Your browser is old and dusty. Try Google Chrome!

Details for slr1316

ORF slr1316
Accession NP_439910.1
Symbol
Category ABC-type iron(III) dicitrate transport system permease protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -125 -111 14.4542 0.0392
NP_440795.1_7 Forward -125 -118 14.6904 0.0123
NP_440795.1_7 Reverse -118 -125 14.6904 0.0123
NP_440795.1_7 Forward -297 -290 7.80726 0.232
NP_441418.1_6 Forward -126 -107 -29.0082 0.215
NP_441418.1_6 Reverse -117 -136 -30.0898 0.256
NP_441418.1_6 Forward -375 -356 -30.5815 0.286
NP_442291.1_5 Reverse -116 -132 -0.728113 0.189
NP_442291.1_5 Forward -127 -111 -2.10475 0.21
NP_440897.1_6 Forward -298 -279 5.30853 0.122
NP_441453.1_4 Forward -126 -118 16.6374 0.00633
NP_441453.1_4 Reverse -117 -125 16.539 0.00633
NP_441960.1_2 Reverse -240 -259 18.1907 0.261
NP_442151.1_6 Forward -126 -112 10.7177 0.118
NP_441818.1_1 Forward -125 -114 10.1862 0.232
NP_440226.1_1 Reverse -117 -136 24.0905 0.00293
NP_442623.1_3 Forward -125 -106 -10.4236 0.181
NP_440996.1_2 Reverse -64 -73 14.8477 0.248
NP_442173.1_1 Reverse -118 -126 17.3257 0.00633
NP_442173.1_1 Forward -125 -117 15.4574 0.00633
NP_442173.1_1 Forward -94 -86 6.3126 0.191
NP_442752.1_4 Reverse -117 -124 13.8055 0.0199
NP_443027.1_4 Forward -128 -118 16.303 0.0437
NP_443027.1_4 Reverse -115 -125 14.0414 0.0452
NP_441812.1_3 Reverse -116 -130 17.1092 0.0639
NP_442975.1_10 Forward -130 -116 21.4351 0.000865
NP_440784.1_7 Forward -125 -118 15.9687 0.0123
NP_440784.1_7 Reverse -118 -125 15.9687 0.0123
NP_442289.1_4 Forward -323 -307 13.0382 0.219
NP_440061.1_9 Reverse -304 -318 7.17714 0.216
NP_440061.1_9 Forward -97 -83 6.39049 0.248
NP_440061.1_9 Forward -128 -114 5.89884 0.266
NP_440110.1_4 Reverse -106 -125 5.30933 0.172
NP_441054.1_2 Forward -314 -295 10.5209 0.284
NP_442062.1_8 Reverse -117 -127 19.1546 0.00121
NP_442062.1_8 Forward -126 -116 14.9263 0.0108
NP_440761.1_4 Forward -131 -112 -13.4719 0.257
NP_441859.1_3 Forward -127 -108 5.89851 0.188
NP_441641.1_6 Forward -259 -240 13.6978 0.182
NP_440304.1_4 Reverse -115 -125 10.8948 0.051
NP_440304.1_4 Reverse -84 -94 3.02829 0.299
NP_440304.1_4 Forward -367 -357 2.92996 0.299
NP_442242.1_4 Forward -125 -118 14.3954 0.0124
NP_442242.1_4 Reverse -118 -125 14.3954 0.0124
NP_442602.1_3 Forward -374 -355 -1.27885 0.237
NP_439918.1_2 Forward -304 -285 -3.04881 0.251
NP_441935.1_1 Forward -375 -356 10.0292 0.213
NP_441619.1_8 Forward -304 -290 11.7987 0.168
NP_440893.1_5 Forward -373 -354 10.0284 0.248
NP_442110.1_7 Forward -126 -112 12.291 0.0586
NP_442110.1_7 Forward -388 -374 4.52282 0.2
NP_441083.1_5 Forward -126 -116 11.0914 0.0166
NP_441083.1_5 Reverse -117 -127 1.55333 0.204
NP_441738.1_2 Forward -124 -117 15.28 0.0102
NP_441738.1_2 Reverse -119 -126 11.5435 0.084
NP_441558.1_5 Reverse -115 -134 9.0459 0.132
NP_441645.1_1 Forward -374 -355 22.6147 0.0335
NP_440209.1_1 Reverse -117 -125 18.1123 0.00295
NP_440209.1_1 Forward -126 -118 8.57422 0.0425
NP_442889.1_8 Forward -129 -115 11.897 0.0729
NP_442889.1_8 Reverse -286 -300 9.43874 0.0989
NP_441713.1_1 Reverse -111 -130 -16.6185 0.285
NP_440178.1_7 Reverse -116 -135 -22.715 0.272
NP_442570.1_3 Forward -383 -364 -3.54046 0.222
NP_442570.1_3 Reverse -103 -122 -8.06369 0.279
NP_441716.1_1 Forward -126 -112 12.4876 0.0769
NP_441716.1_1 Reverse -111 -125 7.27608 0.173
