Your browser is old and dusty. Try Google Chrome!

Details for slr1291

ORF slr1291
Accession NP_440158.1
Symbol ndhD2
Category NADH dehydrogenase
Definition NADH dehydrogenase subunit 4
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -187 -180 14.6904 0.0123
NP_440795.1_7 Reverse -180 -187 14.6904 0.0123
NP_441418.1_6 Reverse -179 -198 -19.4701 0.0888
NP_441418.1_6 Forward -200 -181 -30.6798 0.291
NP_442291.1_5 Reverse -178 -194 -1.51476 0.199
NP_440897.1_6 Forward -188 -169 -3.63955 0.252
NP_441453.1_4 Reverse -179 -187 16.539 0.00633
NP_441453.1_4 Forward -188 -180 16.539 0.00633
NP_442151.1_6 Forward -188 -174 8.84938 0.164
NP_441818.1_1 Forward -187 -176 15.4961 0.0264
NP_441818.1_1 Reverse -203 -214 9.20294 0.25
NP_440226.1_1 Reverse -179 -198 16.1257 0.022
NP_440226.1_1 Forward -188 -169 13.7658 0.0348
NP_440996.1_3 Reverse -166 -184 10.4422 0.247
NP_442173.1_1 Forward -187 -179 15.4574 0.00633
NP_442173.1_1 Reverse -180 -188 15.4574 0.00633
NP_442173.1_1 Forward -379 -371 11.3275 0.0463
NP_442752.1_4 Forward -188 -181 13.8055 0.0199
NP_442752.1_4 Reverse -179 -186 13.8055 0.0199
NP_443027.1_4 Forward -190 -180 13.2547 0.0521
NP_443027.1_4 Reverse -177 -187 11.0914 0.107
NP_440784.1_7 Forward -187 -180 15.9687 0.0123
NP_440784.1_7 Reverse -180 -187 15.9687 0.0123
NP_441967.1_6 Forward -23 -4 23.9922 0.019
NP_441250.1_3 Reverse -157 -176 4.916 0.241
NP_441438.1_1 Reverse -38 -57 10.3242 0.228
NP_440061.1_9 Forward -190 -176 18.0918 0.0109
NP_440061.1_9 Reverse -177 -191 12.3887 0.0971
NP_440061.1_9 Forward -382 -368 9.24208 0.149
NP_441054.1_4 Reverse -169 -187 25.4869 0.00534
NP_442062.1_3 Reverse -40 -59 0.0977854 0.239
NP_442062.1_8 Forward -188 -178 17.3846 0.00193
NP_442062.1_8 Reverse -179 -189 10.3048 0.0493
NP_440761.1_4 Reverse -174 -193 -14.0619 0.257
NP_440304.1_4 Forward -190 -180 10.8948 0.051
NP_440304.1_4 Reverse -177 -187 1.84832 0.299
NP_442242.1_4 Forward -187 -180 14.3954 0.0124
NP_442242.1_4 Reverse -180 -187 14.3954 0.0124
NP_440044.1_8 Reverse -180 -199 -3.3438 0.282
NP_441660.1_8 Reverse -253 -272 16.6174 0.141
NP_439918.1_2 Forward -279 -260 -2.55715 0.244
NP_442110.1_7 Reverse -179 -193 2.5562 0.222
NP_440856.1_4 Forward -195 -176 13.3725 0.0346
NP_441083.1_5 Forward -188 -178 20.3345 0.00053
NP_441083.1_5 Reverse -179 -189 11.2881 0.0159
NP_441083.1_5 Reverse -202 -212 5.09324 0.125
NP_441083.1_5 Forward -200 -190 2.43831 0.195
NP_439957.1_10 Forward -146 -136 16.2046 0.277
NP_441738.1_2 Forward -186 -179 15.28 0.0102
NP_441738.1_2 Reverse -181 -188 15.28 0.0102
NP_441558.1_5 Forward -190 -171 17.699 0.0191
NP_441558.1_5 Reverse -177 -196 8.94757 0.135
NP_440209.1_1 Reverse -179 -187 18.1123 0.00295
NP_440209.1_1 Forward -188 -180 18.1123 0.00295
NP_440407.1_5 Reverse -183 -202 19.6648 0.0977
NP_440447.1_1 Forward -193 -175 4.54237 0.223
NP_440447.1_6 Reverse -171 -189 7.68896 0.14
NP_440056.1_9 Reverse -163 -182 12.8967 0.295
NP_441713.1_1 Reverse -173 -192 3.83436 0.0568
NP_441716.1_1 Forward -188 -174 4.81781 0.248
NP_442111.1_4 Reverse -178 -192 20.8458 0.00257
NP_440906.1_5 Forward -187 -180 15.8704 0.0124
NP_440906.1_5 Reverse -180 -187 15.8704 0.0124
NP_441209.1_3 Forward -60 -41 17.7133 0.226
NP_440747.1_10 Forward -191 -179 17.1486 0.000663
NP_440747.1_10 Reverse -176 -188 16.7552 0.0019
NP_440747.1_10 Forward -203 -191 -12.4491 0.282
NP_440747.1_10 Forward -214 -202 -12.5474 0.297
NP_441130.1_10 Reverse -177 -191 5.40779 0.231
NP_442145.1_4 Forward -58 -39 9.31004 0.175
NP_440944.1_2 Reverse -167 -186 -0.983855 0.259
NP_442634.1_2 Forward -194 -175 -0.4922 0.293
NP_442634.1_4 Reverse -177 -191 8.16106 0.0479
NP_442634.1_4 Forward -190 -176 -1.8687 0.149
NP_442634.1_4 Forward -213 -199 -5.31028 0.246
NP_441265.1_3 Forward -194 -180 4.52282 0.181
NP_440470.1_5 Reverse -51 -70 20.9601 0.0752
NP_440470.1_5 Reverse -61 -80 17.9998 0.141
NP_440057.1_6 Forward -81 -62 15.4883 0.235
NP_443017.1_1 Forward -56 -37 15.1316 0.274
NP_443018.1_3 Forward -187 -180 14.8871 0.0123
NP_443018.1_3 Reverse -180 -187 14.8871 0.0123
NP_443018.1_3 Forward -379 -372 8.8889 0.136
NP_441634.1_8 Reverse -177 -191 -3.24533 0.295
NP_440376.1_1 Forward -188 -179 19.4693 0.000692
NP_440376.1_1 Reverse -179 -188 19.4693 0.000692
NP_441588.1_4 Forward -186 -176 6.46988 0.193
NP_443065.1_9 Reverse -339 -358 13.0775 0.231
NP_442687.1_7 Forward -189 -179 9.02648 0.0994
NP_442687.1_7 Reverse -178 -188 8.92815 0.0994
NP_442191.1_4 Reverse -180 -194 14.9684 0.073
