse -324 -337 4.54195 0.217
NP_442142.1_4 Forward -114 -101 3.16532 0.265
NP_442292.1_1 Forward -110 -101 8.65285 0.0335
NP_442292.1_1 Reverse -103 -112 7.76787 0.0615
NP_442292.1_1 Forward -358 -349 6.09625 0.116
NP_442292.1_1 Reverse -328 -337 5.21127 0.152
NP_440122.1_2 Reverse -100 -119 1.67108 0.243
NP_441523.1_6 Forward -115 -96 9.73422 0.169
NP_443009.1_5 Reverse -101 -112 11.5629 0.0624
NP_443009.1_5 Forward -122 -111 5.66304 0.193
NP_443009.1_5 Forward -168 -157 3.79477 0.278
NP_442408.2_1 Forward -389 -370 -5.11376 0.267
NP_441715.1_4 Reverse -103 -113 7.05986 0.118
NP_441715.1_4 Reverse -159 -169 4.10993 0.299
NP_440357.1_6 Forward -63 -44 17.404 0.0633
NP_440183.1_9 Reverse -37 -56 -20.3551 0.282
NP_441198.1_8 Reverse -325 -335 10.1462 0.296
NP_440379.1_5 Forward -339 -320 -10.522 0.28
NP_441468.1_1 Reverse -103 -110 6.13563 0.209
NP_441468.1_1 Forward -110 -103 6.0373 0.223
NP_441468.1_1 Reverse -351 -358 4.36568 0.237
NP_441468.1_1 Reverse -159 -166 4.07068 0.263
NP_441468.1_1 Reverse -328 -335 3.97235 0.277
NP_441468.1_1 Forward -335 -328 3.97235 0.277
NP_441015.1_10 Reverse -97 -116 -1.08219 0.169
NP_441015.1_10 Reverse -159 -178 -9.44032 0.282
NP_441673.1_1 Reverse -102 -111 11.1111 0.0121
NP_441673.1_1 Forward -111 -102 11.0128 0.018
NP_441673.1_1 Forward -359 -350 1.57302 0.0764
NP_441673.1_1 Reverse -350 -359 1.57302 0.0764
NP_441826.1_2 Reverse -321 -335 4.91614 0.0979
NP_441826.1_2 Forward -66 -52 -2.36035 0.271
NP_441826.1_2 Forward -117 -103 -4.03198 0.291
NP_441330.1_1 Reverse -153 -172 -12.4886 0.183
NP_442490.1_9 Reverse -315 -334 -3.14714 0.227
NP_442868.1_6 Reverse -100 -110 7.74818 0.0697
NP_442868.1_6 Forward -113 -103 0.57002 0.217
NP_442868.1_6 Reverse -348 -358 -0.0199663 0.255
NP_441056.1_1 Forward -336 -317 -4.81876 0.257
NP_443058.1_7 Forward -153 -134 6.09597 0.233
NP_442808.1_1 Reverse -101 -111 7.35439 0.0814
NP_442808.1_1 Forward -54 -44 6.76441 0.0982
NP_442808.1_1 Forward -343 -333 5.68278 0.144
NP_442808.1_1 Forward -360 -350 4.89613 0.185
NP_441101.1_10 Forward -48 -29 -4.42544 0.278
NP_442775.1_6 Reverse -107 -126 9.93088 0.285
NP_440145.1_3 Forward -121 -102 -0.688862 0.143
NP_442820.1_4 Reverse -97 -114 13.1169 0.265
NP_442542.1_2 Forward -181 -168 5.62415 0.257
NP_440342.1_7 Forward -161 -142 18.1907 0.188
NP_440558.1_2 Forward -333 -314 2.55606 0.167
NP_440558.1_2 Reverse -318 -337 -0.4922 0.203
NP_440558.1_2 Forward -339 -320 -1.47551 0.214
NP_440558.1_2 Reverse -323 -342 -4.03212 0.241
NP_442789.1_4 Reverse -381 -400 3.44104 0.163
NP_441878.1_6 Reverse -320 -330 10.7964 0.0176
NP_441878.1_6 Reverse -326 -336 10.5014 0.0176
NP_441878.1_6 Forward -331 -321 9.7148 0.0237
NP_441878.1_6 Reverse -349 -359 2.43831 0.0379
NP_441878.1_6 Forward -112 -102 0.668351 0.139
NP_441878.1_6 Reverse -101 -111 0.668351 0.139
NP_441878.1_6 Forward -337 -327 0.57002 0.14
NP_441878.1_6 Forward -360 -350 0.0783647 0.152
NP_441878.1_6 Reverse -379 -389 -6.60814 0.193
NP_441036.1_8 Reverse -43 -53 11.2881 0.128
NP_441036.1_8 Forward -112 -102 6.8632 0.213
NP_441036.1_8 Reverse -101 -111 6.76487 0.215
NP_441036.1_8 Reverse -111 -121 5.68323 0.265
NP_441036.1_8 Reverse -375 -385 5.5849 0.271
NP_441557.1_5 Reverse -102 -111 10.2261 0.0144
NP_441557.1_5 Forward -111 -102 10.1278 0.0188
NP_441557.1_5 Forward -359 -350 0.688044 0.128
NP_441557.1_5 Reverse -350 -359 0.688044 0.128
NP_441445.1_1 Forward -345 -326 4.32602 0.195
NP_441445.1_1 Reverse -371 -390 1.17943 0.259
NP_441445.1_1 Forward -339 -320 -0.197208 0.286
NP_441590.1_4 Forward -334 -315 3.73524 0.29
NP_440101.1_5 Forward -118 -99 3.73603 0.196
NP_442469.1_2 Forward -367 -349 13.0972 0.298
NP_442183.1_1 Forward -69 -55 6.29277 0.18
NP_442397.1_9 Forward -342 -323 3.04771 0.264
NP_440440.1_10 Forward -150 -136 13.6676 0.265
NP_440979.1_3 Reverse -52 -70 11.0322 0.235
NP_441574.1_1 Forward -179 -160 1.47442 0.173
NP_441574.1_1 Reverse -39 -58 -1.96717 0.222
NP_441574.1_1 Reverse -158 -177 -7.37537 0.289
NP_442444.1_6 Forward -143 -125 14.6617 0.21
NP_441549.1_9 Reverse -98 -116 -5.88071 0.198
NP_441549.1_9 Reverse -346 -364 -8.24065 0.223
NP_441549.1_9 Forward -340 -322 -8.43732 0.228
NP_440861.1_3 Forward -218 -200 14.1788 0.186