NP_442111.1_4 Forward -127 -113 1.67122 0.296
NP_440906.1_5 Forward -125 -118 15.8704 0.0124
NP_440906.1_5 Reverse -118 -125 15.8704 0.0124
NP_440747.1_10 Reverse -114 -126 7.4138 0.00422
NP_440747.1_10 Forward -129 -117 -11.7607 0.142
NP_441847.1_9 Forward -290 -272 9.75391 0.257
NP_441486.1_1 Forward -129 -115 18.6825 0.00398
NP_441486.1_1 Reverse -114 -128 11.8976 0.0137
NP_442145.1_6 Reverse -157 -176 4.32602 0.253
NP_442634.1_2 Forward -335 -316 12.9791 0.133
NP_441014.1_10 Reverse -116 -135 10.7167 0.118
NP_442848.1_1 Reverse -111 -125 -0.885388 0.263
NP_442848.1_1 Forward -132 -118 -3.93365 0.275
NP_441012.1_4 Reverse -113 -126 9.75405 0.272
NP_443018.1_3 Forward -125 -118 14.8871 0.0123
NP_443018.1_3 Reverse -118 -125 14.8871 0.0123
NP_443018.1_3 Forward -119 -112 10.2655 0.107
NP_441634.1_8 Reverse -115 -129 3.8345 0.143
NP_440376.1_1 Forward -126 -117 9.73449 0.0365
NP_440376.1_1 Reverse -117 -126 9.63616 0.0385
NP_440376.1_1 Forward -38 -29 -1.18024 0.294
NP_441857.1_5 Forward -133 -115 2.87075 0.259
NP_441588.1_4 Reverse -119 -129 7.64985 0.178
NP_442687.1_7 Reverse -116 -126 7.94484 0.121
NP_442687.1_7 Forward -127 -117 6.27322 0.175
NP_442687.1_7 Reverse -85 -95 5.09324 0.221
NP_441013.1_2 Reverse -100 -118 -1.35749 0.282
NP_441422.1_7 Forward -128 -111 -1.82945 0.194
NP_441950.1_8 Reverse -343 -357 4.32615 0.292
NP_442658.1_1 Forward -128 -118 15.0242 0.0188
NP_442658.1_1 Reverse -115 -125 6.76441 0.214
NP_442782.1_2 Reverse -117 -131 1.17956 0.282
NP_442782.1_7 Reverse -109 -128 2.65439 0.193
NP_442937.1_5 Reverse -106 -125 13.7658 0.0872
NP_442937.1_5 Forward -380 -361 6.58763 0.275
NP_441958.1_5 Reverse -116 -126 10.9931 0.00875
NP_441958.1_5 Forward -127 -117 2.53664 0.0409
NP_441127.1_1 Forward -375 -361 10.521 0.244
NP_442836.1_5 Reverse -111 -130 5.80098 0.185
NP_440203.1_5 Forward -123 -113 15.7125 0.0611
NP_440203.1_5 Reverse -359 -369 9.41933 0.259
NP_439905.1_1 Forward -365 -352 11.4257 0.204
NP_439990.1_5 Reverse -112 -125 20.7671 0.00296
NP_442911.1_2 Reverse -107 -126 4.62101 0.0375
NP_442911.1_2 Forward -136 -117 -1.96717 0.092
NP_442064.1_4 Reverse -101 -120 15.4366 0.128
NP_440827.1_3 Reverse -106 -125 15.5357 0.169
NP_440602.1_8 Reverse -117 -131 10.6193 0.265
NP_440138.1_6 Forward -125 -106 1.37531 0.284
NP_440615.1_7 Reverse -366 -385 13.0738 0.233
NP_441099.1_5 Reverse -107 -126 -8.45701 0.194
NP_442002.1_9 Forward -32 -25 11.3472 0.185
NP_441294.1_7 Forward -130 -116 13.0902 0.0747
NP_442438.1_10 Forward -131 -117 0.786239 0.213
NP_442438.1_10 Reverse -112 -126 -1.08205 0.291
NP_441000.1_6 Reverse -116 -130 4.71948 0.0933
NP_440147.1_4 Forward -128 -115 1.29759 0.233
NP_441550.1_8 Reverse -115 -125 12.3692 0.0336
NP_441916.1_7 Reverse -117 -127 16.4013 0.00539
NP_441916.1_7 Forward -126 -116 10.9931 0.0261
NP_441041.1_4 Forward -126 -107 -2.95047 0.118
NP_441041.1_4 Forward -120 -101 -11.7019 0.251
NP_441041.1_4 Reverse -117 -136 -12.9802 0.278
NP_441041.1_7 Forward -129 -117 10.0414 0.103
NP_440569.1_7 Forward -126 -107 11.7008 0.286
NP_441547.1_2 Reverse -106 -124 16.0471 0.0911
NP_442004.1_6 Forward -126 -112 10.6193 0.14
NP_441725.1_5 Forward -125 -115 11.2881 0.0247
NP_441725.1_5 Reverse -118 -128 2.24165 0.115
NP_439966.1_7 Reverse -115 -125 15.8108 0.0124
NP_439966.1_7 Forward -128 -118 10.206 0.0958
