Your browser is old and dusty. Try Google Chrome!

Details for slr1317

ORF slr1317
Accession NP_439911.1
Symbol
Category ABC-type iron(III) dicitrate transport system permease protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -334 -348 2.75286 0.172
NP_441061.1_2 Forward -342 -328 1.96621 0.179
NP_441061.1_2 Reverse -230 -244 1.17956 0.193
NP_441061.1_2 Forward -324 -310 0.589577 0.205
NP_441061.1_2 Forward -249 -235 -1.67204 0.269
NP_441061.1_2 Forward -348 -334 -1.96703 0.278
NP_441418.1_6 Forward -343 -324 -30.5815 0.286
NP_442151.1_6 Forward -343 -329 10.816 0.114
NP_441818.1_9 Forward -291 -272 12.6841 0.106
NP_441818.1_9 Forward -367 -348 -0.885524 0.196
NP_441818.1_9 Forward -285 -266 -9.93197 0.291
NP_441818.1_9 Forward -345 -326 -10.9153 0.299
NP_441098.1_3 Reverse -88 -107 -6.40615 0.28
NP_440150.1_2 Reverse -231 -250 9.43841 0.217
NP_442287.1_5 Forward -239 -229 15.2213 0.218
NP_442173.1_1 Forward -324 -316 6.01761 0.2
NP_442752.1_4 Forward -238 -231 10.5605 0.1
NP_443027.1_4 Reverse -197 -207 6.46988 0.275
NP_442909.1_7 Reverse -317 -331 6.68548 0.242
NP_442289.1_5 Forward -160 -141 17.243 0.248
NP_440061.1_9 Reverse -314 -328 6.68548 0.235
NP_440110.1_8 Forward -345 -326 1.0811 0.211
NP_441054.1_2 Forward -378 -359 15.9291 0.136
NP_441054.1_2 Forward -394 -375 11.1109 0.271
NP_439979.1_2 Forward -343 -324 8.16093 0.258
NP_442062.1_8 Forward -61 -51 3.91327 0.243
NP_440304.1_4 Reverse -332 -342 14.3364 0.051
NP_441781.1_7 Forward -349 -330 4.81767 0.186
NP_441035.1_4 Reverse -197 -216 17.699 0.295
NP_440011.1_1 Reverse -320 -339 11.1109 0.286
NP_440011.1_1 Forward -287 -268 10.8159 0.297
NP_439918.1_2 Forward -291 -272 -1.96717 0.24
NP_441208.1_9 Forward -328 -314 8.16106 0.219
NP_441594.1_6 Forward -334 -315 7.27595 0.175
NP_440132.1_1 Reverse -332 -350 10.4422 0.22
NP_442110.1_2 Forward -322 -309 16.2587 0.166
NP_440330.1_2 Forward -152 -133 13.4708 0.266
NP_440856.1_7 Forward -160 -141 -9.24366 0.284
NP_441083.1_3 Forward -333 -323 12.7626 0.248
NP_441083.1_5 Reverse -316 -326 5.78156 0.104
NP_441083.1_5 Reverse -229 -239 5.38824 0.12
NP_442827.1_8 Forward -333 -314 0.195343 0.214
NP_440645.1_1 Reverse -358 -377 6.19431 0.206
NP_441558.1_5 Forward -210 -191 5.60432 0.245
NP_442889.1_8 Reverse -226 -240 4.52221 0.263
NP_441770.1_4 Reverse -162 -181 -12.1936 0.291
NP_442570.1_3 Reverse -50 -69 4.71934 0.16
NP_441387.1_7 Reverse -359 -378 11.2092 0.155
NP_440343.1_9 Forward -368 -349 7.57094 0.278
NP_442442.1_5 Reverse -211 -230 9.63589 0.224
NP_441847.1_9 Reverse -213 -231 17.6204 0.185
NP_441130.1_10 Reverse -197 -211 5.89945 0.211
NP_442634.1_4 Reverse -332 -346 -5.21195 0.241
NP_440403.1_10 Forward -327 -308 4.42435 0.256
NP_441012.1_4 Reverse -144 -157 10.344 0.262
NP_443018.1_3 Reverse -335 -342 4.26735 0.267
NP_443018.1_3 Forward -342 -335 4.16902 0.278
NP_441634.1_1 Forward -213 -194 -3.63879 0.275
NP_441634.1_8 Reverse -197 -211 -4.03198 0.295
NP_441634.1_9 Reverse -323 -342 8.06178 0.294
NP_440376.1_1 Reverse -334 -343 4.22796 0.166
NP_440376.1_1 Forward -325 -316 2.458 0.221
NP_442687.1_7 Forward -85 -75 3.61828 0.299
NP_442485.1_3 Forward -354 -335 22.7139 0.0127
NP_442485.1_3 Reverse -323 -342 -1.18052 0.256
NP_442485.1_3 Forward -378 -359 -2.75381 0.266
NP_442485.1_3 Reverse -317 -336 -4.91709 0.286
NP_440642.1_10 Forward -125 -111 3.34225 0.275
NP_440533.1_6 Forward -392 -373 8.94757 0.276
NP_440533.1_9 Reverse -328 -347 12.4875 0.0901
NP_440667.1_2 Forward -379 -360 8.84924 0.189