NP_441077.1_2 Forward -77 -58 1.38421 0.283
NP_441077.1_2 Forward -67 -48 1.00224 0.289
NP_442958.1_3 Reverse -168 -187 0.491109 0.267
NP_440609.1_6 Reverse -268 -287 21.4356 0.0266
NP_442530.1_2 Forward -171 -161 14.533 0.203
NP_440642.1_10 Reverse -139 -153 12.192 0.137
NP_440667.1_2 Forward -285 -266 5.89931 0.189
NP_442658.1_1 Forward -190 -180 14.2375 0.0237
NP_442658.1_1 Reverse -177 -187 7.94438 0.199
NP_442658.1_1 Reverse -369 -379 5.48612 0.265
NP_442198.1_3 Reverse -170 -189 3.53937 0.285
NP_442782.1_2 Reverse -179 -193 10.7177 0.173
NP_441414.1_9 Forward -188 -169 14.9458 0.0118
NP_441414.1_9 Reverse -179 -198 -9.73531 0.266
NP_440184.1_7 Reverse -36 -55 13.4144 0.28
NP_441958.1_5 Forward -189 -179 21.2195 0.000805
NP_441958.1_5 Reverse -178 -188 12.2714 0.00183
NP_442486.1_4 Forward -198 -179 11.9958 0.167
NP_442816.1_7 Forward -57 -38 5.77684 0.244
NP_439905.1_1 Forward -187 -174 16.5389 0.0578
NP_440984.1_7 Reverse -174 -188 11.2093 0.122
NP_440984.1_7 Forward -193 -179 10.1277 0.126
NP_439990.1_5 Reverse -174 -187 19.6855 0.00652
NP_442690.1_1 Reverse -61 -80 -3.83545 0.142
NP_442690.1_1 Reverse -51 -70 -7.4737 0.175
NP_442690.1_1 Reverse -41 -60 -14.3569 0.272
NP_442690.1_1 Reverse -158 -177 -16.4218 0.289
NP_442690.1_1 Forward -179 -160 -17.1101 0.297
NP_442911.1_2 Reverse -169 -188 5.01433 0.0356
NP_442911.1_2 Forward -198 -179 -1.08219 0.0811
NP_440153.1_5 Reverse -180 -194 5.30946 0.191
NP_442064.1_1 Reverse -174 -193 4.62101 0.143
NP_440993.1_2 Forward -193 -177 3.30346 0.259
NP_440993.1_3 Forward -198 -179 14.4533 0.0527
NP_440602.1_2 Reverse -174 -193 4.81767 0.263
NP_440138.1_7 Reverse -169 -187 15.2807 0.278
NP_441099.1_5 Reverse -169 -188 17.2074 0.0135
NP_442002.1_9 Reverse -370 -377 9.97054 0.246
NP_440809.1_9 Forward -197 -179 2.0841 0.118
NP_442013.1_2 Reverse -191 -210 13.3725 0.293
NP_441712.1_1 Forward -179 -160 9.42428 0.289
NP_441294.1_7 Forward -192 -178 10.4985 0.185
NP_442438.1_10 Forward -193 -179 4.71948 0.142
NP_440377.1_1 Forward -70 -53 15.5256 0.181
NP_441000.1_6 Reverse -178 -192 -3.54032 0.224
NP_440147.1_4 Forward -190 -177 17.9155 0.00539
NP_440147.1_4 Reverse -177 -190 15.7522 0.0148
NP_440147.1_4 Reverse -230 -243 2.08423 0.21
NP_441550.1_8 Forward -190 -180 15.8108 0.0132
NP_441550.1_8 Reverse -177 -187 15.1225 0.0132
NP_441916.1_7 Reverse -179 -189 18.9579 0.00144
NP_441916.1_7 Forward -188 -178 10.3048 0.0261
NP_440345.1_5 Forward -172 -158 16.7213 0.263
NP_441041.1_4 Forward -188 -169 -3.04881 0.119
NP_441041.1_7 Forward -191 -179 13.3454 0.0485
NP_442396.1_5 Reverse -175 -188 11.819 0.0913
NP_440569.1_10 Reverse -53 -72 10.3605 0.222
NP_440569.1_10 Reverse -159 -178 4.72643 0.25
NP_440703.1_2 Reverse -172 -191 17.4367 0.151
NP_441725.1_4 Forward -193 -179 4.03056 0.278
NP_441725.1_5 Forward -187 -177 2.04498 0.115
NP_441725.1_5 Reverse -180 -190 1.94665 0.115
NP_439966.1_7 Reverse -177 -187 15.3192 0.0152
NP_439966.1_7 Forward -190 -180 14.3359 0.0203
NP_442941.1_3 Forward -187 -177 19.2529 0.00262
NP_442941.1_3 Reverse -180 -190 19.2529 0.00262
NP_442941.1_5 Reverse -164 -178 17.3897 0.181
NP_440289.1_2 Forward -191 -178 3.16588 0.0811
NP_440289.1_2 Reverse -176 -189 -3.71729 0.267
NP_442281.1_1 Forward -193 -179 8.55376 0.0798
NP_442281.1_1 Reverse -186 -200 3.04726 0.246
NP_442281.1_1 Forward -216 -202 1.5723 0.296
NP_441334.1_7 Reverse -177 -196 -21.0434 0.287
NP_441079.1_7 Forward -71 -52 -1.27961 0.201
NP_441566.1_3 Forward -291 -272 13.5691 0.24
NP_442256.1_2 Reverse -177 -195 0.609134 0.115
NP_440437.1_1 Forward -194 -175 6.58763 0.0726
NP_440647.1_9 Forward -190 -172 6.60732 0.219
NP_442500.1_8 Forward -71 -57 19.2406 0.103
NP_442500.1_8 Forward -84 -70 9.88916 0.272
NP_442012.1_2 Reverse -177 -196 4.32602 0.216
NP_440498.1_1 Forward -197 -179 -0.177514 0.218
NP_442982.1_5 Forward -198 -179 -2.95047 0.289
NP_441644.1_6 Reverse -179 -189 19.0557 0.000803
NP_441644.1_6 Forward -188 -178 17.3841 0.00127
NP_441071.1_2 Forward -73 -54 12.7478 0.291
NP_440867.1_9 Forward -198 -179 12.3892 0.249
NP_442215.1_2 Reverse -200 -216 -0.826444 0.173
NP_442215.1_2 Reverse -177 -193 -3.38305 0.214
NP_442029.1_6 Reverse -174 -193 5.89931 0.248
NP_442029.1_6 Forward -260 -241 2.45773 0.296
NP_442247.1_8 Forward -382 -368 9.43936 0.247
NP_440253.1_2 Forward -188 -170 -0.374176 0.209
NP_440929.1_8 Forward -188 -179 19.2726 0.000701
NP_440929.1_8 Reverse -179 -188 19.2726 0.000701