NP_442645.1_2 Forward -68 -49 -8.26035 0.123
NP_440547.1_5 Forward -59 -40 5.99764 0.292
NP_441037.1_4 Forward -55 -45 8.48718 0.237
NP_441037.1_4 Forward -113 -103 6.14821 0.278
NP_441037.1_4 Forward -361 -351 5.85583 0.296
NP_440151.1_5 Reverse -107 -126 5.01433 0.262
NP_441633.1_3 Forward -113 -100 -3.81562 0.177
NP_441633.1_3 Reverse -348 -361 -6.17557 0.238
NP_440136.1_2 Reverse -103 -110 6.23397 0.171
NP_440136.1_2 Forward -110 -103 6.13563 0.193
NP_440136.1_2 Reverse -45 -52 3.97235 0.288
NP_442590.1_10 Forward -377 -358 6.39097 0.245
NP_442590.1_10 Reverse -102 -121 3.93269 0.283
NP_442998.1_5 Reverse -176 -186 9.61647 0.238
NP_442998.1_5 Reverse -266 -276 8.73149 0.261
NP_442998.1_10 Reverse -104 -111 15.5754 0.0102
NP_442998.1_10 Forward -109 -102 5.74231 0.255
NP_440899.1_1 Forward -218 -199 9.38336 0.214
NP_440299.1_1 Reverse -98 -111 16.6366 0.00949
NP_440299.1_1 Forward -171 -158 8.2785 0.0962
NP_440299.1_1 Forward -115 -102 7.2952 0.116
NP_440299.1_1 Forward -340 -327 3.95196 0.224
NP_440299.1_1 Reverse -166 -179 3.46031 0.243
NP_441799.1_1 Forward -363 -349 7.27547 0.147
NP_441007.1_5 Reverse -381 -400 13.9625 0.186
NP_442333.2_1 Forward -399 -380 -5.01543 0.25
NP_442333.2_5 Forward -122 -103 -14.0619 0.271
NP_440256.1_1 Forward -114 -95 -6.09707 0.201
NP_441090.1_6 Forward -330 -316 8.84938 0.262
NP_441559.1_8 Reverse -345 -359 3.04785 0.143
NP_441559.1_8 Forward -116 -102 1.08123 0.156
NP_441559.1_8 Reverse -107 -121 -6.39192 0.277
NP_441559.1_8 Reverse -97 -111 -6.98191 0.281
NP_440915.1_6 Reverse -346 -360 9.14437 0.0457
NP_440915.1_6 Reverse -98 -112 4.91614 0.0953
NP_440915.1_6 Forward -115 -101 1.76955 0.131
NP_440915.1_6 Forward -57 -43 1.17956 0.145
NP_440915.1_6 Reverse -40 -54 -1.8687 0.251
NP_441704.1_8 Reverse -91 -110 12.0933 0.122
NP_442452.1_8 Reverse -96 -110 11.9953 0.273
NP_440748.1_5 Forward -57 -38 4.81767 0.195
NP_441464.1_10 Reverse -280 -294 12.0943 0.206
NP_440695.1_5 Reverse -158 -177 3.34271 0.23
NP_439985.1_7 Forward -342 -323 9.53756 0.18
NP_442386.1_9 Forward -54 -45 9.14408 0.172
NP_442386.1_9 Forward -337 -328 9.04574 0.175
NP_440570.1_5 Reverse -340 -359 15.9291 0.111
NP_441340.1_5 Forward -110 -103 6.13563 0.175
NP_441340.1_5 Reverse -103 -110 5.93897 0.198
NP_441340.1_5 Reverse -328 -335 4.07068 0.239
NP_441340.1_5 Forward -358 -351 4.07068 0.239
NP_441340.1_5 Forward -335 -328 4.07068 0.239
NP_442484.1_2 Forward -388 -369 -0.197208 0.257
NP_442791.1_5 Reverse -43 -62 -6.78538 0.279
NP_442791.1_5 Forward -343 -324 -10.4236 0.279
NP_440168.1_9 Forward -353 -334 -4.32711 0.296
NP_440327.1_6 Forward -191 -172 4.32602 0.274
NP_442240.1_2 Reverse -103 -122 -0.688862 0.0609
NP_440586.1_8 Forward -110 -103 11.4451 0.0645
NP_440586.1_8 Forward -358 -351 7.70858 0.227
NP_440586.1_8 Forward -335 -328 7.61025 0.227
NP_440586.1_8 Reverse -328 -335 7.61025 0.227
NP_440586.1_8 Reverse -159 -166 7.41359 0.251
NP_440586.1_8 Forward -268 -261 7.02027 0.279
NP_440586.1_8 Reverse -52 -59 5.64364 0.297
NP_442251.1_6 Reverse -103 -110 12.0355 0.0627
NP_441262.1_3 Forward -111 -104 14.7888 0.0223
NP_440027.1_3 Forward -63 -45 9.26148 0.186
NP_440027.1_3 Forward -127 -109 5.91824 0.232
NP_440027.1_3 Forward -121 -103 5.1316 0.246
NP_440027.1_3 Forward -111 -93 4.34495 0.262
NP_443051.1_1 Forward -112 -103 9.93116 0.0146
NP_443051.1_1 Reverse -101 -110 0.688044 0.134
NP_443051.1_1 Forward -360 -351 0.29472 0.195
NP_439937.1_9 Forward -112 -95 -6.55 0.157
NP_439937.1_9 Forward -64 -47 -14.1214 0.287
NP_439937.1_9 Reverse -349 -366 -14.2198 0.287
NP_440408.1_7 Reverse -321 -340 11.3075 0.229
NP_440439.1_1 Forward -114 -101 1.39592 0.156
NP_440439.1_1 Reverse -99 -112 1.10092 0.162
NP_440439.1_1 Reverse -41 -54 -0.865694 0.241
NP_442239.1_8 Reverse -50 -69 7.66927 0.255
NP_442239.1_8 Reverse -109 -128 5.11266 0.285
NP_439943.1_7 Forward -145 -126 4.03102 0.285
NP_440372.1_2 Forward -110 -103 6.72562 0.0929
NP_440372.1_2 Reverse -103 -110 6.62729 0.151
NP_440372.1_2 Reverse -45 -52 4.07068 0.262
NP_440316.1_10 Reverse -326 -336 7.84651 0.245
NP_441803.1_2 Forward -358 -339 13.2741 0.0511
NP_441803.1_2 Forward -116 -97 3.14605 0.197
NP_439977.1_5 Forward -117 -98 -0.39387 0.225