NP_440360.1_10 Reverse -318 -332 5.1128 0.227
NP_442658.1_1 Reverse -338 -348 6.96107 0.214
NP_442782.1_2 Forward -373 -359 8.35772 0.198
NP_442782.1_2 Reverse -334 -348 3.93283 0.257
NP_441414.1_9 Forward -238 -219 -10.3253 0.28
NP_442937.1_5 Forward -150 -131 7.7676 0.241
NP_441958.1_5 Reverse -315 -325 -0.609952 0.215
NP_441958.1_5 Forward -326 -316 -1.3966 0.239
NP_441127.1_1 Reverse -199 -213 9.34103 0.278
NP_439905.1_1 Forward -207 -194 6.60746 0.283
NP_439905.1_1 Reverse -200 -213 6.21414 0.295
NP_439905.1_2 Forward -342 -328 14.9459 0.188
NP_441162.1_3 Forward -335 -316 9.0459 0.254
NP_442690.1_1 Forward -25 -6 -7.76869 0.178
NP_442064.1_4 Reverse -225 -244 9.7334 0.204
NP_443055.1_6 Reverse -316 -334 0.510066 0.242
NP_443055.1_6 Reverse -377 -395 0.0184138 0.251
NP_443055.1_6 Forward -345 -327 -1.06322 0.271
NP_440993.1_2 Reverse -311 -327 5.17175 0.237
NP_440827.1_8 Reverse -244 -262 13.4905 0.197
NP_440138.1_6 Reverse -317 -336 3.9319 0.24
NP_441099.1_3 Reverse -53 -72 -4.22878 0.299
NP_441099.1_5 Forward -335 -316 -11.1119 0.271
NP_441294.1_4 Forward -319 -300 8.06259 0.217
NP_441646.1_1 Reverse -333 -352 1.37609 0.231
NP_441646.1_1 Forward -332 -313 -0.885524 0.273
NP_441646.1_7 Forward -348 -334 21.1407 0.0399
NP_441646.1_7 Reverse -365 -379 14.9459 0.252
NP_442438.1_10 Forward -348 -334 1.27789 0.2
NP_442438.1_10 Forward -213 -199 0.687908 0.218
NP_442771.1_1 Reverse -332 -350 0.609134 0.0936
NP_442771.1_1 Forward -345 -327 -6.96235 0.169
NP_440147.1_4 Reverse -314 -327 -0.767364 0.299
NP_441175.1_2 Reverse -376 -395 11.8975 0.175
NP_441550.1_8 Forward -327 -317 7.74772 0.149
NP_441916.1_7 Reverse -334 -344 3.32329 0.22
NP_441916.1_7 Forward -263 -253 1.84832 0.272
NP_440206.1_4 Reverse -360 -379 6.78348 0.212
NP_440206.1_4 Forward -347 -328 -2.06626 0.293
NP_440465.1_10 Reverse -196 -215 0.392778 0.29
NP_441041.1_4 Reverse -229 -248 -8.06369 0.196
NP_441041.1_4 Forward -379 -360 -8.35868 0.2
NP_441041.1_4 Reverse -63 -82 -11.3086 0.244
NP_441725.1_5 Forward -342 -332 9.02648 0.0553
NP_441725.1_5 Reverse -335 -345 0.963343 0.141
NP_439966.1_7 Reverse -227 -237 4.50281 0.269
NP_440289.1_2 Reverse -306 -319 -4.01229 0.276
NP_440983.1_5 Reverse -271 -290 -9.24366 0.3
NP_440260.1_7 Forward -235 -216 1.76941 0.241
NP_440260.1_8 Forward -352 -334 1.19912 0.19
NP_440260.1_8 Forward -154 -136 -7.749 0.3
NP_442281.1_1 Reverse -329 -343 4.8172 0.18
NP_442281.1_1 Reverse -311 -325 3.24392 0.238
NP_441334.1_7 Forward -345 -326 -20.5517 0.277
NP_441566.1_3 Reverse -187 -206 14.6508 0.198
NP_442575.1_8 Forward -385 -366 7.57094 0.125
NP_442012.1_5 Forward -380 -361 9.93088 0.252
NP_441556.1_4 Reverse -139 -158 11.5476 0.247
NP_443030.1_4 Reverse -333 -352 -2.95047 0.251
NP_441644.1_6 Reverse -229 -239 9.41933 0.0767
NP_441644.1_6 Forward -325 -315 5.19112 0.204
NP_441644.1_6 Forward -244 -234 3.22451 0.293
NP_442029.1_6 Forward -285 -266 13.8641 0.131
NP_442029.1_6 Forward -367 -348 6.09597 0.244
NP_441751.2_8 Reverse -335 -349 -4.03198 0.158
NP_442554.1_8 Forward -207 -197 11.1898 0.0385
NP_442554.1_8 Forward -342 -332 4.3066 0.189
NP_442970.1_3 Forward -33 -15 12.5838 0.231
NP_442313.1_4 Reverse -58 -77 7.96426 0.286
NP_442313.1_5 Reverse -53 -72 6.78429 0.236
NP_442142.1_4 Reverse -232 -245 14.2767 0.0311
NP_442142.1_4 Reverse -325 -338 11.9167 0.0504
NP_442142.1_4 Forward -340 -327 4.44361 0.222
NP_441264.1_10 Forward -214 -200 16.4209 0.264
NP_443009.1_5 Forward -62 -51 11.1696 0.066
NP_442301.1_2 Reverse -348 -367 11.7983 0.159
NP_440279.1_2 Forward -309 -290 4.916 0.281