NP_440566.1_6 Reverse -177 -196 9.73422 0.287
NP_442933.1_10 Forward -188 -179 17.601 0.00325
NP_442933.1_10 Reverse -179 -188 17.601 0.00325
NP_440576.1_2 Reverse -52 -71 9.0459 0.252
NP_441751.2_8 Reverse -180 -194 7.27608 0.0339
NP_441751.2_8 Forward -187 -173 2.75286 0.0759
NP_442554.1_8 Reverse -180 -190 17.2863 0.00543
NP_442554.1_8 Forward -187 -177 16.2046 0.0065
NP_441762.1_7 Forward -189 -177 -6.64753 0.284
NP_441762.1_7 Reverse -178 -190 -6.84419 0.284
NP_442142.1_4 Forward -191 -178 12.9 0.0406
NP_442142.1_4 Reverse -176 -189 4.83694 0.209
NP_442292.1_1 Forward -187 -178 18.486 0.00229
NP_442292.1_1 Reverse -180 -189 17.5026 0.00435
NP_442476.1_6 Forward -187 -173 12.1926 0.0509
NP_442476.1_6 Reverse -180 -194 1.27789 0.223
NP_440895.1_3 Forward -64 -45 16.2746 0.237
NP_440895.1_6 Reverse -173 -186 10.4424 0.202
NP_441523.1_6 Forward -192 -173 4.52268 0.251
NP_443009.1_5 Reverse -178 -189 14.5128 0.02
NP_443009.1_5 Forward -189 -178 10.1862 0.0792
NP_443009.1_5 Reverse -231 -242 3.99143 0.268
NP_441715.1_4 Forward -187 -177 17.3846 0.0106
NP_441715.1_4 Reverse -180 -190 16.7946 0.0106
NP_441715.1_4 Reverse -203 -213 13.5497 0.0431
NP_441715.1_4 Forward -29 -19 5.09324 0.233
NP_440158.1_1 Forward -55 -36 25.6392 0.00192
NP_440158.1_1 Forward -65 -46 14.9441 0.105
NP_441198.1_8 Reverse -369 -379 10.7322 0.247
NP_440379.1_5 Reverse -175 -194 2.55606 0.149
NP_440464.1_10 Forward -357 -347 12.9127 0.176
NP_441468.1_1 Forward -187 -180 15.8704 0.0124
NP_441468.1_1 Reverse -180 -187 15.8704 0.0124
NP_441673.1_1 Forward -188 -179 20.8459 0.000698
NP_441673.1_1 Reverse -179 -188 20.8459 0.000698
NP_441826.1_2 Forward -194 -180 -3.34366 0.284
NP_441330.1_1 Forward -193 -174 -12.6852 0.183
NP_441637.1_9 Reverse -66 -84 2.77242 0.271
NP_441764.1_1 Reverse -60 -79 15.6341 0.0923
NP_442868.1_6 Reverse -177 -187 19.2529 0.00563
NP_442868.1_6 Forward -190 -180 10.4031 0.038
NP_442719.1_2 Reverse -161 -179 -0.571569 0.162
NP_442719.1_2 Reverse -66 -84 -11.8796 0.297
NP_440785.1_2 Forward -243 -224 7.37428 0.223
NP_441612.1_2 Forward -188 -178 8.54929 0.21
NP_441612.1_2 Reverse -202 -212 7.00028 0.268
NP_441612.1_2 Forward -30 -20 6.61303 0.283
NP_442427.1_8 Reverse -362 -381 10.8159 0.156
NP_442427.1_8 Reverse -170 -189 5.50599 0.264
NP_442808.1_1 Forward -189 -179 8.73102 0.0481
NP_442808.1_1 Reverse -178 -188 8.63269 0.0481
NP_442692.1_1 Reverse -343 -362 -5.99873 0.282
NP_440145.1_3 Reverse -11 -30 -5.11376 0.258
NP_440145.1_3 Forward -198 -179 -5.80207 0.279
NP_442542.1_2 Forward -190 -177 7.88576 0.168
NP_442050.1_5 Forward -190 -180 15.9091 0.0091
NP_442050.1_5 Reverse -177 -187 14.3359 0.0206
NP_442739.1_2 Forward -23 -4 11.1342 0.248
NP_440558.1_2 Forward -197 -178 -2.36049 0.226
NP_442576.1_2 Forward -70 -51 10.5209 0.242
NP_441878.1_6 Forward -189 -179 10.5014 0.0176
NP_441878.1_6 Reverse -178 -188 10.4031 0.0176
NP_441878.1_6 Reverse -102 -112 -7.68978 0.255
NP_441036.1_8 Forward -189 -179 15.713 0.00724
NP_441036.1_8 Reverse -178 -188 8.33817 0.174
NP_441557.1_5 Forward -188 -179 19.9609 0.000699
NP_441557.1_5 Reverse -179 -188 19.9609 0.000699
NP_441445.1_1 Forward -197 -178 1.17943 0.259
NP_441590.1_4 Reverse -242 -261 4.52188 0.286
NP_442066.2_9 Reverse -175 -188 20.0788 0.00699
NP_441224.1_2 Reverse -361 -379 17.1287 0.109
NP_440101.1_3 Forward -193 -174 1.67108 0.269
NP_440101.1_10 Forward -261 -242 11.8975 0.137
NP_440101.1_10 Reverse -381 -400 3.53937 0.236
NP_442192.1_5 Forward -83 -64 7.07928 0.292
NP_442166.1_7 Reverse -180 -194 10.6193 0.19
NP_441819.1_2 Forward -86 -67 16.5674 0.27
NP_441574.1_1 Forward -267 -248 -5.21209 0.26
NP_441549.1_9 Reverse -175 -193 14.6705 0.0304
NP_442347.1_2 Forward -187 -178 12.4878 0.056
NP_442347.1_2 Reverse -180 -189 3.34298 0.284
NP_442645.1_2 Reverse -171 -190 -22.0267 0.29
NP_441037.1_4 Forward -190 -180 7.22024 0.237
NP_441633.1_3 Reverse -177 -190 3.36254 0.0699
NP_441633.1_3 Forward -190 -177 -3.71729 0.177
NP_441633.1_3 Forward -382 -369 -5.09393 0.223
NP_440136.1_2 Forward -187 -180 15.9687 0.0123
NP_440136.1_2 Reverse -180 -187 15.9687 0.0123
NP_442998.1_5 Forward -85 -75 12.4681 0.169
NP_442998.1_5 Forward -171 -161 8.53483 0.261
NP_442998.1_10 Forward -186 -179 15.5754 0.0102
NP_442998.1_10 Reverse -181 -188 15.5754 0.0102
NP_440899.1_8 Reverse -65 -84 -9.44032 0.262
NP_440299.1_1 Reverse -175 -188 10.9334 0.0529
NP_440299.1_1 Forward -192 -179 7.39353 0.113
NP_440299.1_1 Reverse -228 -241 4.14862 0.217