NP_439966.1_9 Forward -128 -119 0.983037 0.253
NP_442941.1_3 Forward -125 -115 19.9412 0.00262
NP_442941.1_3 Reverse -118 -128 8.92815 0.0326
NP_440289.1_2 Forward -129 -116 12.409 0.015
NP_440260.1_8 Reverse -101 -119 -5.09406 0.273
NP_442281.1_1 Forward -131 -117 12.5853 0.0358
NP_442281.1_1 Reverse -112 -126 5.01387 0.172
NP_442281.1_1 Forward -167 -153 2.35894 0.269
NP_440437.1_1 Forward -132 -113 -2.26216 0.215
NP_440437.1_1 Reverse -111 -130 -2.55715 0.219
NP_442982.1_5 Forward -362 -343 -0.885524 0.262
NP_441644.1_6 Forward -126 -116 15.0242 0.00766
NP_442215.1_2 Forward -128 -112 -4.75968 0.239
NP_442029.1_6 Forward -380 -361 6.58763 0.238
NP_440253.1_2 Reverse -117 -135 16.6371 0.013
NP_440929.1_8 Forward -126 -117 9.93116 0.0249
NP_440929.1_8 Reverse -117 -126 9.83282 0.0254
NP_442933.1_10 Forward -126 -117 17.601 0.00325
NP_442933.1_10 Reverse -117 -126 17.601 0.00325
NP_441095.1_6 Forward -154 -135 6.29264 0.262
NP_440382.1_2 Reverse -266 -285 3.34192 0.274
NP_441751.2_8 Forward -125 -111 16.1259 0.00936
NP_440096.1_5 Reverse -343 -362 6.68596 0.275
NP_442554.1_8 Forward -125 -115 15.9097 0.00747
NP_442554.1_8 Reverse -118 -128 4.20827 0.193
NP_442554.1_8 Forward -119 -109 3.71661 0.215
NP_442554.1_8 Reverse -170 -180 2.63497 0.265
NP_441762.1_7 Forward -127 -115 4.07055 0.0572
NP_441762.1_7 Reverse -116 -128 -4.58258 0.179
NP_442142.1_4 Reverse -114 -127 16.4399 0.0264
NP_442142.1_4 Forward -129 -116 8.96682 0.106
NP_442142.1_4 Forward -123 -110 3.46031 0.255
NP_442292.1_1 Forward -125 -116 18.486 0.00229
NP_442292.1_1 Reverse -118 -127 0.688044 0.23
NP_440895.1_6 Reverse -111 -124 11.1307 0.202
NP_443009.1_5 Reverse -116 -127 17.266 0.00627
NP_442301.1_7 Forward -367 -348 18.289 0.257
NP_441715.1_4 Reverse -118 -128 15.0247 0.0268
NP_441715.1_4 Forward -125 -115 14.828 0.0268
NP_441468.1_1 Forward -125 -118 15.8704 0.0124
NP_441468.1_1 Reverse -118 -125 15.8704 0.0124
NP_441015.1_10 Reverse -106 -125 -4.42544 0.203
NP_441015.1_10 Forward -125 -106 -10.3253 0.284
NP_441673.1_1 Forward -126 -117 11.1111 0.0121
NP_441673.1_1 Reverse -117 -126 11.0128 0.018
NP_441731.1_3 Reverse -109 -128 -6.09707 0.29
NP_440265.1_4 Forward -131 -112 18.8068 0.287
NP_441876.1_9 Forward -21 -11 10.5993 0.287
NP_441876.1_9 Forward -90 -80 10.206 0.299
NP_441826.1_2 Reverse -111 -125 15.3392 0.0196
NP_442490.1_9 Reverse -105 -124 -3.54046 0.242
NP_442868.1_6 Reverse -115 -125 9.91146 0.038
NP_442868.1_6 Reverse -84 -94 4.40493 0.178
NP_441056.1_1 Forward -126 -107 3.53937 0.131
NP_441612.1_2 Reverse -174 -184 8.45247 0.214
NP_442227.1_2 Reverse -101 -120 9.93088 0.171
NP_442427.1_8 Forward -135 -116 12.2908 0.152
NP_442808.1_1 Forward -127 -117 9.91099 0.0481
NP_442692.1_10 Forward -209 -196 15.8434 0.216
NP_440145.1_3 Forward -193 -174 -5.50708 0.269
NP_442050.1_5 Reverse -115 -125 16.4991 0.00812
NP_442050.1_5 Forward -128 -118 8.23937 0.234
NP_441114.1_4 Forward -106 -95 17.6599 0.298
NP_440558.1_2 Forward -360 -341 4.916 0.147
NP_440558.1_2 Reverse -108 -127 -0.0988766 0.198
NP_441878.1_6 Forward -127 -117 0.668351 0.139
NP_441878.1_6 Reverse -116 -126 0.57002 0.14
NP_441036.1_8 Forward -127 -117 17.4829 0.0012
NP_441557.1_5 Reverse -117 -126 18.6826 0.0015
NP_441557.1_5 Forward -126 -117 10.5211 0.00695
NP_441445.1_1 Forward -135 -116 5.60432 0.166