NP_441572.1_7 Reverse -321 -340 4.71934 0.0931
NP_442384.1_10 Reverse -102 -115 15.4572 0.00986
NP_442384.1_10 Forward -359 -346 7.98409 0.0711
NP_442384.1_10 Reverse -158 -171 3.36254 0.193
NP_442384.1_10 Forward -111 -98 3.06754 0.203
NP_441877.1_7 Reverse -153 -172 1.57197 0.242
NP_441018.1_7 Reverse -108 -127 6.4893 0.286
NP_442262.1_10 Forward -335 -328 10.4622 0.145
NP_442262.1_10 Reverse -328 -335 10.4622 0.145
NP_440163.1_10 Reverse -324 -334 8.82982 0.26
NP_440344.1_10 Reverse -95 -112 -9.89259 0.16
NP_440344.1_10 Forward -60 -43 -12.1542 0.243
NP_440282.1_3 Reverse -316 -335 -1.7705 0.298
NP_440282.1_10 Forward -340 -321 -2.95047 0.235
NP_440189.1_1 Reverse -91 -110 15.1424 0.0289
NP_441965.1_3 Reverse -92 -111 10.9142 0.0966
NP_440297.1_9 Forward -335 -325 19.0562 0.0359
NP_440297.1_9 Reverse -328 -338 9.61647 0.0917
NP_440297.1_9 Forward -329 -319 0.0783647 0.282
NP_440297.1_9 Reverse -322 -332 -0.0199663 0.282
NP_441592.1_4 Forward -336 -317 -3.04881 0.274
NP_441896.1_3 Reverse -93 -112 0.786102 0.224
NP_441896.1_3 Reverse -341 -360 -3.14714 0.297
NP_440894.1_10 Reverse -97 -116 2.65439 0.286
NP_440999.1_1 Forward -119 -100 8.16011 0.156
NP_440999.1_9 Forward -115 -101 0.392915 0.187
NP_440999.1_9 Reverse -98 -112 -0.393733 0.205
NP_440888.1_2 Forward -111 -97 10.0287 0.107
NP_440888.1_2 Forward -359 -345 9.04542 0.139
NP_440888.1_2 Reverse -350 -364 8.25877 0.167
NP_440888.1_2 Reverse -102 -116 6.48882 0.232
NP_440792.1_5 Forward -166 -147 6.58763 0.237
NP_440600.1_4 Forward -119 -101 -7.65067 0.293
NP_442147.1_7 Reverse -42 -61 9.93088 0.253
NP_440491.1_1 Reverse -99 -118 7.89159 0.256
NP_442948.1_2 Forward -112 -93 6.09597 0.245
NP_442033.1_10 Reverse -100 -119 1.67108 0.0882
NP_442033.1_10 Forward -361 -342 -7.76869 0.186
NP_442033.1_10 Forward -113 -94 -8.45701 0.199
NP_441543.1_2 Forward -110 -101 7.47288 0.117
NP_441543.1_2 Reverse -103 -112 6.19458 0.153
NP_441543.1_2 Forward -358 -349 5.21127 0.209
NP_442845.1_2 Forward -336 -322 11.406 0.131
NP_442845.1_2 Reverse -321 -335 7.9644 0.195
NP_442845.1_2 Forward -152 -138 3.93283 0.272
NP_442845.1_2 Reverse -38 -52 3.34284 0.294
NP_441834.1_10 Forward -335 -316 18.584 0.0514
NP_441551.1_5 Forward -340 -324 14.0208 0.119
NP_441551.1_5 Forward -39 -23 6.54769 0.264
NP_441319.1_8 Reverse -344 -362 7.09898 0.263
NP_441469.1_8 Reverse -326 -335 10.9145 0.191
NP_441469.1_8 Forward -54 -45 6.09625 0.236
NP_442315.1_1 Reverse -40 -58 8.67227 0.21
NP_443064.1_5 Reverse -328 -347 16.0771 0.293
NP_443064.1_6 Reverse -102 -112 9.75513 0.199
NP_442337.1_8 Forward -347 -328 -0.885524 0.278
NP_442578.1_7 Forward -110 -103 5.93897 0.183
NP_440710.1_1 Forward -119 -101 -2.43913 0.191
NP_440071.1_2 Forward -362 -348 17.7975 0.24
NP_441462.1_2 Reverse -102 -112 10.5014 0.00824
NP_441462.1_2 Forward -111 -101 2.14332 0.0801
NP_441462.1_2 Reverse -350 -360 0.963343 0.109
NP_441462.1_2 Forward -389 -379 -0.904945 0.265
NP_441621.1_7 Reverse -100 -114 -5.11362 0.248
NP_440668.1_3 Forward -129 -110 17.3057 0.0516
NP_442204.1_1 Forward -115 -104 21.1015 0.0035
NP_442204.1_1 Reverse -323 -334 0.94365 0.281
NP_442204.1_1 Forward -150 -139 0.255333 0.282
NP_442204.1_6 Reverse -266 -285 7.47261 0.237
NP_440255.1_3 Forward -310 -300 16.6368 0.298
NP_440516.1_8 Forward -111 -102 15.6344 0.00582
NP_440516.1_8 Reverse -102 -111 7.47288 0.0581
NP_440516.1_8 Forward -53 -44 7.07956 0.0867
NP_440516.1_8 Reverse -11 -20 -0.295266 0.232
NP_442428.1_5 Reverse -103 -110 6.13563 0.209
NP_442428.1_5 Forward -110 -103 6.0373 0.212
NP_442428.1_5 Reverse -351 -358 4.66067 0.244
NP_442428.1_5 Reverse -159 -166 4.56234 0.249
NP_442428.1_5 Forward -335 -328 4.36568 0.271
NP_442428.1_5 Reverse -328 -335 4.36568 0.271
NP_440673.1_2 Forward -346 -327 8.63366 0.264
NP_440673.1_2 Reverse -41 -60 8.43855 0.27
NP_440673.1_3 Reverse -104 -111 12.4288 0.0426
NP_440673.1_3 Forward -165 -158 10.9539 0.106
NP_440673.1_3 Forward -58 -51 9.38056 0.192
NP_440673.1_3 Forward -157 -150 7.51227 0.252
NP_441052.1_2 Forward -111 -101 10.3048 0.0289
NP_441052.1_2 Forward -359 -349 7.45319 0.0712
NP_441052.1_2 Reverse -321 -331 4.3066 0.161
NP_441052.1_2 Reverse -327 -337 4.0116 0.168
NP_441052.1_2 Reverse -102 -112 0.668351 0.256