NP_441799.1_1 Forward -192 -178 15.6336 0.0172
NP_441799.1_1 Reverse -175 -189 14.5519 0.0228
NP_441007.1_10 Forward -193 -180 1.39592 0.203
NP_441007.1_10 Reverse -174 -187 1.29759 0.203
NP_442201.1_10 Forward -199 -180 -6.58872 0.184
NP_440256.1_1 Reverse -176 -195 8.06259 0.0239
NP_440256.1_1 Forward -191 -172 -6.29373 0.207
NP_440709.1_1 Forward -59 -40 5.70185 0.163
NP_441559.1_8 Forward -193 -179 8.65272 0.0676
NP_441559.1_8 Reverse -174 -188 -5.90027 0.271
NP_441559.1_8 Forward -204 -190 -7.57189 0.295
NP_440915.1_6 Reverse -175 -189 9.73436 0.039
NP_440915.1_6 Forward -192 -178 7.86607 0.0637
NP_440997.1_4 Forward -296 -277 11.3075 0.276
NP_441296.1_9 Reverse -254 -267 11.2284 0.232
NP_442785.1_7 Forward -190 -176 11.2093 0.228
NP_441464.1_1 Forward -192 -173 10.4225 0.24
NP_440026.1_7 Forward -193 -178 16.6962 0.159
NP_440695.1_5 Reverse -179 -198 0.58944 0.284
NP_441939.1_3 Reverse -180 -199 11.3075 0.114
NP_442386.1_9 Reverse -178 -187 13.8639 0.0289
NP_442386.1_9 Forward -189 -180 6.39082 0.219
NP_441404.1_7 Forward -34 -15 10.2259 0.197
NP_442054.1_3 Reverse -233 -252 -5.21209 0.297
NP_441291.1_7 Reverse -268 -287 21.4356 0.0282
NP_441340.1_5 Forward -187 -180 15.6737 0.0124
NP_441340.1_5 Reverse -180 -187 15.6737 0.0124
NP_441340.1_5 Reverse -372 -379 4.07068 0.239
NP_442327.1_3 Reverse -148 -167 5.58586 0.276
NP_442484.1_2 Reverse -168 -187 5.89931 0.159
NP_439976.1_4 Forward -393 -374 7.27514 0.278
NP_442506.1_2 Reverse -168 -187 3.14605 0.278
NP_442240.1_2 Reverse -180 -199 -10.6203 0.137
NP_440586.1_8 Forward -187 -180 13.2151 0.026
NP_440586.1_8 Reverse -180 -187 13.2151 0.026
NP_442251.1_6 Forward -187 -180 15.2804 0.0124
NP_442251.1_6 Reverse -180 -187 15.2804 0.0124
NP_442251.1_6 Forward -29 -22 8.20058 0.23
NP_442251.1_6 Reverse -203 -210 8.10225 0.245
NP_442959.1_5 Forward -82 -63 5.30933 0.287
NP_441262.1_3 Reverse -179 -186 14.7888 0.0223
NP_441262.1_3 Forward -188 -181 14.7888 0.0223
NP_443051.1_1 Forward -189 -180 19.5676 0.00335
NP_443051.1_1 Reverse -178 -187 10.4228 0.00754
NP_439937.1_9 Forward -353 -336 -12.0565 0.269
NP_441595.1_2 Forward -78 -65 8.94252 0.278
NP_440439.1_1 Forward -191 -178 10.934 0.0339
NP_440439.1_1 Reverse -176 -189 1.59258 0.148
NP_439943.1_7 Reverse -174 -193 13.8641 0.0929
NP_440372.1_2 Forward -187 -180 16.3621 0.0124
NP_440372.1_2 Reverse -180 -187 16.3621 0.0124
NP_440372.1_2 Reverse -372 -379 4.07068 0.262
NP_440372.1_3 Forward -77 -63 13.094 0.274
NP_441572.1_7 Forward -194 -175 -2.75381 0.2
NP_441572.1_7 Reverse -173 -192 -3.83545 0.22
NP_440267.1_2 Forward -193 -179 19.5668 0.0168
NP_442384.1_10 Forward -188 -175 19.2922 0.00338
NP_442384.1_10 Reverse -179 -192 17.9155 0.00564
NP_441877.1_9 Reverse -48 -65 4.16874 0.284
NP_441018.1_7 Reverse -175 -194 10.8159 0.194
NP_442262.1_10 Forward -187 -180 14.1988 0.0123
NP_442262.1_10 Reverse -180 -187 14.1988 0.0123
NP_442262.1_10 Forward -379 -372 11.4455 0.102
NP_441689.1_5 Forward -190 -180 8.3377 0.132
NP_441689.1_5 Reverse -177 -187 5.78111 0.197
NP_440282.1_10 Forward -198 -179 -8.85033 0.266
NP_441965.1_10 Reverse -176 -192 8.71166 0.123
NP_441965.1_10 Forward -191 -175 1.92682 0.297
NP_442693.1_6 Forward -194 -175 1.57275 0.278
NP_440297.1_9 Forward -187 -177 -0.118297 0.282
NP_440297.1_9 Reverse -180 -190 -0.216628 0.282
NP_440894.1_7 Reverse -234 -253 8.06178 0.292
NP_440999.1_9 Forward -215 -201 2.16287 0.154
NP_440999.1_9 Forward -192 -178 0.687908 0.177
NP_440999.1_9 Reverse -175 -189 -3.34366 0.291
NP_440888.1_2 Forward -188 -174 15.1419 0.0122
NP_440888.1_2 Reverse -179 -193 15.1419 0.0122
NP_442277.1_4 Forward -197 -178 2.06362 0.256
NP_441543.1_2 Forward -187 -178 16.9127 0.00359
NP_441543.1_2 Reverse -180 -189 15.9293 0.00518
NP_442845.1_2 Reverse -173 -187 5.89945 0.22
NP_441551.1_5 Reverse -175 -191 6.44936 0.269
NP_442710.1_7 Forward -60 -41 1.61936 0.169
NP_441469.1_8 Forward -189 -180 6.5879 0.227
NP_441469.1_8 Reverse -178 -187 6.48957 0.227
NP_443064.1_6 Forward -188 -178 12.5669 0.0796
NP_443064.1_6 Reverse -179 -189 10.8217 0.13
NP_442578.1_7 Forward -187 -180 14.5921 0.026
NP_442578.1_7 Reverse -180 -187 14.5921 0.026
NP_440710.1_1 Forward -196 -178 1.49411 0.135
NP_441462.1_2 Reverse -179 -189 20.2362 0.000805
NP_441462.1_2 Forward -188 -178 11.5831 0.00406
NP_441621.1_7 Reverse -177 -191 -5.21195 0.248
NP_443062.1_1 Reverse -179 -197 16.3465 0.031
NP_443062.1_1 Forward -188 -170 10.4961 0.116