NP_440379.1_5 Forward -346 -327 -6.58872 0.238
NP_440379.1_5 Forward -217 -198 -8.85033 0.256
NP_441468.1_1 Reverse -335 -342 4.26735 0.246
NP_441015.1_10 Forward -213 -194 5.30933 0.115
NP_441015.1_10 Forward -342 -323 0.491109 0.165
NP_441015.1_10 Forward -243 -224 -2.16383 0.178
NP_441015.1_10 Forward -336 -317 -4.03212 0.197
NP_442253.1_5 Forward -352 -335 10.7569 0.0918
NP_440265.1_7 Forward -373 -359 15.0436 0.258
NP_441876.1_9 Reverse -225 -235 15.8108 0.267
NP_441826.1_2 Forward -67 -53 1.47456 0.151
NP_441826.1_4 Reverse -317 -336 22.6156 0.0251
NP_442490.1_9 Reverse -322 -341 -6.39206 0.273
NP_441764.1_4 Reverse -7 -24 12.7509 0.181
NP_441764.1_8 Reverse -216 -226 15.7131 0.284
NP_442868.1_6 Reverse -332 -342 0.0783647 0.248
NP_441056.1_1 Reverse -229 -248 -8.26035 0.282
NP_442227.1_2 Forward -341 -322 2.26107 0.235
NP_442227.1_2 Reverse -318 -337 2.0644 0.239
NP_442227.1_2 Reverse -225 -244 0.884433 0.252
NP_442227.1_2 Reverse -222 -241 -3.04881 0.289
NP_443058.1_7 Forward -251 -232 9.24257 0.206
NP_442808.1_1 Reverse -228 -238 7.35439 0.0814
NP_442808.1_1 Reverse -308 -318 3.91283 0.218
NP_442808.1_1 Reverse -141 -151 2.43787 0.266
NP_441101.1_10 Reverse -330 -349 -1.7705 0.211
NP_440031.1_10 Forward -249 -230 18.289 0.0942
NP_442542.1_2 Forward -327 -314 8.08242 0.163
NP_442113.1_10 Reverse -222 -241 -8.26035 0.278
NP_442050.1_1 Reverse -327 -346 13.8641 0.187
NP_442903.1_2 Reverse -6 -25 7.59119 0.165
NP_440601.1_5 Reverse -168 -187 20.1573 0.192
NP_440601.1_9 Reverse -162 -181 14.1591 0.186
NP_440558.1_2 Reverse -195 -214 7.17762 0.123
NP_440558.1_2 Forward -352 -333 6.88262 0.127
NP_440558.1_2 Reverse -361 -380 -5.31042 0.256
NP_440558.1_2 Reverse -336 -355 -7.27704 0.291
NP_441878.1_6 Reverse -333 -343 1.94665 0.0567
NP_441878.1_6 Forward -344 -334 0.57002 0.14
NP_441878.1_6 Forward -326 -316 -7.59145 0.245
NP_441445.1_1 Forward -352 -333 0.491109 0.275
NP_441590.1_4 Reverse -360 -379 6.88182 0.254
NP_441433.1_8 Forward -243 -224 -3.3438 0.28
NP_441433.1_8 Reverse -236 -255 -4.72043 0.294
NP_442419.1_2 Forward -342 -323 2.94938 0.217
NP_440101.1_10 Forward -379 -360 7.47261 0.193
NP_442183.1_1 Forward -325 -311 4.03116 0.282
NP_441116.1_5 Reverse -362 -381 13.8633 0.27
NP_441574.1_1 Reverse -196 -215 -7.67036 0.293
NP_440829.1_5 Forward -115 -101 19.627 0.0922
NP_442888.1_9 Reverse -316 -335 16.8141 0.171
NP_441037.1_4 Reverse -332 -342 6.34312 0.267
NP_442594.1_8 Forward -246 -227 5.89931 0.236
NP_442590.1_9 Forward -344 -325 9.3409 0.23
NP_442590.1_10 Forward -355 -336 13.9625 0.126
NP_442998.1_2 Reverse -266 -285 5.40686 0.257
NP_442998.1_5 Forward -390 -380 9.91146 0.232
NP_442998.1_5 Reverse -246 -256 7.94484 0.278
NP_440899.1_1 Forward -379 -360 11.2376 0.164
NP_440899.1_8 Forward -134 -115 -1.47551 0.21
NP_440899.1_8 Forward -267 -248 -8.35868 0.254
NP_440899.1_8 Forward -315 -296 -9.24366 0.262
NP_440299.1_1 Forward -347 -334 3.16532 0.256
NP_442333.2_5 Reverse -354 -373 -8.85033 0.246
NP_442333.2_5 Reverse -305 -324 -9.34199 0.246
NP_442333.2_5 Reverse -323 -342 -12.1936 0.249
NP_442961.1_4 Forward -366 -347 4.03102 0.288
NP_440456.1_7 Reverse -292 -306 10.521 0.292
NP_441559.1_8 Reverse -47 -61 0.982901 0.159
NP_441559.1_8 Reverse -335 -349 -4.03198 0.215
NP_441559.1_8 Forward -353 -339 -5.90027 0.271
NP_442756.1_2 Forward -333 -314 5.50599 0.27
NP_440915.1_6 Forward -329 -315 -2.45868 0.272
NP_441179.1_9 Reverse -233 -243 8.92768 0.284
NP_442785.1_7 Reverse -314 -328 11.5043 0.228