NP_441445.1_1 Reverse -108 -127 2.0644 0.243
NP_442419.1_2 Reverse -106 -125 -4.42544 0.287
NP_442830.1_5 Reverse -283 -297 -1.77094 0.299
NP_441564.1_2 Forward -305 -286 -1.67217 0.223
NP_442183.1_1 Forward -126 -112 5.50613 0.215
NP_442347.1_2 Forward -125 -116 12.4878 0.056
NP_441597.1_2 Reverse -81 -100 16.8141 0.236
NP_442645.1_2 Reverse -109 -128 -18.9784 0.282
NP_440136.1_2 Forward -125 -118 15.9687 0.0123
NP_440136.1_2 Reverse -118 -125 15.9687 0.0123
NP_442590.1_10 Forward -126 -107 3.04771 0.297
NP_442998.1_10 Forward -124 -117 15.5754 0.0102
NP_442998.1_10 Reverse -119 -126 5.74231 0.255
NP_440299.1_1 Reverse -113 -126 22.4381 0.000547
NP_440299.1_1 Reverse -285 -298 5.72191 0.166
NP_441799.1_1 Forward -130 -116 7.86545 0.13
NP_441799.1_1 Reverse -113 -127 7.07881 0.153
NP_440640.1_6 Forward -365 -346 5.40766 0.21
NP_440256.1_1 Reverse -114 -133 6.88262 0.0282
NP_441559.1_8 Reverse -112 -126 -7.08024 0.283
NP_441838.1_5 Forward -126 -107 19.174 0.0485
NP_441199.1_7 Forward -61 -42 7.7676 0.184
NP_442993.1_1 Reverse -117 -133 11.9566 0.0141
NP_442386.1_9 Forward -127 -118 16.7155 0.0144
NP_442386.1_9 Reverse -116 -125 13.8639 0.0289
NP_441340.1_5 Forward -125 -118 15.6737 0.0124
NP_441340.1_5 Reverse -118 -125 15.6737 0.0124
NP_441340.1_9 Reverse -62 -72 8.25522 0.256
NP_441271.1_1 Forward -132 -114 11.6214 0.239
NP_441947.1_4 Forward -268 -249 15.3391 0.151
NP_441947.1_10 Forward -128 -110 1.88744 0.276
NP_440168.1_9 Reverse -355 -374 0.294447 0.273
NP_440586.1_8 Forward -125 -118 13.2151 0.026
NP_440586.1_8 Reverse -118 -125 13.2151 0.026
NP_440586.1_8 Forward -119 -112 9.08521 0.178
NP_441861.1_10 Forward -292 -273 17.3057 0.228
NP_442251.1_6 Forward -125 -118 15.2804 0.0124
NP_442251.1_6 Reverse -118 -125 15.2804 0.0124
NP_440192.1_5 Reverse -227 -246 3.73603 0.271
NP_441262.1_3 Reverse -117 -124 14.7888 0.0223
NP_441262.1_3 Forward -126 -119 13.9038 0.0336
NP_440027.1_8 Forward -129 -110 10.52 0.243
NP_443051.1_1 Reverse -116 -125 10.4228 0.00754
NP_443051.1_1 Forward -127 -118 1.08137 0.123
NP_440451.1_10 Forward -119 -100 10.9134 0.264
NP_440408.1_7 Forward -126 -107 8.45592 0.281
NP_440439.1_1 Reverse -114 -127 7.98409 0.0577
NP_439943.1_7 Forward -125 -106 4.22769 0.278
NP_440372.1_2 Forward -125 -118 16.3621 0.0124
NP_440372.1_2 Reverse -118 -125 16.3621 0.0124
NP_442511.1_7 Reverse -117 -136 19.5673 0.116
NP_441803.1_2 Reverse -112 -131 0.884433 0.243
NP_439977.1_5 Forward -132 -113 0.294447 0.211
NP_440139.1_1 Forward -132 -113 4.03023 0.193
NP_442384.1_10 Forward -126 -113 16.9322 0.00688
NP_441018.1_7 Reverse -101 -120 8.25926 0.253
NP_442790.1_4 Forward -40 -21 -5.70374 0.144
NP_442262.1_10 Forward -125 -118 14.1988 0.0123
NP_442262.1_10 Reverse -118 -125 14.1988 0.0123
NP_442262.1_10 Forward -119 -112 9.18389 0.211
NP_441689.1_5 Reverse -115 -125 15.3192 0.0403
NP_441689.1_5 Forward -128 -118 10.796 0.132
NP_440163.1_10 Reverse -114 -124 12.4681 0.159
NP_440163.1_10 Forward -129 -119 11.3864 0.169
NP_440344.1_10 Forward -133 -116 -5.27103 0.105
NP_440344.1_10 Reverse -110 -127 -8.61428 0.13
NP_441965.1_10 Forward -129 -113 7.92501 0.137
NP_441965.1_10 Forward -123 -107 4.97508 0.224
NP_441640.1_8 Forward -125 -106 5.11266 0.111
NP_440297.1_9 Forward -125 -115 9.32148 0.0917
NP_440297.1_9 Reverse -118 -128 0.766681 0.282