NP_443062.1_6 Reverse -171 -190 1.67108 0.271
NP_441410.1_3 Forward -197 -178 11.2092 0.185
NP_442204.1_1 Forward -192 -181 11.3667 0.0565
NP_442204.1_2 Forward -198 -179 10.8159 0.223
NP_442780.1_3 Reverse -157 -176 6.73176 0.269
NP_440454.1_2 Forward -80 -66 10.4202 0.291
NP_440516.1_2 Reverse -173 -191 -2.14413 0.298
NP_440516.1_8 Forward -188 -179 16.9127 0.00442
NP_440516.1_8 Reverse -179 -188 16.9127 0.00442
NP_442428.1_5 Forward -187 -180 15.8704 0.0124
NP_442428.1_5 Reverse -180 -187 15.8704 0.0124
NP_441068.1_2 Forward -390 -371 11.7008 0.229
NP_442823.1_4 Reverse -373 -392 18.289 0.18
NP_440673.1_3 Forward -186 -179 12.4288 0.0426
NP_440673.1_3 Reverse -181 -188 12.4288 0.0426
NP_440673.1_3 Forward -378 -371 11.3472 0.085
NP_441052.1_2 Forward -188 -178 19.9412 0.00106
NP_441052.1_2 Reverse -179 -189 10.4031 0.0285
NP_442219.1_9 Forward -187 -178 17.7976 0.00718
NP_442219.1_9 Reverse -180 -189 8.25953 0.0681
NP_440436.1_4 Forward -187 -178 17.2072 0.00233
NP_440436.1_4 Reverse -180 -189 9.24241 0.0871
NP_442086.1_3 Reverse -180 -199 5.70265 0.288
NP_440314.1_9 Forward -187 -168 10.0292 0.0293
NP_440314.1_9 Forward -230 -211 -9.83364 0.278
NP_442577.1_10 Reverse -294 -313 10.815 0.216
NP_441719.1_4 Forward -187 -180 16.3621 0.0124
NP_441719.1_4 Reverse -180 -187 16.3621 0.0124
NP_441115.1_4 Reverse -178 -196 10.3431 0.181
NP_441115.1_4 Forward -189 -171 8.57317 0.244
NP_440728.1_1 Forward -81 -62 14.2566 0.216
NP_441851.1_10 Reverse -178 -188 15.8113 0.00552
NP_441851.1_10 Forward -189 -179 8.53483 0.114
NP_441851.1_10 Forward -381 -371 3.91327 0.296
NP_441555.1_5 Reverse -154 -173 15.6332 0.245
NP_442011.1_1 Reverse -178 -197 6.09597 0.186
NP_442515.1_1 Forward -189 -175 11.701 0.0388
NP_442515.1_1 Reverse -178 -192 -4.7203 0.298
NP_441982.1_6 Forward -172 -163 12.6763 0.274
NP_440165.1_5 Reverse -178 -197 1.27776 0.128
NP_442709.1_3 Reverse -172 -191 7.86593 0.121
NP_442709.1_4 Reverse -41 -60 8.65445 0.161
NP_441046.1_2 Reverse -168 -187 1.17943 0.26
NP_442689.1_8 Reverse -65 -82 -5.27103 0.27
NP_441349.1_10 Forward -198 -179 0.786102 0.0864
NP_441409.1_6 Reverse -173 -192 2.3594 0.0584
NP_440432.1_9 Reverse -180 -195 -3.06836 0.179
NP_440432.1_9 Forward -187 -172 -4.93665 0.228
NP_442843.1_1 Reverse -372 -391 0.392778 0.17
NP_442843.1_6 Reverse -163 -182 2.16274 0.29
NP_441124.1_5 Reverse -58 -68 13.3901 0.215
NP_441124.1_5 Forward -171 -161 12.4352 0.221
NP_441124.1_5 Reverse -155 -165 10.0479 0.298
NP_440431.1_3 Forward -189 -170 3.24438 0.0923
NP_441031.1_1 Forward -61 -42 8.17242 0.25
NP_441570.1_1 Reverse -179 -197 -1.65248 0.0583
NP_441078.1_4 Forward -188 -179 19.6659 0.0007
NP_441078.1_4 Reverse -179 -188 19.6659 0.0007
NP_442729.1_8 Reverse -175 -188 10.639 0.125
NP_441663.1_8 Forward -194 -175 4.12936 0.169
NP_440526.1_3 Forward -187 -176 1.04151 0.267
NP_441432.1_8 Reverse -178 -187 16.8143 0.00595
NP_441432.1_8 Forward -189 -180 16.8143 0.00595
NP_441432.1_9 Reverse -164 -177 9.18011 0.28
NP_441432.1_9 Reverse -57 -70 8.79228 0.287
NP_442320.1_8 Reverse -173 -187 -2.36035 0.0871
NP_441732.1_2 Forward -192 -176 -6.7263 0.0495
NP_441732.1_2 Reverse -198 -214 -17.2477 0.247
NP_440629.1_4 Forward -181 -162 11.7992 0.217
NP_442003.1_4 Forward -187 -168 9.24257 0.3
NP_440760.1_1 Forward -188 -169 -2.75381 0.0332
NP_442510.1_5 Reverse -170 -189 12.9791 0.248
NP_440913.1_1 Reverse -177 -195 8.47561 0.183
NP_442400.1_10 Forward -176 -163 9.99293 0.269
NP_440713.1_4 Forward -198 -179 7.86593 0.174
NP_442489.1_7 Forward -188 -179 20.1576 0.000695
NP_442489.1_7 Reverse -179 -188 20.1576 0.000695
NP_442489.1_7 Reverse -202 -211 -1.86856 0.259
NP_442079.1_7 Forward -187 -168 4.71934 0.187
NP_442079.1_7 Reverse -180 -199 2.3594 0.229
NP_440559.1_1 Forward -187 -178 17.4043 0.00658
NP_440559.1_1 Reverse -372 -381 10.5211 0.0586
NP_440559.1_1 Reverse -180 -189 8.65285 0.0586
NP_441659.2_8 Reverse -179 -189 20.9245 0.000805
NP_441659.2_8 Forward -188 -178 18.1713 0.00133
NP_440426.1_7 Forward -198 -179 3.14605 0.207
NP_442913.1_10 Forward -197 -178 4.52268 0.0864
NP_439956.1_7 Reverse -173 -192 3.83436 0.257
NP_442008.1_2 Reverse -176 -195 5.89931 0.223
NP_442776.1_1 Reverse -168 -187 2.94938 0.294
NP_442346.1_5 Reverse -178 -188 16.6963 0.00248
NP_442346.1_5 Forward -189 -179 16.303 0.00248
NP_440545.1_3 Forward -192 -175 -1.43612 0.168
NP_440545.1_3 Reverse -175 -192 -4.58271 0.229
NP_441856.1_3 Forward -214 -195 5.99764 0.124
NP_441856.1_3 Reverse -176 -195 3.83436 0.17