NP_441866.1_4 Forward -133 -120 13.2449 0.273
NP_442967.1_10 Reverse -309 -323 16.7791 0.222
NP_442452.1_8 Forward -67 -53 12.487 0.273
NP_442866.1_1 Forward -330 -311 -5.9004 0.245
NP_442866.1_1 Forward -379 -360 -8.35868 0.279
NP_440748.1_5 Reverse -319 -338 0.196116 0.252
NP_440748.1_5 Forward -346 -327 -3.14714 0.291
NP_441464.1_8 Reverse -199 -213 4.12949 0.283
NP_441464.1_10 Forward -287 -273 7.57108 0.295
NP_440695.1_6 Reverse -219 -233 12.0596 0.265
NP_442993.1_1 Forward -263 -247 -3.57971 0.133
NP_442386.1_9 Reverse -51 -60 7.07914 0.219
NP_442386.1_9 Reverse -327 -336 5.0142 0.27
NP_440570.1_5 Forward -248 -229 4.81767 0.207
NP_440570.1_5 Forward -341 -322 0.786102 0.254
NP_440570.1_5 Forward -347 -328 -3.14714 0.288
NP_441750.1_1 Forward -244 -225 -12.8819 0.3
NP_441340.1_5 Forward -342 -335 4.07068 0.239
NP_441340.1_9 Reverse -216 -226 14.6181 0.194
NP_441947.1_10 Reverse -332 -350 0.0191479 0.276
NP_442484.1_2 Forward -342 -323 -0.0988766 0.254
NP_440327.1_6 Forward -291 -272 7.47261 0.228
NP_440327.1_6 Forward -285 -266 3.04771 0.285
NP_441160.1_5 Forward -228 -209 1.47442 0.288
NP_441160.1_9 Reverse -341 -360 11.0125 0.193
NP_440586.1_1 Forward -377 -358 -1.86883 0.244
NP_440586.1_8 Forward -243 -236 5.8403 0.283
NP_442959.1_5 Reverse -249 -268 8.94757 0.224
NP_440027.1_3 Reverse -310 -328 6.40989 0.225
NP_440027.1_3 Forward -67 -49 3.16499 0.278
NP_440027.1_3 Forward -77 -59 2.47668 0.289
NP_443051.1_1 Reverse -333 -342 -1.18024 0.297
NP_439937.1_8 Reverse -197 -216 2.85105 0.209
NP_439937.1_8 Reverse -137 -156 -2.55715 0.26
NP_439937.1_9 Reverse -315 -332 -17.0714 0.291
NP_440408.1_7 Reverse -322 -341 11.7992 0.213
NP_440439.1_1 Forward -352 -339 -0.275709 0.211
NP_442239.1_8 Forward -349 -330 7.57094 0.255
NP_442239.1_8 Reverse -328 -347 6.58763 0.263
NP_442783.1_2 Reverse -60 -79 14.8474 0.129
NP_440316.1_10 Forward -349 -339 6.17489 0.265
NP_439977.1_5 Reverse -322 -341 1.0811 0.196
NP_441572.1_7 Reverse -328 -347 -3.14714 0.207
NP_441980.1_8 Reverse -130 -149 9.43923 0.24
NP_441018.1_7 Forward -353 -334 11.4058 0.185
NP_441689.1_5 Reverse -314 -324 10.206 0.132
NP_440531.1_6 Reverse -162 -181 5.211 0.116
NP_440189.1_2 Reverse -308 -327 2.0644 0.268
NP_441640.1_8 Reverse -230 -249 8.55425 0.103
NP_441640.1_8 Forward -249 -230 -2.55715 0.233
NP_440297.1_9 Forward -342 -332 9.91146 0.0917
NP_440297.1_9 Reverse -335 -345 9.61647 0.0917
NP_440350.1_5 Forward -134 -115 -5.31042 0.289
NP_439926.1_1 Reverse -346 -365 11.9958 0.207
NP_442067.1_4 Reverse -323 -342 2.0644 0.299
NP_440999.1_9 Reverse -339 -353 4.22782 0.116
NP_440888.1_2 Forward -349 -335 8.65209 0.152
NP_442277.1_7 Reverse -117 -133 7.93263 0.196
NP_442845.1_2 Forward -343 -329 9.2427 0.178
NP_442845.1_2 Reverse -52 -66 5.99778 0.219
NP_441551.1_5 Forward -347 -331 5.95771 0.291
NP_441469.1_8 Forward -209 -200 12.1928 0.123
NP_441469.1_8 Forward -344 -335 10.7178 0.202
NP_441469.1_8 Forward -349 -340 7.66954 0.227
NP_442315.1_2 Forward -284 -272 9.38042 0.291
NP_442637.1_10 Forward -180 -161 16.2241 0.0758
NP_442337.1_8 Reverse -46 -65 0.687771 0.245
NP_442337.1_8 Forward -218 -199 -2.36049 0.3
NP_441462.1_2 Reverse -334 -344 0.0783647 0.168
NP_441462.1_2 Reverse -316 -326 -1.19994 0.291
NP_441462.1_2 Forward -325 -315 -1.19994 0.291
NP_441462.1_5 Forward -280 -261 4.52268 0.285
NP_441621.1_7 Forward -210 -196 -4.13031 0.208
NP_441929.1_3 Reverse -219 -238 1.57275 0.285
NP_440519.1_8 Forward -373 -357 11.4649 0.184
NP_442204.1_1 Forward -242 -231 8.81013 0.0852