NP_441052.1_2 Reverse -368 -378 0.57002 0.256
NP_442219.1_8 Reverse -265 -284 11.4526 0.177
NP_442219.1_8 Forward -177 -158 6.71761 0.291
NP_442219.1_9 Forward -110 -101 7.96454 0.0696
NP_440436.1_4 Forward -110 -101 13.9623 0.0193
NP_440436.1_4 Reverse -103 -112 5.9975 0.174
NP_440436.1_4 Forward -358 -349 4.81753 0.239
NP_441884.1_9 Forward -56 -37 -21.535 0.25
NP_441884.1_9 Forward -114 -95 -22.0267 0.275
NP_440314.1_9 Forward -358 -339 -9.44032 0.268
NP_441719.1_4 Forward -110 -103 6.72562 0.093
NP_441719.1_4 Reverse -103 -110 6.62729 0.151
NP_441733.1_10 Reverse -41 -54 11.229 0.106
NP_441004.1_1 Reverse -315 -334 -7.17871 0.197
NP_441004.1_1 Forward -179 -160 -12.6852 0.25
NP_441004.1_1 Reverse -368 -387 -15.4385 0.275
NP_441004.1_2 Reverse -116 -135 -2.36049 0.264
NP_441004.1_2 Reverse -378 -397 -4.81876 0.297
NP_441004.1_4 Forward -154 -144 8.73149 0.267
NP_442854.1_4 Forward -116 -97 15.2399 0.214
NP_442854.1_6 Reverse -321 -340 1.37609 0.279
NP_440328.1_4 Forward -117 -98 3.14605 0.186
NP_443054.1_2 Reverse -331 -345 0.687908 0.256
NP_442430.1_2 Forward -340 -321 1.76941 0.268
NP_442308.1_8 Forward -365 -346 18.879 0.0966
NP_441851.1_10 Reverse -101 -111 6.07655 0.187
NP_441851.1_10 Reverse -326 -336 5.97822 0.19
NP_441851.1_10 Reverse -349 -359 4.79825 0.247
NP_442001.1_4 Forward -136 -117 6.29183 0.29
NP_442011.1_1 Reverse -50 -69 -3.3438 0.294
NP_441668.1_4 Forward -399 -380 0.58944 0.235
NP_441668.1_4 Forward -189 -170 0.0977854 0.247
NP_442515.1_1 Forward -390 -376 6.58777 0.0975
NP_442515.1_1 Reverse -149 -163 -0.688726 0.231
NP_442515.1_1 Reverse -169 -183 -4.03198 0.298
NP_440593.1_3 Forward -335 -316 -0.4922 0.205
NP_440593.1_9 Forward -333 -319 10.226 0.24
NP_440463.1_8 Forward -286 -267 6.43495 0.269
NP_441349.1_10 Forward -121 -102 -2.65548 0.124
NP_441349.1_10 Reverse -92 -111 -6.88371 0.238
NP_441349.1_10 Forward -369 -350 -8.752 0.278
NP_441349.1_10 Forward -340 -321 -9.53865 0.294
NP_441409.1_6 Reverse -96 -115 7.37428 0.028
NP_440432.1_4 Forward -209 -190 6.4893 0.193
NP_440432.1_9 Forward -166 -151 0.864876 0.156
NP_442843.1_1 Reverse -45 -64 -3.14714 0.222
NP_442843.1_1 Reverse -171 -190 -9.63698 0.267
NP_439960.1_4 Forward -337 -318 12.1917 0.291
NP_439960.1_10 Forward -331 -313 -0.865831 0.238
NP_440431.1_3 Forward -360 -341 -11.5053 0.286
NP_440431.1_4 Reverse -236 -255 -7.59203 0.262
NP_442450.1_5 Reverse -325 -335 6.46988 0.174
NP_440588.1_2 Reverse -318 -337 -2.65548 0.17
NP_440588.1_2 Forward -368 -349 -3.93378 0.2
NP_440195.1_4 Reverse -12 -31 3.93269 0.297
NP_443047.1_7 Reverse -334 -353 9.14423 0.188
NP_443047.1_7 Forward -52 -33 6.88262 0.228
NP_442243.1_1 Forward -365 -347 2.77167 0.204
NP_442243.1_3 Forward -282 -263 23.1063 0.064
NP_441570.1_1 Reverse -102 -120 -9.22396 0.132
NP_441570.1_1 Forward -377 -359 -12.3706 0.213
NP_441570.1_1 Reverse -327 -345 -16.9921 0.26
NP_440078.1_10 Reverse -356 -375 1.86774 0.291
NP_441078.1_4 Reverse -102 -111 9.93116 0.0203
NP_441078.1_4 Forward -111 -102 9.83282 0.0226
NP_441078.1_4 Reverse -350 -359 7.86621 0.0432
NP_441078.1_4 Forward -359 -350 0.884706 0.154
NP_441078.1_4 Reverse -321 -330 -1.37691 0.254
NP_441078.1_4 Forward -330 -321 -1.47524 0.266
NP_441078.1_4 Reverse -327 -336 -1.6719 0.266
NP_441078.1_4 Forward -336 -327 -1.77023 0.266
NP_441663.1_8 Forward -117 -98 -3.54046 0.291
NP_442443.1_1 Forward -131 -112 -6.98204 0.299
NP_440526.1_3 Forward -110 -99 9.10461 0.0988
NP_440526.1_3 Forward -389 -378 1.6315 0.267
NP_441432.1_8 Reverse -349 -358 11.3078 0.0569
NP_441432.1_8 Forward -112 -103 7.17789 0.102
NP_441432.1_8 Reverse -101 -110 7.07956 0.105
NP_441432.1_8 Reverse -367 -376 2.94966 0.28
NP_442320.1_8 Reverse -96 -110 -2.45868 0.0894
NP_442320.1_8 Forward -173 -159 -5.80194 0.249
NP_441732.1_2 Forward -115 -99 12.6449 0.00384
NP_441732.1_2 Reverse -323 -339 -16.5594 0.174
NP_440497.1_6 Forward -116 -97 -6.29373 0.264
NP_442797.1_1 Forward -52 -33 7.07928 0.152
NP_442797.1_7 Forward -343 -325 7.4923 0.198
NP_440199.1_10 Reverse -365 -375 14.0414 0.0895
NP_442510.1_5 Reverse -341 -360 14.8474 0.215
NP_440713.1_4 Reverse -92 -111 1.86774 0.277
NP_442489.1_7 Reverse -102 -111 10.6195 0.00984