NP_441856.1_3 Forward -191 -172 1.67108 0.212
NP_440250.1_3 Reverse -226 -245 14.2566 0.23
NP_440250.1_4 Reverse -31 -50 2.9486 0.277
NP_440459.1_2 Forward -276 -259 8.29864 0.266
NP_441653.1_2 Forward -199 -180 9.81081 0.141
NP_442603.1_7 Forward -188 -174 16.9119 0.0273
NP_440449.1_6 Forward -113 -95 6.31057 0.255
NP_441948.1_4 Forward -195 -177 4.73903 0.0894
NP_441833.1_4 Forward -187 -180 15.9687 0.0124
NP_441833.1_4 Reverse -180 -187 15.9687 0.0124
NP_441895.1_10 Reverse -374 -393 -27.8282 0.299
NP_442162.1_9 Forward -187 -180 16.2637 0.0124
NP_442162.1_9 Reverse -180 -187 16.2637 0.0124
NP_442162.1_9 Forward -379 -372 9.28223 0.0694
NP_443015.1_8 Forward -137 -123 17.4247 0.235
NP_440671.1_1 Reverse -48 -67 3.73847 0.296
NP_440224.1_1 Forward -199 -180 9.0459 0.0617
NP_441973.1_6 Reverse -54 -72 15.6609 0.27
NP_442943.1_1 Forward -68 -53 15.8342 0.0725
NP_442943.1_1 Forward -175 -160 10.6662 0.184
NP_442943.1_1 Reverse -160 -175 4.54118 0.231
NP_442199.1_5 Forward -196 -177 -0.0988766 0.175
NP_442140.1_3 Forward -187 -177 10.3048 0.0902
NP_442140.1_3 Reverse -180 -190 4.69992 0.238
NP_441609.1_1 Reverse -161 -180 0.884433 0.205
NP_440875.1_9 Reverse -181 -191 16.5483 0.0145
NP_441813.1_5 Reverse -177 -187 18.1713 0.00743
NP_441813.1_5 Forward -190 -180 18.1713 0.00743
NP_441813.1_5 Forward -382 -372 4.40493 0.159
NP_440594.1_8 Forward -187 -174 12.2117 0.152
NP_440590.1_4 Forward -187 -174 11.7207 0.0187
NP_440590.1_4 Reverse -180 -193 -5.38892 0.277
NP_440567.1_1 Reverse -180 -194 9.83269 0.0414
NP_442497.1_10 Reverse -180 -189 17.601 0.00813
NP_442497.1_10 Forward -187 -178 10.4228 0.0087
NP_440821.1_4 Reverse -177 -187 9.41981 0.0286
NP_440821.1_4 Forward -190 -180 2.24165 0.131
NP_441239.1_9 Forward -190 -178 13.0187 0.0389
NP_441239.1_9 Reverse -177 -189 5.25052 0.223
NP_440624.1_5 Reverse -53 -71 6.60692 0.298
NP_442044.1_1 Forward -193 -174 -14.0619 0.283
NP_440219.1_1 Reverse -54 -73 13.2234 0.255
NP_442643.1_1 Reverse -173 -192 -11.7019 0.231
NP_440833.1_6 Forward -169 -155 9.53707 0.261
NP_440876.1_5 Forward -186 -167 8.55425 0.277
NP_442138.1_10 Reverse -179 -198 1.86774 0.12
NP_442809.1_6 Forward -144 -125 3.83436 0.256
NP_440546.1_4 Reverse -179 -189 13.5365 0.0459
NP_440546.1_4 Forward -188 -178 10.046 0.109
NP_440462.1_6 Forward -190 -180 18.7612 0.00454
NP_440462.1_6 Reverse -177 -187 9.61647 0.0429
NP_442611.1_1 Reverse -179 -198 5.40766 0.179
NP_440868.1_4 Forward -192 -180 15.0836 0.0164
NP_440868.1_4 Reverse -175 -187 9.97041 0.0405
NP_441497.1_5 Reverse -3 -22 18.1493 0.248
NP_442479.1_5 Reverse -161 -180 10.7488 0.222
NP_442479.1_9 Forward -252 -233 -4.22878 0.25
NP_441848.1_4 Forward -80 -64 11.4658 0.224
NP_441848.1_4 Forward -151 -135 8.79206 0.288
NP_441848.1_4 Reverse -3 -19 8.79206 0.288
NP_441848.1_5 Reverse -56 -75 14.9314 0.214
NP_441084.1_6 Forward -190 -176 13.4163 0.133
NP_442882.1_7 Forward -195 -181 10.9137 0.272
NP_442039.1_4 Forward -187 -180 15.1821 0.0124
NP_442039.1_4 Reverse -180 -187 15.1821 0.0124
NP_442039.1_7 Forward -174 -164 11.8781 0.257
NP_442837.1_3 Forward -187 -180 15.7721 0.0124
NP_442837.1_3 Reverse -180 -187 15.7721 0.0124
NP_440160.1_5 Forward -184 -174 15.0242 0.267
NP_442053.1_1 Forward -188 -179 18.3876 0.0007
NP_442053.1_1 Reverse -179 -188 18.3876 0.0007
NP_440505.1_3 Reverse -177 -187 18.3679 0.00213
NP_440505.1_3 Forward -190 -180 17.188 0.00332
NP_441203.1_1 Reverse -180 -199 -14.8485 0.205
NP_442532.1_3 Reverse -59 -78 15.8609 0.294
NP_442532.1_4 Reverse -53 -71 9.12842 0.273
NP_441576.1_10 Reverse -149 -168 12.1925 0.289
NP_440914.1_1 Forward -188 -178 17.5935 0.000537
NP_440914.1_1 Reverse -179 -189 16.3248 0.00196
NP_440914.1_1 Reverse -371 -381 7.93196 0.214
NP_441011.1_8 Reverse -180 -189 16.6177 0.00602
NP_441011.1_8 Forward -187 -178 8.25953 0.144
NP_442533.1_2 Reverse -360 -378 22.1428 0.0764
NP_442533.1_6 Forward -188 -179 17.2076 0.00137
NP_442533.1_6 Reverse -179 -188 17.2076 0.00137
NP_442322.1_2 Reverse -301 -320 13.47 0.229
NP_441482.1_7 Forward -194 -180 -2.85201 0.1
NP_441482.1_7 Reverse -185 -199 -10.8168 0.216
NP_441482.1_7 Reverse -173 -187 -12.3901 0.295
NP_439944.1_9 Forward -187 -177 10.5014 0.0887
NP_439944.1_9 Reverse -180 -190 9.12481 0.1
NP_442597.1_9 Reverse -60 -79 15.7065 0.284
NP_441697.1_5 Reverse -52 -71 -8.54695 0.263
NP_441697.1_5 Reverse -53 -72 -9.02441 0.268
NP_441697.1_5 Forward -60 -41 -11.4117 0.295
NP_441028.1_6 Reverse -77 -87 4.89613 0.275