NP_442204.1_1 Reverse -330 -341 1.4353 0.271
NP_442204.1_1 Forward -248 -237 -0.432984 0.299
NP_442204.1_5 Reverse -324 -343 0.392778 0.264
NP_440516.1_8 Reverse -316 -325 5.11294 0.118
NP_440516.1_8 Forward -325 -316 5.01461 0.118
NP_440516.1_8 Forward -238 -229 -0.590259 0.283
NP_442428.1_5 Reverse -335 -342 4.66067 0.244
NP_441032.1_1 Reverse -347 -366 14.8474 0.221
NP_441353.1_5 Forward -333 -314 21.6323 0.0865
NP_441443.1_7 Forward -247 -228 3.6377 0.218
NP_442120.1_10 Forward -379 -360 -5.99873 0.203
NP_442120.1_10 Forward -331 -312 -15.8318 0.296
NP_440673.1_2 Forward -218 -199 15.8525 0.0865
NP_440673.1_3 Forward -341 -334 8.8889 0.206
NP_440673.1_3 Reverse -366 -373 6.23397 0.283
NP_440865.1_9 Forward -349 -330 -7.17871 0.244
NP_441052.1_2 Reverse -229 -239 4.60159 0.154
NP_442907.1_9 Forward -83 -64 -0.688862 0.225
NP_442907.1_9 Reverse -334 -353 -7.17871 0.294
NP_441004.1_1 Forward -367 -348 -8.55534 0.2
NP_441004.1_1 Forward -394 -375 -10.3253 0.219
NP_441004.1_1 Forward -379 -360 -14.5535 0.268
NP_441004.1_3 Forward -145 -126 3.44104 0.261
NP_442366.1_10 Forward -353 -341 17.9352 0.229
NP_440129.1_10 Reverse -234 -248 5.70279 0.185
NP_442694.1_3 Forward -347 -329 6.11567 0.197
NP_443054.1_2 Reverse -338 -352 1.67122 0.245
NP_443054.1_2 Reverse -314 -328 -0.0987402 0.284
NP_441851.1_10 Reverse -333 -343 6.46988 0.167
NP_441668.1_4 Reverse -65 -84 0.786102 0.231
NP_441668.1_4 Reverse -99 -118 -2.26216 0.288
NP_441396.1_5 Forward -147 -138 18.0926 0.141
NP_441396.1_5 Forward -237 -228 8.75118 0.21
NP_440593.1_3 Reverse -317 -336 -7.67036 0.298
NP_440940.1_7 Reverse -324 -342 11.3264 0.112
NP_442843.1_1 Forward -394 -375 5.40766 0.144
NP_442843.1_1 Forward -393 -374 -8.94866 0.264
NP_439960.1_10 Forward -338 -320 -4.01242 0.287
NP_439960.1_10 Forward -245 -227 -4.70074 0.296
NP_441124.1_5 Forward -390 -380 10.4299 0.289
NP_442168.1_5 Forward -342 -323 -1.37718 0.264
NP_441003.1_9 Forward -253 -234 5.80098 0.257
NP_440483.1_1 Forward -243 -224 -0.885524 0.208
NP_441570.1_1 Forward -343 -325 -9.71562 0.146
NP_440078.1_10 Forward -379 -360 3.24438 0.269
NP_441078.1_4 Reverse -334 -343 -1.86856 0.272
NP_442729.1_5 Forward -245 -235 8.4365 0.248
NP_442729.1_7 Forward -164 -146 6.50899 0.286
NP_442348.1_2 Forward -229 -220 14.7494 0.146
NP_442348.1_2 Forward -230 -221 7.57121 0.28
NP_441432.1_8 Reverse -315 -324 5.21127 0.185
NP_441333.1_1 Forward -290 -280 11.7806 0.241
NP_441732.1_2 Reverse -312 -328 -16.5594 0.174
NP_441732.1_5 Reverse -243 -257 13.0776 0.192
NP_442797.1_7 Forward -350 -332 13.3922 0.123
NP_442797.1_7 Reverse -327 -345 10.1472 0.169
NP_442797.1_7 Reverse -326 -344 3.06741 0.236
NP_441945.1_10 Forward -251 -232 11.7008 0.235
NP_442353.1_3 Reverse -326 -345 8.4551 0.264
NP_442510.1_5 Forward -346 -327 17.8957 0.171
NP_442727.1_1 Forward -152 -138 17.1092 0.181
NP_443011.1_4 Forward -368 -349 15.4374 0.109
NP_442751.1_2 Reverse -308 -327 2.26028 0.295
NP_441072.1_2 Forward -353 -334 6.58763 0.275
NP_442400.1_2 Reverse -116 -135 8.25926 0.249
NP_440713.1_4 Forward -335 -316 4.12936 0.231
NP_440713.1_4 Reverse -48 -67 2.16274 0.27
NP_442489.1_7 Reverse -334 -343 -1.37691 0.195
NP_442489.1_7 Forward -325 -316 -1.77023 0.247
NP_440565.1_7 Forward -335 -316 1.86774 0.246
NP_440565.1_7 Forward -356 -337 -1.47551 0.282
NP_441659.2_8 Reverse -334 -344 3.32329 0.164
NP_439912.1_2 Forward -321 -302 27.5321 0.00171
NP_439912.1_3 Forward -137 -119 23.3227 0.0125
NP_439912.1_6 Forward -158 -140 13.2938 0.24
NP_441968.1_1 Reverse -117 -125 14.3753 0.286