NP_442280.1_10 Reverse -101 -119 15.7789 0.109
NP_440999.1_9 Forward -130 -116 4.91614 0.114
NP_440888.1_2 Forward -126 -112 14.9452 0.0137
NP_440888.1_2 Reverse -117 -131 11.1104 0.0757
NP_442147.1_6 Reverse -310 -324 16.4202 0.205
NP_440575.1_1 Forward -282 -263 6.68515 0.216
NP_440575.1_1 Reverse -276 -295 -0.492971 0.29
NP_440575.1_8 Reverse -274 -293 5.50599 0.166
NP_441543.1_2 Forward -125 -116 16.9127 0.00359
NP_441543.1_2 Reverse -118 -127 15.4377 0.00784
NP_442845.1_2 Reverse -111 -125 14.7492 0.0774
NP_442845.1_2 Reverse -105 -119 3.63784 0.282
NP_441469.1_8 Forward -127 -118 8.06287 0.227
NP_441469.1_8 Reverse -116 -125 6.48957 0.227
NP_443064.1_6 Forward -126 -116 9.75513 0.199
NP_442578.1_7 Forward -125 -118 14.5921 0.026
NP_442578.1_7 Reverse -118 -125 14.5921 0.026
NP_440710.1_1 Reverse -281 -299 -7.45401 0.238
NP_441462.1_2 Reverse -117 -127 10.5998 0.0068
NP_441462.1_2 Forward -126 -116 1.84832 0.081
NP_441929.1_3 Forward -283 -264 13.2741 0.111
NP_443062.1_1 Forward -126 -108 15.9565 0.0336
NP_443062.1_1 Reverse -117 -135 6.8883 0.19
NP_443062.1_6 Reverse -109 -128 14.7491 0.0802
NP_440349.1_3 Forward -125 -106 9.53674 0.299
NP_440519.1_8 Forward -104 -88 1.63183 0.28
NP_442204.1_1 Reverse -113 -124 9.69511 0.0736
NP_441560.1_8 Reverse -112 -131 15.5056 0.106
NP_442487.1_5 Reverse -273 -292 8.55343 0.198
NP_442487.1_5 Reverse -295 -314 2.6536 0.3
NP_440516.1_8 Reverse -117 -126 9.4395 0.0183
NP_440516.1_8 Forward -126 -117 7.17789 0.0754
NP_442428.1_5 Forward -125 -118 15.8704 0.0124
NP_442428.1_5 Reverse -118 -125 15.8704 0.0124
NP_441267.1_2 Forward -363 -344 15.2408 0.0578
NP_442120.1_10 Forward -132 -113 -10.817 0.261
NP_440673.1_3 Reverse -119 -126 14.0021 0.0426
NP_440673.1_3 Forward -124 -117 12.4288 0.0426
NP_440673.1_3 Forward -93 -86 7.02061 0.274
NP_441052.1_2 Forward -126 -116 11.4848 0.0285
NP_441052.1_2 Forward -120 -110 10.9931 0.0285
NP_441052.1_2 Reverse -117 -127 0.668351 0.256
NP_442219.1_8 Forward -367 -348 14.5449 0.136
NP_442219.1_8 Reverse -362 -381 7.68394 0.265
NP_442219.1_9 Forward -125 -116 17.7976 0.00718
NP_442219.1_9 Reverse -118 -127 9.04618 0.0681
NP_440436.1_4 Forward -125 -116 17.2072 0.00233
NP_440436.1_4 Reverse -118 -127 16.9122 0.00357
NP_441086.1_6 Reverse -296 -306 16.0075 0.256
NP_441719.1_4 Forward -125 -118 16.3621 0.0124
NP_441719.1_4 Reverse -118 -125 16.3621 0.0124
NP_441733.1_10 Reverse -114 -127 8.77074 0.135
NP_442366.1_3 Forward -127 -109 24.9952 0.00586
NP_442695.1_3 Forward -62 -48 13.6669 0.268
NP_441115.1_4 Forward -127 -109 10.0481 0.19
NP_441115.1_4 Forward -258 -240 9.26148 0.221
NP_440094.1_2 Forward -125 -106 -3.93378 0.294
NP_443054.1_2 Reverse -115 -129 2.65453 0.242
NP_441851.1_10 Reverse -116 -126 16.9913 0.00552
NP_441851.1_10 Forward -127 -117 6.76487 0.156
NP_442515.1_1 Reverse -85 -99 -3.24533 0.289
NP_442515.1_1 Reverse -174 -188 -4.4253 0.298
NP_440593.1_3 Forward -125 -106 4.32602 0.137
NP_441349.1_10 Reverse -107 -126 -1.18052 0.0999
NP_441409.1_6 Reverse -111 -130 0.687771 0.0648
NP_440432.1_9 Reverse -118 -133 -5.32998 0.245
NP_440431.1_3 Forward -255 -236 -10.7186 0.276
NP_442450.1_5 Reverse -115 -125 9.32148 0.115
NP_440588.1_2 Reverse -108 -127 13.8641 0.0175
NP_441570.1_1 Forward -126 -108 -16.8938 0.257
NP_441570.1_1 Reverse -111 -129 -17.4838 0.278