NP_442202.1_6 Forward -240 -221 -0.000545616 0.265
NP_442202.1_6 Forward -82 -63 -1.27885 0.272
NP_440116.1_8 Reverse -180 -199 1.67108 0.0915
NP_440116.1_8 Forward -187 -168 -5.99873 0.2
NP_441527.1_4 Forward -82 -63 -12.1756 0.285
NP_441527.1_4 Forward -73 -54 -12.6531 0.292
NP_441527.1_4 Forward -83 -64 -13.0351 0.298
NP_441527.1_5 Forward -190 -171 12.4059 0.297
NP_440115.1_6 Forward -191 -181 14.0414 0.0615
NP_440115.1_6 Reverse -176 -186 6.76487 0.167
NP_440115.1_6 Reverse -368 -378 6.66654 0.172
NP_440007.1_9 Forward -192 -178 7.17775 0.213
NP_442562.1_4 Forward -285 -266 11.7008 0.117
NP_441602.1_3 Reverse -174 -193 -4.22878 0.261
NP_441972.1_5 Reverse -180 -199 -4.6221 0.211
NP_441972.1_5 Forward -187 -168 -6.29373 0.229
NP_441972.1_5 Forward -199 -180 -8.45701 0.265
NP_441106.1_1 Forward -189 -180 18.486 0.0028
NP_441106.1_1 Reverse -178 -187 9.63616 0.0311
NP_442306.1_10 Forward -193 -174 -20.2567 0.202
NP_441286.1_1 Reverse -178 -190 5.93884 0.0258
NP_441286.1_1 Forward -189 -177 3.48056 0.0467
NP_441286.1_1 Forward -381 -369 -5.95921 0.235
NP_442674.1_1 Forward -179 -160 14.6387 0.204
NP_442674.1_2 Forward -236 -217 10.0292 0.208
NP_442674.1_2 Reverse -155 -174 7.96426 0.262
NP_442674.1_3 Forward -194 -175 2.26028 0.3
NP_440670.1_8 Forward -188 -179 18.3876 0.000699
NP_440670.1_8 Reverse -179 -188 18.3876 0.000699
NP_441479.1_1 Reverse -176 -195 7.7676 0.278
NP_440886.1_7 Forward -189 -179 8.04271 0.0805
NP_440886.1_7 Reverse -178 -188 7.94438 0.0805
NP_442614.1_2 Forward -188 -174 9.04604 0.242
NP_442614.1_2 Reverse -179 -193 8.25939 0.255
NP_442382.1_9 Reverse -298 -317 10.1267 0.281
NP_442072.1_9 Reverse -178 -196 -11.5839 0.0789
NP_440513.1_4 Reverse -179 -198 8.75091 0.295
NP_439899.1_1 Reverse -47 -65 3.79798 0.284
NP_439899.1_1 Reverse -37 -55 3.31129 0.3
NP_440907.2_8 Reverse -180 -190 9.616 0.103
NP_440907.2_8 Forward -379 -369 4.99446 0.228
NP_441021.1_1 Forward -187 -168 1.27776 0.0848
NP_441463.1_2 Reverse -65 -83 2.10063 0.242
NP_441463.1_2 Reverse -55 -73 1.04342 0.261
NP_441463.1_2 Reverse -45 -63 -1.35932 0.293
NP_441463.1_3 Forward -198 -179 -2.55715 0.156
NP_441463.1_3 Reverse -169 -188 -8.55534 0.271
NP_442842.1_4 Reverse -350 -369 5.211 0.247
NP_441626.1_2 Forward -187 -180 15.7721 0.0124
NP_441626.1_2 Reverse -180 -187 15.7721 0.0124
NP_441626.1_4 Forward -282 -263 14.7491 0.167
NP_442365.1_7 Reverse -175 -194 3.44104 0.156
NP_442794.1_1 Reverse -175 -187 7.31547 0.142
NP_442615.1_1 Forward -197 -179 20.5703 0.00395
NP_442615.1_1 Reverse -170 -188 -4.99573 0.201
NP_440387.1_1 Reverse -179 -195 -1.3181 0.142
NP_440387.1_1 Forward -188 -172 -3.18639 0.156
NP_441431.1_2 Forward -191 -177 6.68548 0.263
NP_441836.1_2 Forward -194 -175 4.03102 0.147
NP_441836.1_2 Reverse -173 -192 3.83436 0.147
NP_442084.1_6 Forward -46 -28 7.09898 0.221
NP_440467.1_3 Reverse -180 -199 17.6042 0.0604
NP_440467.1_3 Forward -199 -180 15.8463 0.114
NP_440114.1_10 Reverse -179 -193 9.04604 0.186
NP_440114.1_10 Reverse -96 -110 8.45605 0.202
NP_442437.1_8 Reverse -180 -199 4.916 0.256
NP_440725.1_4 Reverse -266 -285 2.55606 0.189
NP_442087.1_2 Forward -188 -169 13.2118 0.257
NP_440766.1_5 Forward -173 -161 15.0087 0.193
NP_442743.1_1 Reverse -255 -274 5.40686 0.273
NP_442743.1_4 Reverse -180 -199 -3.3438 0.227
NP_441311.1_2 Forward -194 -180 14.1586 0.229
NP_442930.1_1 Forward -71 -61 16.9908 0.19
NP_442930.1_1 Forward -125 -115 10.4026 0.276
NP_442930.1_1 Forward -167 -157 9.81266 0.28
NP_439910.1_2 Reverse -171 -188 -12.8425 0.103
NP_440457.1_1 Forward -192 -180 10.2654 0.092
NP_440457.1_1 Reverse -175 -187 -0.74767 0.273
NP_440987.1_4 Forward -82 -63 13.0775 0.143
NP_440798.1_6 Reverse -180 -193 10.8357 0.0721
NP_442297.1_4 Forward -192 -173 14.9613 0.181
NP_441332.1_4 Forward -72 -53 15.9291 0.149
NP_441332.1_4 Forward -179 -160 14.4541 0.149
NP_440473.1_1 Forward -191 -172 15.2101 0.124
NP_442509.1_9 Forward -188 -178 8.14104 0.192
NP_442509.1_9 Reverse -179 -189 8.04271 0.192
NP_441489.1_3 Forward -173 -159 10.4202 0.232
NP_442514.1_5 Forward -196 -177 -5.70449 0.261
NP_441440.1_6 Reverse -334 -352 19.292 0.0882
NP_440554.1_4 Reverse -180 -190 17.9746 0.0131
NP_440554.1_4 Forward -187 -177 8.92815 0.0646
NP_441845.1_6 Reverse -167 -185 0.0191479 0.274
NP_441885.1_5 Forward -188 -178 20.9245 0.000538
NP_441885.1_5 Reverse -179 -189 11.3864 0.00668
NP_440628.1_3 Forward -170 -156 15.4376 0.262
NP_440478.1_4 Reverse -187 -206 10.0292 0.293