NP_439956.1_7 Forward -354 -335 2.85105 0.269
NP_439956.1_7 Reverse -47 -66 0.786102 0.296
NP_440708.1_6 Forward -341 -322 6.68596 0.124
NP_440442.1_3 Forward -245 -231 14.9459 0.287
NP_441800.1_3 Forward -342 -324 16.5388 0.173
NP_441800.1_7 Forward -184 -166 -3.02911 0.268
NP_442776.1_1 Reverse -137 -156 8.45592 0.197
NP_440029.1_10 Reverse -356 -368 17.9346 0.264
NP_442346.1_1 Forward -348 -329 16.9124 0.181
NP_442346.1_5 Reverse -333 -343 12.0747 0.0508
NP_440545.1_3 Reverse -330 -347 8.88863 0.0418
NP_440545.1_3 Reverse -195 -212 3.0871 0.089
NP_440545.1_3 Forward -347 -330 2.20212 0.106
NP_440545.1_5 Forward -289 -272 5.44704 0.234
NP_440831.1_3 Reverse -325 -344 8.61992 0.222
NP_440831.1_3 Forward -247 -228 6.19299 0.275
NP_440010.1_4 Reverse -225 -244 -2.8529 0.291
NP_442027.1_1 Forward -238 -220 16.5171 0.134
NP_442551.1_4 Forward -351 -336 6.37141 0.196
NP_441585.1_5 Reverse -357 -376 3.44025 0.255
NP_440449.1_6 Forward -333 -315 10.4929 0.154
NP_442162.1_9 Forward -324 -317 5.93897 0.214
NP_442055.1_6 Forward -351 -332 17.0107 0.221
NP_440671.1_4 Reverse -328 -342 7.47274 0.217
NP_440671.1_4 Forward -244 -230 7.37441 0.219
NP_440671.1_4 Reverse -310 -324 6.09611 0.261
NP_440671.1_4 Forward -349 -335 5.21113 0.289
NP_441044.1_4 Reverse -128 -146 8.96727 0.223
NP_442140.1_3 Reverse -200 -210 3.81494 0.278
NP_441671.1_6 Forward -348 -329 11.5042 0.179
NP_442089.1_4 Reverse -61 -80 18.289 0.248
NP_442089.1_6 Reverse -53 -72 6.78429 0.195
NP_440590.1_4 Forward -379 -366 -1.06236 0.21
NP_442497.1_10 Forward -342 -333 0.589713 0.153
NP_440821.1_4 Reverse -332 -342 0.57002 0.169
NP_440821.1_4 Forward -345 -335 -0.0199663 0.217
NP_441239.1_9 Forward -210 -198 14.592 0.0271
NP_441239.1_9 Reverse -50 -62 8.00379 0.145
NP_441239.1_9 Forward -345 -333 6.92215 0.173
NP_441239.1_9 Reverse -197 -209 4.75886 0.243
NP_441239.1_9 Reverse -227 -239 3.48056 0.285
NP_440400.1_1 Reverse -330 -349 -1.27961 0.285
NP_441892.1_1 Reverse -325 -342 9.87194 0.0703
NP_441892.1_1 Forward -334 -317 -5.27103 0.276
NP_440665.1_1 Reverse -229 -248 -11.6036 0.244
NP_441017.1_8 Forward -232 -217 14.8279 0.174
NP_442216.1_4 Reverse -222 -230 8.1805 0.255
NP_442138.1_1 Forward -351 -332 5.89851 0.24
NP_440546.1_7 Forward -298 -288 14.9263 0.279
NP_439974.1_4 Reverse -353 -372 8.25926 0.282
NP_441230.1_5 Forward -354 -335 1.76941 0.234
NP_441230.1_5 Forward -330 -311 1.0811 0.253
NP_440675.1_3 Forward -160 -141 4.52268 0.3
NP_442340.1_3 Forward -215 -196 -9.34199 0.275
NP_441868.1_4 Reverse -51 -65 11.5043 0.295
NP_440638.2_3 Reverse -319 -338 9.83255 0.228
NP_442402.1_4 Forward -37 -18 -9.9327 0.295
NP_442402.1_10 Reverse -223 -233 10.206 0.299
NP_441848.1_9 Reverse -228 -239 18.741 0.109
NP_440696.1_3 Reverse -48 -66 2.18243 0.217
NP_440696.1_3 Forward -328 -310 0.805796 0.225
NP_440696.1_3 Reverse -58 -76 -2.14413 0.274
NP_442039.1_10 Reverse -372 -390 10.1465 0.293
NP_440351.1_8 Reverse -48 -66 5.32902 0.276
NP_441102.1_2 Forward -238 -219 10.8159 0.226
NP_441203.1_1 Forward -342 -323 -19.8634 0.297
NP_442532.1_7 Reverse -199 -213 3.93283 0.182
NP_440914.1_1 Reverse -310 -320 6.95605 0.257
NP_441011.1_8 Forward -237 -228 5.50626 0.256
NP_442533.1_6 Forward -343 -334 5.01461 0.16
NP_442533.1_6 Reverse -229 -238 2.16301 0.27
NP_442541.1_10 Forward -208 -194 1.96562 0.27
NP_441482.1_7 Reverse -328 -342 0.196253 0.0595
NP_441482.1_7 Forward -67 -53 -11.8001 0.284
NP_441028.1_6 Reverse -224 -234 8.3377 0.216
NP_442664.1_9 Forward -54 -35 22.4189 0.0539