NP_441078.1_4 Forward -126 -117 9.93116 0.0203
NP_441078.1_4 Reverse -117 -126 9.83282 0.0226
NP_441091.1_5 Forward -130 -111 5.89931 0.231
NP_440526.1_3 Forward -125 -114 7.92465 0.126
NP_441432.1_8 Reverse -116 -125 16.8143 0.00595
NP_441432.1_8 Forward -299 -290 3.53964 0.244
NP_441333.1_1 Reverse -126 -136 14.5451 0.217
NP_442320.1_8 Forward -132 -118 5.70279 0.0334
NP_442320.1_8 Reverse -111 -125 -3.54032 0.124
NP_441732.1_2 Reverse -113 -129 -17.4444 0.258
NP_441732.1_2 Forward -261 -245 -17.5427 0.27
NP_440131.1_4 Reverse -104 -123 5.80098 0.275
NP_440199.1_10 Reverse -114 -124 7.64985 0.231
NP_440713.1_4 Reverse -107 -126 21.2389 0.0133
NP_442489.1_7 Forward -126 -117 10.4228 0.0151
NP_442489.1_7 Reverse -117 -126 10.3245 0.0193
NP_442079.1_7 Forward -125 -106 5.70265 0.17
NP_440559.1_1 Forward -125 -116 17.4043 0.00658
NP_440559.1_1 Reverse -118 -127 8.84951 0.0586
NP_441659.2_8 Forward -126 -116 15.9097 0.00467
NP_441659.2_8 Reverse -117 -127 2.33998 0.205
NP_440442.1_3 Forward -127 -113 16.7159 0.23
NP_441800.1_3 Forward -125 -107 5.32902 0.286
NP_442776.1_1 Reverse -290 -309 9.63589 0.181
NP_442346.1_5 Reverse -116 -126 16.2046 0.00277
NP_442346.1_5 Forward -127 -117 6.8632 0.188
NP_441629.1_1 Forward -134 -115 7.07928 0.253
NP_440010.1_4 Forward -130 -111 0.293673 0.25
NP_442551.1_4 Reverse -354 -369 -2.38005 0.259
NP_442603.1_7 Forward -126 -112 16.3219 0.0326
NP_441585.1_5 Reverse -88 -107 0.490334 0.291
NP_441047.1_2 Forward -119 -100 14.9458 0.0665
NP_441833.1_4 Forward -125 -118 15.9687 0.0124
NP_441833.1_4 Reverse -118 -125 15.9687 0.0124
NP_442799.1_2 Reverse -109 -128 -1.18052 0.294
NP_441329.1_6 Forward -139 -120 2.24364 0.231
NP_442162.1_9 Forward -125 -118 16.2637 0.0124
NP_442162.1_9 Reverse -118 -125 16.2637 0.0124
NP_440671.1_4 Reverse -111 -125 20.2558 0.00642
NP_440671.1_4 Forward -132 -118 12.8809 0.0998
NP_442045.1_5 Reverse -108 -127 6.19431 0.202
NP_442140.1_3 Reverse -118 -128 8.04317 0.124
NP_442140.1_3 Forward -125 -115 4.40493 0.243
NP_440875.1_9 Forward -181 -171 8.76138 0.233
NP_441813.1_5 Forward -128 -118 16.4013 0.01
NP_441813.1_5 Reverse -115 -125 15.9097 0.01
NP_440590.1_4 Forward -125 -112 6.1158 0.0583
NP_440590.1_4 Reverse -118 -131 -4.60227 0.263
NP_440567.1_1 Forward -125 -111 4.03116 0.131
NP_442497.1_10 Forward -125 -116 10.4228 0.0087
NP_442497.1_10 Reverse -118 -127 8.55452 0.0294
NP_440821.1_4 Reverse -115 -125 18.2696 0.00448
NP_440821.1_4 Forward -128 -118 10.3048 0.0163
NP_441239.1_9 Forward -128 -116 11.7404 0.0551
NP_441009.1_4 Forward -126 -107 10.8159 0.26
NP_440624.1_5 Reverse -138 -156 7.66739 0.294
NP_441892.1_1 Forward -129 -112 0.137172 0.173
NP_441892.1_1 Reverse -108 -125 -2.91109 0.23
NP_441892.1_1 Reverse -102 -119 -4.48438 0.261
NP_441017.1_6 Forward -130 -116 12.9786 0.209
NP_440546.1_4 Reverse -117 -127 13.5365 0.0459
NP_440546.1_4 Forward -126 -116 10.8217 0.104
NP_440462.1_6 Forward -128 -118 14.7297 0.0186
NP_440462.1_6 Reverse -115 -125 7.74818 0.0699
NP_442465.1_9 Reverse -290 -304 11.7993 0.238
NP_440868.1_4 Reverse -113 -125 6.1355 0.0878
NP_440868.1_4 Forward -130 -118 0.530633 0.21
NP_440868.1_4 Reverse -362 -374 0.432302 0.212
NP_442499.1_3 Reverse -168 -186 9.65558 0.252
NP_440036.1_1 Forward -106 -87 8.45592 0.277
NP_442039.1_4 Forward -125 -118 15.1821 0.0124