NP_440478.1_10 Forward -190 -176 6.6861 0.288
NP_441173.1_9 Reverse -164 -172 13.2937 0.17
NP_440750.1_5 Forward -82 -68 4.81781 0.294
NP_443000.1_7 Forward -190 -180 20.3345 0.00223
NP_443000.1_7 Reverse -177 -187 19.9412 0.00223
NP_440275.1_3 Forward -190 -180 16.1063 0.0155
NP_440275.1_3 Reverse -177 -187 15.123 0.0182
NP_442932.1_9 Forward -256 -237 3.44104 0.298
NP_440127.1_5 Reverse -359 -377 10.1472 0.288
NP_441207.1_7 Forward -82 -68 11.9662 0.241
NP_441207.1_7 Forward -169 -155 8.96496 0.282
NP_441105.1_3 Forward -199 -180 -6.98204 0.243
NP_440216.1_1 Reverse -179 -193 26.254 0.000481
NP_440216.1_1 Forward -188 -174 -0.787057 0.0284
NP_440172.1_1 Reverse -179 -189 17.5813 0.00421
NP_440172.1_1 Forward -188 -178 15.0247 0.00945
NP_440172.1_1 Forward -380 -370 2.7333 0.268
NP_440172.1_1 Reverse -191 -201 2.7333 0.268
NP_440172.1_1 Forward -211 -201 2.63497 0.274
NP_442015.1_10 Forward -192 -179 3.75586 0.178
NP_442015.1_10 Reverse -175 -188 2.67422 0.187
NP_441226.1_7 Forward -187 -180 14.4934 0.0123
NP_441226.1_7 Reverse -180 -187 14.4934 0.0123
NP_441757.1_3 Reverse -178 -197 3.6377 0.155
NP_441111.1_7 Forward -187 -179 18.7023 0.00294
NP_441111.1_7 Reverse -180 -188 18.7023 0.00294
NP_442379.1_10 Forward -195 -178 0.137172 0.223
NP_441766.1_2 Forward -188 -179 17.5026 0.00297
NP_441766.1_2 Reverse -179 -188 17.5026 0.00297
NP_441766.1_2 Forward -380 -371 3.24465 0.227
NP_442417.1_5 Reverse -179 -193 4.52282 0.292
NP_440416.1_9 Forward -195 -176 3.34271 0.0375
NP_440416.1_9 Reverse -184 -203 -16.9135 0.226
NP_442116.1_6 Forward -81 -64 11.4157 0.198
NP_442116.1_6 Forward -79 -62 6.06813 0.287
NP_440261.1_5 Reverse -180 -193 6.60746 0.0318
NP_440261.1_5 Forward -187 -174 5.03416 0.0478
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCAGATGCAACACCAAGTCTTCCGATTGCTCCAAAATCAGAGAGTCAGCCCGAATTGGCTCCAAAGATAGTTCCGTCGGACTCAGCTTAGTCAATTTAATGGGTCGTCCCAGTAACCAGGCGGCATAGTCTTCGGAAAAGGATTCAGCGAGGAATTTGCAGAGATTGTCAAACATAGCCGAATTCTACTGGTAATCTCCTAGAGATCCGCCAGGCGATCGCCAGAAAATTGGCAAAAATTTAACAAGGTTAGGCGAGGAAAAACCTAGGTCAAAGAACTTATTCACATGGATAGAGCCCATTCTCTGACTTCTATAGGGAAAATCTCAAAAAAAATTCTCAAAAGTTTACAAAGTTTAATATAATCGGAGGAAGATCACTAGGTATTTATTCTTATTACC

CDS

ATGTTGGAACACTTCCCCTGGCTGACAACGATGATTGCCCTGCCGTTAGTCGCCGCCCTCTTCATTCCGTTAATTCCCGACAAAGACGGGAAACAAGTCCGCTGGTATGCCCTTGGTGTGGGTCTAGCGGATTTTGTTTTGATGAGCTACGTTTTTTGGACTAACTACGACATCAGCAGTACCGGTTTTCAGCTCCAGGAAAAATTTAGCTGGATTCCCCAATTTGGGCTCAGTTGGAGTGTTTCCGTGGATGGCATCTCCATGCCCCTAGTGTTACTAGCCGGACTGGTTACCACCCTTTCCATCTTTGCCGCCTGGCAGGTGGACCATAAGCCCCGCCTCTTCTACTTCCTAATGTTGGTGCTTTATGCGGCCCAGATTGGCGTGTTCGTGGCCCAGGACATGCTCCTACTGTTCATCATGTGGGAACTGGAATTGGTACCGGTTTACCTCCTAGTTTGTATCTGGGGTGGCCAAAAACGGCAGTATGCCGCCATGAAGTTTTTGCTCTACACCGCCGCCGCCTCCGTATTCATTTTGGTTGCCGCCCTGGGCTTAGCTTTCTACGGTGATGTAACTACCTTTGACATTGCGGAATTGGGTCTGAAAGATTACCCGATCGCCTTAGAACTGTTTTTATACGCCGGTTTACTTATTGCCTTTGGCGTTAAATTAGCCATTTTCCCTTTCCATACCTGGTTACCCGATGCCCACGGTGAGGCCTCTGCCCCTGTATCCATGATTTTGGCTGGGGTGCTGCTGAAAATGGGCGGTTACGGCCTAATTCGCTTGAACCTTGGTCTGTTGGAAGATGCCCACGTTTACTTTGCCCCTATTTTGGTCATCCTTGGGGTAGTTAACATTATCTACGGTGGTTTCTCCTCCTTTGCCCAGGACAACATGAAGCGCCGCTTGGCCTACTCCTCCGTTTCCCACATGGGCTTTGTGCTCCTCGGTATTGCTTCCTTCACCGATTTGGGCATCAGTGGAGCCATGTTGCAAATGCTTTCCCACGGTTTAATCGCCGCTGTGCTCTTCTTCCTGGCTGGGGTTACCTACGACCGTACCCACACCCTTTCCTTGGCCCAGATGGGTAACATTGGCAAAGTAATGCCCACGGTTTTTGCCCTCTTCACCATGGGTGCTATGGCTTCTTTAGCCTTACCTGGCATGAGCGGTTTTGTGAGTGAATTGGCAGTATTTGTCGGCGTAAGTTCCAGCGACATTTACAGCACTCCTTTTAAAACGGTGACCGTGTTCCTGGCAGCTGTGGGCTTAGTACTCACCCCGATTTACCTGTTGTCCATGTTGCGCCAACTTTTCTACGGCAACAACATTCCCCCTTCTTGCAATCTGGAGCAGGACAATCTGTCTGCTAATTCTGACCAAGAAGCGGTTTGTTTTGGCACCAGTTGTGTGCTCCCCGGCAATGCCATCTATGATGATGCCCGGCCCCGGGAAGTATTCATTGCCGCTTGCTTCCTGTTACCCATCATCGCTGTGGGACTCTATCCCAAGTTGGCCACCCAAACCTACGATGCCACCACGGTAGCGGTGAACAGCCAAGTGCGCCAATCCTACGTGCAAATTGCGGAAACCAATCCCCGGGTCTATGCCGAAGCATTAACTGCTCCCCACATTCCCACCACGGACTTTGCCACCGTCAAAGTTCAACCCTAG

Protein

MLEHFPWLTTMIALPLVAALFIPLIPDKDGKQVRWYALGVGLADFVLMSYVFWTNYDISSTGFQLQEKFSWIPQFGLSWSVSVDGISMPLVLLAGLVTTLSIFAAWQVDHKPRLFYFLMLVLYAAQIGVFVAQDMLLLFIMWELELVPVYLLVCIWGGQKRQYAAMKFLLYTAAASVFILVAALGLAFYGDVTTFDIAELGLKDYPIALELFLYAGLLIAFGVKLAIFPFHTWLPDAHGEASAPVSMILAGVLLKMGGYGLIRLNLGLLEDAHVYFAPILVILGVVNIIYGGFSSFAQDNMKRRLAYSSVSHMGFVLLGIASFTDLGISGAMLQMLSHGLIAAVLFFLAGVTYDRTHTLSLAQMGNIGKVMPTVFALFTMGAMASLALPGMSGFVSELAVFVGVSSSDIYSTPFKTVTVFLAAVGLVLTPIYLLSMLRQLFYGNNIPPSCNLEQDNLSANSDQEAVCFGTSCVLPGNAIYDDARPREVFIAACFLLPIIAVGLYPKLATQTYDATTVAVNSQVRQSYVQIAETNPRVYAEALTAPHIPTTDFATVKVQP