NP_441527.1_4 Reverse -118 -137 -10.3613 0.27
NP_441527.1_4 Reverse -115 -134 -11.5072 0.282
NP_441527.1_7 Forward -23 -4 7.37347 0.29
NP_440007.1_9 Forward -242 -228 6.98109 0.213
NP_440007.1_9 Reverse -330 -344 5.30946 0.26
NP_442728.1_7 Reverse -309 -323 10.6193 0.297
NP_441680.1_4 Reverse -318 -337 -1.47551 0.262
NP_441961.1_4 Forward -345 -326 3.24438 0.281
NP_441961.1_4 Forward -351 -332 3.04771 0.281
NP_440608.1_1 Forward -79 -60 7.56838 0.223
NP_441602.1_3 Forward -213 -194 4.42435 0.153
NP_441602.1_3 Forward -330 -311 -5.31042 0.282
NP_441602.1_3 Forward -354 -335 -5.50708 0.288
NP_441972.1_5 Forward -342 -323 -3.54046 0.2
NP_441972.1_5 Reverse -317 -336 -6.39206 0.229
NP_441972.1_5 Reverse -137 -156 -9.53865 0.288
NP_441106.1_1 Reverse -333 -342 3.83464 0.235
NP_440429.1_2 Forward -336 -317 11.4058 0.247
NP_440429.1_2 Reverse -335 -354 6.88262 0.299
NP_440302.1_4 Reverse -334 -353 14.1591 0.283
NP_441286.1_1 Forward -344 -332 -6.05754 0.245
NP_442674.1_3 Reverse -326 -345 5.40686 0.269
NP_440670.1_8 Forward -325 -316 12.2911 0.0274
NP_440670.1_8 Reverse -316 -325 5.80125 0.134
NP_441930.1_1 Reverse -330 -349 5.50599 0.28
NP_441930.1_2 Forward -349 -339 11.9764 0.271
NP_441930.1_2 Reverse -339 -349 11.7798 0.275
NP_440886.1_7 Reverse -228 -238 15.6142 0.0243
NP_442614.1_2 Reverse -334 -348 14.7492 0.0915
NP_440767.1_2 Forward -246 -227 -4.91709 0.297
NP_440028.1_6 Forward -219 -201 12.8022 0.24
NP_442022.1_4 Forward -361 -342 8.35759 0.268
NP_441021.1_1 Forward -348 -329 -8.94866 0.204
NP_441988.1_5 Reverse -273 -292 11.9958 0.274
NP_441589.1_5 Forward -152 -133 15.5938 0.267
NP_442794.1_1 Reverse -231 -243 7.51213 0.137
NP_442794.1_1 Forward -242 -230 5.15219 0.231
NP_441962.1_4 Forward -330 -311 -13.8652 0.279
NP_441962.1_4 Reverse -134 -153 -14.1602 0.284
NP_441431.1_2 Reverse -196 -210 7.47213 0.241
NP_441836.1_2 Reverse -322 -341 -5.9004 0.288
NP_441993.1_1 Forward -343 -324 15.6882 0.0681
NP_441993.1_1 Forward -211 -192 6.62464 0.178
NP_441993.1_1 Reverse -52 -71 5.74752 0.195
NP_441993.1_1 Forward -348 -329 5.16278 0.207
NP_441993.1_1 Reverse -316 -335 2.8238 0.25
NP_441993.1_1 Forward -151 -132 2.04414 0.265
NP_442084.1_5 Reverse -330 -349 14.7491 0.0985
NP_441174.1_2 Reverse -337 -351 12.0943 0.267
NP_440467.1_3 Reverse -317 -336 16.2369 0.101
NP_442437.1_8 Forward -336 -317 16.2241 0.0933
NP_441510.2_7 Reverse -154 -168 12.782 0.28
NP_440293.1_3 Reverse -56 -75 -0.590531 0.232
NP_440293.1_3 Forward -153 -134 -6.39206 0.288
NP_440766.1_4 Forward -242 -228 2.5562 0.179
NP_440766.1_5 Reverse -293 -305 8.32423 0.279
NP_439910.1_2 Reverse -301 -318 -13.2358 0.153
NP_439910.1_2 Reverse -44 -61 -22.6756 0.285
NP_442867.1_8 Forward -216 -197 5.50599 0.276
NP_439911.1_1 Forward -180 -161 35.9886 0.00000956
NP_439911.1_2 Forward -267 -248 30.2854 0.000263
NP_439911.1_3 Forward -339 -320 27.7288 0.00229
NP_439911.1_4 Forward -141 -122 25.2705 0.00861
NP_439911.1_5 Forward -400 -383 25.8999 0.0083
NP_439911.1_7 Forward -375 -356 19.5673 0.0929
NP_439911.1_8 Forward -300 -281 25.3688 0.0122
NP_440457.1_1 Reverse -330 -342 6.03717 0.132
NP_440457.1_1 Forward -347 -335 5.74217 0.138
NP_440457.1_1 Forward -329 -317 -0.157684 0.254
NP_442680.1_5 Reverse -114 -133 3.97985 0.227
NP_440801.1_9 Reverse -383 -397 17.5862 0.227
NP_441332.1_6 Reverse -228 -238 15.3256 0.121
NP_442509.1_9 Reverse -316 -326 8.82935 0.192
NP_440185.1_9 Reverse -105 -122 13.5102 0.264
NP_442703.1_8 Forward -133 -115 14.768 0.253
NP_442341.1_5 Reverse -320 -339 11.3075 0.284