NP_442489.1_7 Forward -111 -102 10.3245 0.0193
NP_442489.1_7 Reverse -350 -359 8.35786 0.0225
NP_442489.1_7 Forward -359 -350 0.884706 0.145
NP_442489.1_7 Reverse -321 -330 -1.37691 0.195
NP_442489.1_7 Forward -330 -321 -1.47524 0.203
NP_442489.1_7 Reverse -380 -389 -1.57357 0.213
NP_442489.1_7 Reverse -327 -336 -1.6719 0.235
NP_442489.1_7 Forward -336 -327 -1.77023 0.247
NP_440757.1_7 Forward -335 -317 -0.570838 0.269
NP_442079.1_7 Forward -52 -33 -0.295539 0.29
NP_440559.1_1 Forward -110 -101 7.96454 0.0739
NP_440559.1_1 Reverse -103 -112 5.40793 0.14
NP_441659.2_8 Forward -111 -101 14.828 0.00801
NP_441659.2_8 Reverse -102 -112 11.3864 0.0184
NP_441659.2_8 Forward -359 -349 6.76487 0.0678
NP_441659.2_8 Forward -389 -379 3.81494 0.15
NP_441659.2_8 Reverse -327 -337 3.02829 0.177
NP_441659.2_8 Reverse -350 -360 1.65166 0.233
NP_441659.2_8 Forward -291 -281 0.766681 0.258
NP_441022.1_1 Reverse -74 -83 12.5054 0.232
NP_442913.1_10 Forward -368 -349 -1.86883 0.178
NP_441040.1_5 Reverse -316 -335 17.0107 0.111
NP_442849.1_4 Reverse -240 -254 19.1741 0.285
NP_439956.1_7 Reverse -344 -363 4.42435 0.257
NP_441800.1_3 Forward -335 -317 7.4923 0.286
NP_442776.1_1 Reverse -322 -341 6.88262 0.214
NP_442776.1_1 Forward -329 -310 4.81767 0.268
NP_441185.1_6 Reverse -133 -152 1.47442 0.22
NP_442346.1_5 Forward -112 -102 14.9263 0.00941
NP_442346.1_5 Reverse -326 -336 14.7297 0.0103
NP_442346.1_5 Reverse -157 -167 9.51814 0.118
NP_442346.1_5 Forward -168 -158 8.4365 0.137
NP_442346.1_5 Reverse -101 -111 6.96153 0.187
NP_442346.1_5 Reverse -320 -330 6.66654 0.195
NP_442346.1_5 Reverse -349 -359 6.37155 0.205
NP_442346.1_5 Forward -360 -350 5.78156 0.229
NP_442346.1_5 Forward -337 -327 5.28991 0.253
NP_442346.1_5 Forward -331 -321 5.19158 0.256
NP_440352.1_5 Reverse -376 -395 9.73562 0.289
NP_440545.1_3 Reverse -98 -115 14.3952 0.0154
NP_440545.1_3 Forward -340 -323 7.90532 0.048
NP_440545.1_3 Reverse -323 -340 0.432165 0.139
NP_440545.1_3 Forward -115 -98 0.235503 0.143
NP_440545.1_3 Forward -363 -346 -1.92778 0.177
NP_440545.1_3 Reverse -346 -363 -5.66436 0.256
NP_440486.1_6 Reverse -314 -333 8.55425 0.242
NP_440486.1_6 Reverse -320 -339 6.29264 0.283
NP_440250.1_1 Reverse -317 -335 9.55725 0.273
NP_441653.1_2 Reverse -159 -178 3.14308 0.274
NP_441653.1_3 Reverse -121 -135 11.406 0.3
NP_440010.1_4 Reverse -154 -173 -1.47628 0.267
NP_442137.1_1 Reverse -111 -130 5.70265 0.274
NP_442551.1_4 Forward -332 -317 -3.36336 0.287
NP_442603.1_7 Forward -111 -97 11.9953 0.107
NP_442603.1_7 Forward -359 -345 6.78381 0.23
NP_440449.1_6 Forward -367 -349 5.14342 0.283
NP_441948.1_4 Forward -60 -42 -0.669169 0.139
NP_440170.1_2 Forward -117 -98 8.94757 0.265
NP_441833.1_4 Reverse -103 -110 14.1004 0.0258
NP_441833.1_4 Forward -110 -103 6.13563 0.198
NP_442162.1_9 Reverse -103 -110 6.62729 0.142
NP_442162.1_9 Forward -110 -103 6.52896 0.178
NP_440671.1_4 Reverse -321 -335 10.3243 0.161
NP_442404.1_9 Forward -108 -94 9.43874 0.271
NP_442140.1_3 Forward -110 -100 12.0747 0.0664
NP_441671.1_6 Forward -341 -322 10.3242 0.179
NP_440875.1_9 Reverse -104 -114 16.5483 0.0145
NP_440875.1_9 Reverse -352 -362 10.5134 0.212
NP_441813.1_5 Forward -113 -103 8.33817 0.047
NP_441813.1_5 Reverse -100 -110 -0.806614 0.285
NP_440590.1_4 Reverse -45 -58 20.1771 0.00597
NP_440590.1_4 Forward -110 -97 14.2773 0.011
NP_440590.1_4 Forward -358 -345 2.18257 0.0972
NP_440590.1_4 Reverse -103 -116 1.59258 0.118
NP_440567.1_1 Reverse -351 -365 9.34103 0.0455
NP_440567.1_1 Forward -110 -96 1.37622 0.208
NP_442497.1_10 Reverse -103 -112 7.86621 0.0695
NP_442497.1_10 Forward -110 -101 0.589713 0.153
NP_442497.1_10 Forward -335 -326 0.29472 0.199
NP_440821.1_4 Reverse -100 -110 8.23984 0.053
NP_440821.1_4 Reverse -325 -335 0.275027 0.19
NP_441239.1_9 Forward -338 -326 8.00379 0.145
NP_441239.1_9 Reverse -325 -337 7.70879 0.15
NP_441239.1_9 Forward -332 -320 7.02048 0.173
NP_441239.1_9 Forward -361 -349 6.03717 0.202
NP_441239.1_9 Reverse -42 -54 3.57889 0.283
NP_441239.1_9 Forward -113 -101 3.18557 0.292
NP_441727.1_3 Forward -186 -167 2.75272 0.299
NP_441892.1_1 Reverse -318 -335 -4.58271 0.264
NP_441892.1_1 Forward -120 -103 -4.77938 0.268
NP_441892.1_1 Forward -155 -138 -5.46769 0.281