NP_442039.1_4 Reverse -118 -125 15.1821 0.0124
NP_441811.1_8 Reverse -111 -125 5.80112 0.289
NP_440008.1_9 Reverse -111 -130 11.9958 0.187
NP_442837.1_3 Forward -125 -118 15.7721 0.0124
NP_442837.1_3 Reverse -118 -125 15.7721 0.0124
NP_440160.1_9 Forward -305 -286 7.57094 0.287
NP_442053.1_1 Reverse -117 -126 9.24284 0.068
NP_442053.1_1 Forward -126 -117 8.94785 0.07
NP_440505.1_3 Reverse -115 -125 16.303 0.00696
NP_441203.1_1 Forward -125 -106 -10.227 0.137
NP_440914.1_1 Forward -126 -116 16.3248 0.00196
NP_441011.1_8 Reverse -118 -127 18.191 0.00602
NP_441011.1_8 Forward -125 -116 8.25953 0.144
NP_442533.1_6 Reverse -117 -126 15.1427 0.00675
NP_442533.1_6 Forward -126 -117 7.47288 0.0898
NP_443050.1_2 Forward -118 -99 13.5691 0.147
NP_441482.1_7 Reverse -111 -125 0.687908 0.0554
NP_439944.1_9 Forward -125 -115 19.0562 0.00329
NP_439944.1_9 Reverse -118 -128 8.63316 0.105
NP_441028.1_6 Forward -90 -80 3.71617 0.281
NP_440116.1_8 Forward -125 -106 -3.14714 0.148
NP_441527.1_4 Reverse -79 -98 -3.48588 0.167
NP_440115.1_6 Reverse -83 -93 13.5497 0.0699
NP_440115.1_6 Reverse -114 -124 9.41981 0.115
NP_440007.1_9 Reverse -113 -127 1.86788 0.282
NP_441972.1_5 Forward -125 -106 -2.45882 0.184
NP_441106.1_1 Forward -127 -118 17.306 0.00607
NP_441106.1_1 Reverse -116 -125 9.63616 0.0311
NP_440429.1_2 Reverse -290 -309 7.47261 0.288
NP_439903.1_6 Forward -129 -110 3.44025 0.21
NP_441286.1_1 Reverse -116 -128 5.25052 0.0259
NP_441286.1_1 Forward -127 -115 2.69391 0.0562
NP_441286.1_1 Forward -96 -84 -6.15587 0.251
NP_442674.1_1 Forward -256 -237 12.9884 0.218
NP_442674.1_3 Reverse -103 -122 10.3234 0.174
NP_440670.1_8 Reverse -117 -126 8.94785 0.0606
NP_440670.1_8 Forward -126 -117 8.84951 0.0606
NP_440886.1_7 Forward -127 -117 9.02601 0.0805
NP_442072.1_9 Reverse -116 -134 -14.4355 0.145
NP_440907.2_8 Reverse -118 -128 4.99446 0.228
NP_442264.1_2 Forward -130 -113 10.1669 0.188
NP_441021.1_1 Forward -125 -106 -5.01543 0.172
NP_441463.1_3 Reverse -107 -126 -10.522 0.296
NP_441463.1_6 Forward -128 -114 6.3193 0.274
NP_441626.1_2 Forward -125 -118 15.7721 0.0124
NP_441626.1_2 Reverse -118 -125 15.7721 0.0124
NP_440107.1_5 Reverse -110 -129 -7.27704 0.281
NP_442794.1_1 Reverse -113 -125 19.7052 0.00523
NP_442615.1_1 Reverse -108 -126 -3.81576 0.17
NP_441962.1_4 Reverse -81 -100 -14.4552 0.288
NP_440387.1_1 Forward -126 -110 -4.36636 0.185
NP_441488.1_8 Reverse -106 -120 10.717 0.146
NP_440814.1_4 Reverse -108 -127 -12.4886 0.23
NP_440114.1_10 Reverse -117 -131 11.6026 0.107
NP_440766.1_4 Reverse -113 -127 18.7808 0.0255
NP_439988.1_10 Reverse -64 -83 6.61707 0.257
NP_442743.1_5 Forward -125 -106 10.3242 0.144
NP_439910.1_1 Forward -304 -290 19.3708 0.265
NP_439910.1_2 Forward -134 -117 34.0614 0.00009
NP_439910.1_3 Forward -257 -238 23.9922 0.024
NP_440457.1_1 Reverse -113 -125 8.29878 0.101
NP_442509.1_9 Reverse -117 -127 6.86274 0.248
NP_440554.1_4 Reverse -118 -128 16.6963 0.0189
NP_440554.1_4 Forward -125 -115 7.05986 0.106
NP_441885.1_5 Forward -126 -116 11.1898 0.00775
NP_441885.1_5 Reverse -117 -127 10.2065 0.012
NP_440478.1_9 Forward -122 -103 8.55425 0.268
NP_442703.1_4 Forward -126 -107 2.55527 0.283
NP_442703.1_8 Forward -82 -64 10.7364 0.266
NP_442341.1_7 Forward -127 -113 6.3911 0.127
NP_442341.1_9 Forward -128 -114 7.07881 0.204
NP_442395.2_4 Forward -127 -108 6.29183 0.15