NP_442341.1_7 Reverse -315 -329 5.21113 0.165
NP_442341.1_7 Reverse -228 -242 5.1128 0.167
NP_442341.1_9 Reverse -227 -241 10.0287 0.141
NP_442341.1_9 Forward -345 -331 5.99717 0.247
NP_442341.1_9 Reverse -331 -345 4.62054 0.296
NP_441756.1_5 Forward -346 -327 -3.54046 0.29
NP_441756.1_5 Forward -335 -316 -4.72043 0.295
NP_441173.1_9 Reverse -382 -390 12.9004 0.206
NP_441173.1_9 Reverse -225 -233 10.1471 0.261
NP_441173.1_9 Reverse -383 -391 9.75379 0.284
NP_442395.2_4 Reverse -315 -334 4.32522 0.184
NP_440076.1_5 Reverse -327 -346 17.2065 0.0977
NP_440076.1_5 Forward -350 -331 13.3716 0.252
NP_440507.2_3 Forward -346 -327 13.8633 0.144
NP_440679.1_10 Forward -341 -322 -12.5869 0.203
NP_440679.1_10 Forward -215 -196 -20.0601 0.283
NP_442451.1_2 Forward -216 -197 -9.44032 0.259
NP_439962.1_4 Reverse -335 -354 -6.78538 0.285
NP_439962.1_4 Forward -345 -326 -8.45701 0.294
NP_439962.1_4 Forward -342 -323 -8.65367 0.298
NP_439962.1_4 Reverse -323 -342 -9.047 0.298
NP_442495.1_5 Forward -348 -329 7.47261 0.291
NP_440172.1_1 Forward -325 -315 1.84832 0.294
NP_442371.1_1 Forward -391 -381 14.0409 0.191
NP_442015.1_10 Reverse -48 -61 -0.177378 0.255
NP_441226.1_7 Forward -342 -335 11.5435 0.0757
NP_441111.1_7 Forward -342 -334 -0.570565 0.233
NP_441766.1_2 Forward -343 -334 3.14632 0.23
NP_442252.1_4 Forward -379 -360 14.1591 0.241
NP_440416.1_9 Forward -350 -331 -16.1268 0.208
NP_440416.1_9 Forward -245 -226 -17.5035 0.241
NP_440416.1_9 Forward -68 -49 -18.7818 0.264
NP_443052.1_9 Forward -180 -161 -4.52377 0.258
NP_442154.1_1 Forward -336 -318 -17.3854 0.254
NP_442154.1_1 Forward -326 -308 -18.4671 0.282
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAAAACGGCCTGGGTAAAATTGGGGGCGGCAACGGTTTTGGTGTTACTGGCGGGCAGTGCCGTCGCCCTGGCGGGGCCGATTGGCTTTGTCGGTTTAATTGTGCCCCACGTGGTTCGTTTTGGGGTCGGAGTGGATTATCGATGGATTTTACCCTACGCCATGGTGATGGGGGGAATTTTTCTTTCTGTGGCTGACATGGCCGCCCGATTATTGATCAGCCCGCAAGAACTACCAGTGGGCATTATGACTGCTTTGGTGGGGGCACCTTTTTTTATTTATCTTGCCCGCTCCCAAATTAAATAATCAAACCTAACGGGTCAACTCCAAAGACAACCCAAGGCCATTCCAGGCTAATTGATTGAATCCCGAATTTTATTAACTGTTTGTTCCATTTGTGCC

CDS

ATGTTTGCCCCTCGACCTTGGATTGTGGTCCGTCTCCGGTCTTTACCCCTATCGTTTCGCCTCGATCGCCATGTCCCCTTGGTAATGGGATTACTTACTGCTCTAGCATTATTACTATTTATTCTCAATATTAGTTGGGGGGAATATCCTGTCCCTCCCTTGGCGATGCTCCAGGCCATCTTTGGGCTATCTACCGATGCTGACCATGAATTTGTGGTGCGTACTCTGCGATTACCCCGGTCCTTGGTGGCATTGTTGGTGGGTATGGGTTTGGCGATCGCCGGAGGGATTTTGCAAGGCATTACCCGCAATCCTTTGGCAGCCCCTGAAATTATTGGTGTCAATGCGGGGGCTAGTTTGGTGGCGGTTACCTTCATCGTTTTGCTACCGGGTATTTCTCCTTCCTTGCTGCCAGTGGCCGCTTTTTGCGGTGGTTTAACAGCGGCGATCGCCATTTATGTGCTGGCTTGGAATCAGGGCAGTGCCCCCGTCCGGTTAATTTTGGTGGGCATTGGCCTAGCCGCATTAGCCAGTTCCCTCACCAGTTTGATGGTCACCTTTGGGGAAATTAGCGTGGTTAGTCAGGCCCTAGTTTGGCTCACTGGTAGCGTCCATGGCCGGGGTTGGGAACATTTATTGCCCCTGCTACCTTGGCTAGCCTTGTTTATTCCCCTCTCCTTGGCATTGGCCCGGGAGTTGGACACCCTAAACCTAGGGGACAATCTAGCCCGAGGATTGGGTAGCCGGGTGGAATGGATGCGGGGTCTTTTACTAGTTTGCAGTGTGGCCCTAGCGGGTTCCTGTGTGGCCACCGCCGGCAATATTGGCTTTGTCGGTTTGATGGCTCCCCACCTGGCCCGCCATCTGGTAGGCCCCTCCCATGGGGGCATGATTCCCGTTGCGGCCCTAACTGGAGCCTGCATTACAGAACTGGCAGATTTAATTGGTAGAACCGTTTTTGCCCCGATAGAAATTCCCTGCGGAGTAATTACGGCGATCGTGGGCGCTCCCTATTTTCTCTGGCTCCTATACCGAAATCGGAATCAATAG

Protein

MFAPRPWIVVRLRSLPLSFRLDRHVPLVMGLLTALALLLFILNISWGEYPVPPLAMLQAIFGLSTDADHEFVVRTLRLPRSLVALLVGMGLAIAGGILQGITRNPLAAPEIIGVNAGASLVAVTFIVLLPGISPSLLPVAAFCGGLTAAIAIYVLAWNQGSAPVRLILVGIGLAALASSLTSLMVTFGEISVVSQALVWLTGSVHGRGWEHLLPLLPWLALFIPLSLALARELDTLNLGDNLARGLGSRVEWMRGLLLVCSVALAGSCVATAGNIGFVGLMAPHLARHLVGPSHGGMIPVAALTGACITELADLIGRTVFAPIEIPCGVITAIVGAPYFLWLLYRNRNQ