NP_440665.1_2 Reverse -141 -160 -7.27704 0.298
NP_442044.1_1 Forward -116 -97 -12.6852 0.273
NP_442193.1_8 Reverse -57 -76 10.6184 0.286
NP_443035.1_10 Forward -42 -25 5.34871 0.274
NP_443035.1_10 Reverse -329 -346 5.15205 0.28
NP_441526.1_6 Reverse -42 -61 3.83436 0.271
NP_442052.1_8 Reverse -319 -329 12.7631 0.253
NP_442809.1_6 Reverse -321 -340 1.86774 0.269
NP_440546.1_4 Forward -111 -101 8.00989 0.209
NP_440546.1_4 Reverse -44 -54 6.8464 0.276
NP_440546.1_4 Forward -330 -320 6.55553 0.291
NP_442041.1_2 Reverse -314 -332 8.27895 0.293
NP_440462.1_4 Reverse -275 -289 9.14437 0.243
NP_440462.1_4 Forward -214 -200 6.98109 0.278
NP_440462.1_6 Forward -113 -103 9.12481 0.0498
NP_440462.1_6 Reverse -42 -52 7.15819 0.089
NP_440868.1_4 Reverse -98 -110 0.727295 0.201
NP_440341.1_5 Reverse -325 -344 14.6508 0.229
NP_442402.1_4 Forward -209 -190 -10.031 0.296
NP_439948.1_1 Forward -186 -169 19.8889 0.203
NP_441084.1_6 Reverse -156 -170 12.8346 0.152
NP_441084.1_6 Forward -113 -99 11.5741 0.196
NP_441084.1_6 Forward -361 -347 11.3802 0.205
NP_440653.1_10 Forward -329 -310 8.16093 0.201
NP_440696.1_3 Forward -346 -328 5.82068 0.19
NP_440696.1_3 Forward -340 -322 2.37909 0.216
NP_440696.1_3 Reverse -340 -358 -4.01242 0.294
NP_442039.1_7 Forward -239 -229 7.15819 0.279
NP_442039.1_7 Forward -42 -32 6.96153 0.286
NP_441811.1_8 Reverse -96 -110 7.66941 0.241
NP_440825.1_6 Reverse -378 -397 10.6192 0.285
NP_442837.1_3 Reverse -103 -110 6.13563 0.25
NP_442837.1_3 Forward -110 -103 5.93897 0.265
NP_440160.1_2 Forward -129 -110 -9.14533 0.293
NP_440160.1_2 Reverse -320 -339 -9.24366 0.293
NP_439994.1_3 Forward -112 -93 11.4627 0.183
NP_442053.1_1 Reverse -102 -111 9.34117 0.0666
NP_442053.1_1 Forward -111 -102 8.55452 0.0784
NP_442053.1_1 Forward -53 -44 6.09625 0.147
NP_442053.1_1 Reverse -350 -359 5.3096 0.197
NP_440505.1_3 Forward -113 -103 15.9097 0.00857
NP_440505.1_3 Reverse -100 -110 6.8632 0.169
NP_441203.1_1 Reverse -103 -122 6.78429 0.0238
NP_441203.1_1 Forward -335 -316 -20.4534 0.297
NP_441408.2_7 Forward -361 -342 -2.55715 0.272
NP_440914.1_1 Reverse -102 -112 14.7634 0.00997
NP_440914.1_1 Forward -53 -43 12.5188 0.0569
NP_440914.1_1 Forward -111 -101 7.83437 0.219
NP_441011.1_8 Reverse -103 -112 6.8829 0.18
NP_441011.1_8 Forward -166 -157 5.50626 0.256
NP_441011.1_8 Reverse -12 -21 5.21127 0.278
NP_442101.1_10 Forward -119 -100 -4.81876 0.151
NP_442533.1_6 Reverse -321 -330 13.8644 0.0178
NP_442533.1_6 Forward -359 -350 8.25953 0.0776
NP_442533.1_6 Reverse -102 -111 7.66954 0.0897
NP_442533.1_6 Forward -111 -102 7.37455 0.0898
NP_442533.1_6 Forward -330 -321 7.17789 0.0948
NP_442533.1_6 Reverse -327 -336 7.17789 0.0948
NP_442533.1_6 Reverse -350 -359 6.8829 0.101
NP_442533.1_6 Forward -336 -327 6.68623 0.105
NP_442533.1_6 Forward -53 -44 4.22796 0.186
NP_442533.1_6 Reverse -158 -167 1.86802 0.284
NP_443050.1_2 Forward -240 -221 7.7676 0.287
NP_442232.1_3 Forward -367 -348 -14.0619 0.287
NP_443016.1_1 Forward -395 -376 -5.9004 0.251
NP_441482.1_7 Forward -117 -103 6.58777 0.0271
NP_441482.1_7 Reverse -321 -335 -0.000409212 0.0612
NP_439944.1_9 Forward -110 -100 17.188 0.00584
NP_439944.1_9 Reverse -351 -361 12.8614 0.0791
NP_439944.1_9 Forward -335 -325 5.28991 0.262
NP_439944.1_9 Reverse -159 -169 5.28991 0.262
NP_439944.1_9 Forward -172 -162 4.79825 0.296
NP_440116.1_5 Forward -56 -39 3.0871 0.249
NP_440116.1_8 Forward -358 -339 -3.83545 0.158
NP_440115.1_6 Forward -114 -104 14.0414 0.0615
NP_440115.1_6 Reverse -99 -109 8.23984 0.135
NP_440115.1_6 Reverse -330 -340 5.78156 0.221
NP_440007.1_9 Reverse -323 -337 13.2743 0.163
NP_440007.1_9 Forward -57 -43 2.16287 0.281
NP_440007.1_9 Forward -115 -101 0.687908 0.292
NP_441680.1_4 Forward -126 -107 11.8975 0.153
NP_441347.1_5 Reverse -349 -363 10.3237 0.269
NP_441602.1_3 Reverse -97 -116 -3.63879 0.251
NP_441602.1_3 Reverse -345 -364 -5.50708 0.288
NP_442890.1_9 Forward -286 -267 18.584 0.113
NP_441972.1_5 Reverse -351 -370 -5.40875 0.22
NP_441106.1_1 Forward -112 -103 8.65285 0.0522
NP_441106.1_1 Reverse -101 -110 6.29291 0.0927
NP_441106.1_1 Reverse -157 -166 4.71961 0.21
NP_442306.1_10 Forward -76 -57 -19.2734 0.197
NP_441286.1_1 Forward -112 -100 9.67541 0.0217