NP_443000.1_3 Forward -298 -279 10.5529 0.272
NP_443000.1_7 Reverse -115 -125 17.0896 0.00865
NP_443000.1_7 Forward -128 -118 8.04317 0.0553
NP_440507.2_3 Reverse -108 -127 18.1898 0.0469
NP_440275.1_3 Reverse -115 -125 8.1415 0.0602
NP_440275.1_3 Reverse -84 -94 6.27322 0.118
NP_440091.1_1 Forward -130 -118 20.5902 0.00953
NP_440091.1_1 Reverse -113 -125 -0.452677 0.273
NP_443010.1_10 Forward -129 -112 4.31693 0.234
NP_440149.1_8 Forward -126 -107 -1.67217 0.162
NP_441105.1_3 Reverse -106 -125 -2.26216 0.159
NP_440216.1_1 Reverse -117 -131 -3.44199 0.082
NP_440216.1_1 Forward -298 -284 -12.4884 0.274
NP_440216.1_9 Forward -118 -109 6.39124 0.289
NP_440172.1_1 Reverse -117 -127 10.9931 0.0445
NP_440172.1_1 Forward -126 -116 5.28991 0.146
NP_442371.1_1 Reverse -215 -225 13.4509 0.206
NP_442015.1_10 Reverse -113 -126 9.06573 0.0553
NP_441226.1_7 Forward -125 -118 14.4934 0.0123
NP_441226.1_7 Reverse -118 -125 14.4934 0.0123
NP_441111.1_7 Forward -125 -117 18.7023 0.00294
NP_441111.1_7 Reverse -118 -126 8.86921 0.0589
NP_441766.1_2 Reverse -117 -126 17.896 0.00297
NP_441766.1_2 Forward -126 -117 9.4395 0.0285
NP_440416.1_9 Reverse -110 -129 -8.55534 0.117
NP_440416.1_9 Forward -121 -102 -9.63698 0.133
NP_443052.1_8 Forward -136 -117 -9.047 0.183
NP_442116.1_6 Reverse -55 -72 6.64108 0.273
NP_442154.1_1 Forward -306 -288 -17.6804 0.262
NP_440261.1_5 Forward -125 -112 -2.93064 0.0983
NP_440988.1_10 Forward -122 -108 9.83628 0.193
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGAAAAAAAGGAGCATCCTGATTTGGCAATTGAGGTCAATGTCACCAGTGGCAGTCCAAGCAAACTAGCAAAGTATCAACGGCTGGGCATTCAAGAGGTTTGGCTGTGGCAGGACGGAAAATTTTCTATTTACTCCCTAGAAGGCGAGCATTACCAAGAAACTTCAACCAGCAAATTACTTCCAGGTTTAAATTTTGCGCTGCTAGAGGAATGCGTATTGATGCCCTCTCGACTAGAAGCAATCCAAAAGTTTACAGCTCGATAAAAATAAACAGCGATCGCCATGGACAAGGCAGGGAACTATTCCGGTTGCCCCCTTTTATTGATAATCTTTCCTAGTAACTTCACTAAAGTAAAGAACGGAGTCGGGCAATTAGGTTAATCCCTACCTAAAGATCC

CDS

GTGCCCTTTCTCCAATGCATTATGCGATCGTCCTTGTATTTTCGAGCTAAATCTCCCGGTTATCTTGCCTTGGGCCTTGTCCTGGGGGCAACGGTTTTATTCGCCTGTCTAATATCCAGTATTCTCCTGGGAGCGGCGGATATTAGTCCCCAAACAGTGTGGCAAGCCCTATTTCAATTTGACGGTTCCACTGACCATTTAATTATTCGCACGGTACGTTTACCCAGGGCCATTCTGGCGATCGTGGTGGGAGCTTCCTTGGCTGTGGCCGGGGCCATTACCCAGGGTTTAACCCGTAATCCTCTGGCAGCTCCCGATATTCTGGGGGTTAATGTGGGTGCGTCCTTAGCGGTGGTTCTGGCCACATTTATTGGTGGCGATGGTAGTAACCAGTGGGCATTTGCCTTCATTGGAGCGGCGATCGCCGCTGTAGTTGTCTATGGCTTGGGAACCCTTGGCCGCAGTGGTCTCACCCCAATTAAATTGGTCATTGCGGGGGCGGCCCTGTCGTATTTTTTAGGCTCTTTGACCACCGGCATTCTCCTGCTCAATCAACGTACCCTAGACGATATTCGCTTTTGGTTGGCCGGCTCCCTAGGGGGACAAGATTGGAATGGTTTAACGGCGGTTTTGCCCTACATCATGGTTGGTTTGGTCAGTTCCCTTAGTTTGGGTAGGCAATTAACCTTACTGACCTTTGGAGAAGAAGTGGCCCAGGGATTAGGCCTAAAAACGGCCTGGGTAAAATTGGGGGCGGCAACGGTTTTGGTGTTACTGGCGGGCAGTGCCGTCGCCCTGGCGGGGCCGATTGGCTTTGTCGGTTTAATTGTGCCCCACGTGGTTCGTTTTGGGGTCGGAGTGGATTATCGATGGATTTTACCCTACGCCATGGTGATGGGGGGAATTTTTCTTTCTGTGGCTGACATGGCCGCCCGATTATTGATCAGCCCGCAAGAACTACCAGTGGGCATTATGACTGCTTTGGTGGGGGCACCTTTTTTTATTTATCTTGCCCGCTCCCAAATTAAATAA

Protein

MPFLQCIMRSSLYFRAKSPGYLALGLVLGATVLFACLISSILLGAADISPQTVWQALFQFDGSTDHLIIRTVRLPRAILAIVVGASLAVAGAITQGLTRNPLAAPDILGVNVGASLAVVLATFIGGDGSNQWAFAFIGAAIAAVVVYGLGTLGRSGLTPIKLVIAGAALSYFLGSLTTGILLLNQRTLDDIRFWLAGSLGGQDWNGLTAVLPYIMVGLVSSLSLGRQLTLLTFGEEVAQGLGLKTAWVKLGAATVLVLLAGSAVALAGPIGFVGLIVPHVVRFGVGVDYRWILPYAMVMGGIFLSVADMAARLLISPQELPVGIMTALVGAPFFIYLARSQIK