NP_441286.1_1 Forward -337 -325 3.08724 0.05
NP_441286.1_1 Reverse -101 -113 -3.79593 0.146
NP_441286.1_1 Reverse -349 -361 -4.58258 0.165
NP_441286.1_1 Forward -390 -378 -5.17256 0.192
NP_442674.1_3 Reverse -319 -338 5.2102 0.271
NP_440670.1_8 Reverse -102 -111 16.5193 0.00214
NP_440670.1_8 Forward -111 -102 9.4395 0.0559
NP_440670.1_8 Reverse -380 -389 5.40793 0.158
NP_441479.1_1 Reverse -48 -67 9.43923 0.216
NP_440886.1_7 Forward -54 -44 12.5659 0.0805
NP_440886.1_7 Forward -112 -102 4.10949 0.253
NP_440886.1_7 Forward -285 -275 4.01116 0.255
NP_440886.1_7 Forward -390 -380 3.12618 0.296
NP_442614.1_2 Reverse -327 -341 10.521 0.234
NP_442614.1_2 Forward -323 -309 8.06273 0.255
NP_440907.2_8 Forward -52 -42 7.25606 0.123
NP_442264.1_2 Forward -340 -323 11.3469 0.185
NP_442264.1_5 Forward -336 -322 15.0442 0.222
NP_441021.1_1 Forward -335 -316 -5.60541 0.177
NP_441021.1_1 Forward -341 -322 -6.49039 0.18
NP_441021.1_1 Forward -358 -339 -9.44032 0.216
NP_440841.1_4 Reverse -378 -397 -8.752 0.25
NP_441463.1_3 Forward -369 -350 -6.58872 0.246
NP_441463.1_3 Reverse -370 -389 -10.0303 0.288
NP_441463.1_6 Forward -338 -324 9.50821 0.249
NP_441626.1_2 Reverse -171 -178 7.6106 0.119
NP_441626.1_2 Forward -110 -103 6.0373 0.212
NP_441626.1_2 Reverse -103 -110 6.0373 0.212
NP_442365.1_7 Reverse -323 -342 -5.50708 0.271
NP_442794.1_1 Reverse -346 -358 5.05386 0.236
NP_442794.1_1 Reverse -200 -212 4.46387 0.261
NP_442794.1_1 Forward -211 -199 3.77555 0.286
NP_442794.1_1 Reverse -370 -382 3.2839 0.286
NP_442794.1_1 Reverse -98 -110 2.20226 0.299
NP_440387.1_1 Reverse -102 -118 -3.38305 0.158
NP_440855.1_5 Reverse -348 -367 3.04693 0.287
NP_441963.1_1 Forward -299 -280 13.7658 0.024
NP_441836.1_2 Forward -365 -346 3.44104 0.153
NP_441836.1_2 Reverse -96 -115 2.26107 0.175
NP_441836.1_2 Reverse -33 -52 -4.42544 0.255
NP_441993.1_1 Reverse -96 -115 9.54836 0.135
NP_441993.1_1 Forward -336 -317 4.18821 0.223
NP_442323.1_7 Forward -116 -97 5.40686 0.205
NP_440287.1_6 Forward -62 -43 4.71934 0.196
NP_441552.1_3 Reverse -95 -114 14.7483 0.227
NP_440293.1_3 Reverse -313 -332 -0.197208 0.228
NP_440293.1_3 Reverse -343 -362 -3.3438 0.244
NP_440293.1_3 Reverse -106 -125 -6.49039 0.29
NP_440293.1_9 Forward -335 -321 11.6342 0.257
NP_440766.1_4 Reverse -271 -285 0.294584 0.291
NP_439988.1_3 Forward -340 -326 6.6861 0.278
NP_439988.1_3 Reverse -115 -129 6.48943 0.278
NP_441237.1_6 Forward -330 -313 8.00365 0.142
NP_441237.1_9 Forward -110 -100 10.8948 0.214
NP_441979.1_5 Forward -179 -160 -10.227 0.228
NP_440457.1_1 Reverse -323 -335 5.74217 0.138
NP_440457.1_1 Reverse -376 -388 2.10393 0.217
NP_440457.1_1 Forward -115 -103 0.628964 0.25
NP_440457.1_1 Reverse -146 -158 -0.354346 0.262
NP_440798.1_6 Reverse -351 -364 1.00259 0.24
NP_440801.1_3 Reverse -199 -218 17.3057 0.3
NP_440801.1_8 Forward -102 -83 5.211 0.192
NP_442297.1_4 Forward -57 -38 12.7242 0.263
NP_441984.1_1 Reverse -48 -66 10.3439 0.211
NP_441436.1_2 Reverse -29 -48 -6.1954 0.296
NP_442509.1_9 Forward -296 -286 12.4676 0.09
NP_442509.1_9 Reverse -44 -54 8.14104 0.192
NP_442509.1_9 Forward -234 -224 8.04271 0.192
NP_442509.1_9 Reverse -102 -112 7.94438 0.195
NP_440554.1_4 Reverse -103 -113 8.4365 0.0749
NP_440554.1_4 Forward -166 -156 7.45319 0.103
NP_441885.1_5 Forward -111 -101 11.3864 0.00668
NP_441885.1_5 Forward -359 -349 2.24165 0.0822
NP_441885.1_5 Reverse -102 -112 1.65166 0.106
NP_441885.1_5 Reverse -380 -390 -0.609952 0.215
NP_441885.1_5 Forward -179 -169 -0.904945 0.241
NP_442341.1_7 Forward -112 -98 1.76955 0.281
NP_442341.1_9 Reverse -110 -124 4.71887 0.294
NP_441756.1_2 Forward -234 -215 17.404 0.125
NP_441173.1_9 Reverse -229 -237 10.9338 0.242
NP_443000.1_7 Forward -113 -103 10.5014 0.0345
NP_443000.1_7 Reverse -348 -358 7.64985 0.0734
NP_443000.1_7 Reverse -156 -166 7.05986 0.102
NP_443000.1_7 Forward -169 -159 3.71661 0.226
NP_443000.1_7 Reverse -100 -110 0.668351 0.293
NP_440076.1_5 Reverse -44 -63 11.7 0.293
NP_440507.2_3 Forward -339 -320 10.4217 0.208
NP_442513.1_6 Reverse -61 -80 9.93006 0.296
NP_441842.1_1 Forward -109 -96 14.8666 0.0877
NP_440275.1_3 Reverse -100 -110 14.828 0.02
NP_440275.1_3 Forward -113 -103 6.46988 0.105
NP_440091.1_1 Reverse -98 -110 6.43049 0.095
NP_441359.1_5 Reverse -340 -359 3.14605 0.259
NP_439962.1_4 Forward -53 -34 -6.39206 0.283
NP_439962.1_4 Reverse -31 -50 -7.17871 0.288
NP_440175.1_7 Reverse -108 -126 9.85107 0.276
NP_442495.1_4 Reverse -106 -116 16.303 0.0771
NP_442495.1_5 Reverse -351 -370 8.06259 0.291
NP_440149.1_8 Reverse -158 -177 -0.983855 0.154
NP_440149.1_8 Reverse -269 -288 -4.32711 0.206
NP_441105.1_3 Forward -341 -322 6.68596 0.0586
NP_441105.1_3 Reverse -316 -335 -8.45701 0.272
NP_440216.1_1 Reverse -102 -116 7.66941 0.00931
NP_440216.1_1 Reverse -350 -364 -1.8687 0.0412
NP_440216.1_9 Reverse -329 -338 7.76787 0.286
NP_440172.1_1 Reverse -102 -112 8.04317 0.0692
NP_440172.1_1 Forward -53 -43 6.37155 0.105
NP_440172.1_1 Reverse -350 -360 5.28991 0.146
NP_440172.1_1 Forward -111 -101 5.19158 0.149
NP_440172.1_1 Reverse -158 -168 1.94665 0.29
NP_440172.1_1 Reverse -51 -61 1.84832 0.294
NP_442015.1_10 Forward -115 -102 10.639 0.0391
NP_442015.1_10 Reverse -108 -121 9.55739 0.0475
NP_442015.1_10 Forward -211 -198 3.46087 0.182
NP_442015.1_10 Reverse -98 -111 3.06754 0.185
NP_442015.1_10 Forward -369 -356 2.77255 0.187
NP_442015.1_10 Reverse -346 -359 0.412608 0.227
NP_442015.1_10 Forward -340 -327 -0.570702 0.272
NP_441226.1_7 Forward -358 -351 11.2485 0.0971
NP_441226.1_7 Forward -52 -45 8.59356 0.197
NP_441226.1_7 Forward -389 -382 6.52862 0.253
NP_441111.1_7 Reverse -103 -111 8.96754 0.0463
NP_441111.1_7 Forward -110 -102 8.86921 0.0589
NP_441111.1_7 Forward -358 -350 -0.570565 0.233
NP_441111.1_7 Reverse -351 -359 -0.570565 0.233
NP_441766.1_2 Reverse -102 -111 7.86621 0.0703
NP_441766.1_2 Forward -111 -102 7.66954 0.0723
NP_441766.1_2 Forward -179 -170 1.27803 0.296
NP_442417.1_5 Reverse -102 -116 4.91614 0.283
NP_440416.1_9 Forward -55 -36 -14.9469 0.182
NP_440416.1_9 Forward -174 -155 -16.3235 0.212
NP_440416.1_9 Forward -337 -318 -16.4218 0.215
NP_440416.1_9 Forward -46 -27 -16.6185 0.218
NP_440416.1_9 Forward -343 -324 -18.3884 0.256
NP_443052.1_9 Forward -55 -36 1.57275 0.184
NP_443052.1_9 Forward -46 -27 -5.99873 0.276
NP_442226.1_8 Forward -79 -69 13.0581 0.274
NP_442564.1_4 Reverse -127 -146 20.1497 0.216
NP_442564.1_9 Reverse -327 -341 14.6052 0.227
NP_440261.1_5 Reverse -103 -116 -3.02898 0.108
NP_440261.1_5 Reverse -351 -364 -4.50394 0.151
NP_440261.1_5 Forward -110 -97 -4.89726 0.178
NP_440261.1_5 Forward -335 -322 -12.1738 0.272
NP_440988.1_10 Reverse -325 -339 4.02751 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCATCAATTTGCCAACCGCCCTCTTGATAGCCTTTCGGGAGGCCAACGCCAGAGAGCCTGGATTGCCATGGCCCTGGCCCAAGACACTGAAATTTTATTGTTAGACGAACCCACCACCTATCTCGATCTAGCCCATCAAATTGAAGTTTTAGATTTACTCCATTGGCTGAACCGGGAAGCAGGACGCACCATTGTGATGGTATTGCACGACCTCAATTTGGCCTGTCGCTATAGTCATCGCTTGATTGCCCTACGGGATGGAAAACTACTGGCCCAAGGACGACCCCAGGCGATCGTCACCGAAGAACTAGTACGACAAGTTTTTGGACTGGAGAGCCGCATCATCGCCGATCCCGTCACTGGCACCCCTCTCTGTGTACCCGTTAGCCGACACCTAAA

CDS

ATGAAAAGTAAACTAATAATTTTTACTTTCTGCCTGGTGCTATTTGGTTGTGCTAAACAAGTACCCGTTGAATTTTCCCCTGGGGAAACCATTCAATCAAACCTAACCCAGCGCACCATAGCCCACGCCATGGGCGTAACGGCAGTCCCCAATGAGCCACAGCGCATAGTGGTGTTGACCAATGAAGCAACAGATATGGTATTGGCCTTGGGAGTCACCCCGGTGGGGGCAGTTAAATCTTGGTCCGGAGATCCTTACTACGAATATTTAGCAAAGGATATGCTTGGAGTCCCCATCGTGGGAGATGAAATGCAGCCTAACCTAGAGAAAATTGTCGCCTTACAGCCGGACTTGATTATCGGTAGTCGGTTGCGCCAGGGACAAATTTACAAGTCACTGAGTGCCATTGCCCCCACAGTTTTTTCAGAAACCATTGGTGAATCATGGCAAGATAACCTACGTCTTTATGGGCAGGCCCTTGACAGAGAAGCCGAAGCGGAGCAACTTTTGAACGATTGGGACACGCGTGTGGCCCAAATGCGTCAAAAACTAAGTGCAAAAGATTTAACAATTTCCCTCGTCCGATTTATGCCAAGGGGAGCCCGCATTTATTTACAAAATTCTTTCCCCGGTCAAATTTTGCAGGCAGTGGGTTTGGAAAGACCGGCGAGTCAAGCTAACCATGGCTTTGCTGAACATGTTTCCTTCGAGCAAATTCCCCAAATGGAAGCTGATGCACTGTTTTACTTCATCTATACCGGAGATAGCGGGGACCAAACCCCCGGCAGCATAACGAATCCTTGGTTAAACCATCCCCTATGGCAGCAGTTGGAGGTTGTTCAATCGGGTAAGGCCTACGCTGTTAGCGATGTGGTTTGGACCACTGCCGGAGGTATCCAAGCCGCCCACCTGCTACTAGATGATTTGGAACGACATTTAGAGCCTTAG

Protein

MKSKLIIFTFCLVLFGCAKQVPVEFSPGETIQSNLTQRTIAHAMGVTAVPNEPQRIVVLTNEATDMVLALGVTPVGAVKSWSGDPYYEYLAKDMLGVPIVGDEMQPNLEKIVALQPDLIIGSRLRQGQIYKSLSAIAPTVFSETIGESWQDNLRLYGQALDREAEAEQLLNDWDTRVAQMRQKLSAKDLTISLVRFMPRGARIYLQNSFPGQILQAVGLERPASQANHGFAEHVSFEQIPQMEADALFYFIYTGDSGDQTPGSITNPWLNHPLWQQLEVVQSGKAYAVSDVVWTTAGGIQAAHLLLDDLERHLEP