Your browser is old and dusty. Try Google Chrome!

Details for slr1288

ORF slr1288
Accession NP_441614.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -317 -303 8.25939 0.0917
NP_441061.1_2 Forward -93 -79 1.47456 0.188
NP_441061.1_2 Reverse -280 -294 0.88457 0.197
NP_440795.1_10 Forward -348 -329 12.0933 0.242
NP_441418.1_6 Forward -94 -75 -20.65 0.121
NP_441453.1_4 Forward -94 -86 6.80426 0.121
NP_441453.1_4 Reverse -85 -93 6.11594 0.121
NP_441623.1_1 Forward -288 -270 -4.70074 0.275
NP_442151.1_6 Reverse -85 -99 6.98109 0.214
NP_442151.1_6 Reverse -132 -146 5.30946 0.284
NP_440226.1_1 Reverse -85 -104 2.85105 0.249
NP_441465.1_8 Forward -306 -288 7.00065 0.246
NP_440348.1_8 Reverse -268 -287 11.9958 0.295
NP_440150.1_6 Forward -383 -364 6.88262 0.223
NP_440996.1_3 Reverse -290 -308 9.26226 0.281
NP_442287.1_1 Forward -283 -273 14.3359 0.266
NP_443002.1_5 Reverse -356 -374 8.3765 0.297
NP_441721.1_9 Reverse -68 -87 18.1907 0.162
NP_442173.1_1 Reverse -86 -94 12.0158 0.0316
NP_442173.1_1 Forward -93 -85 10.7375 0.0611
NP_001035873.1_7 Forward -272 -253 15.8307 0.254
NP_442752.1_4 Forward -94 -87 13.8055 0.0199
NP_442752.1_4 Reverse -309 -316 9.47889 0.109
NP_443027.1_4 Reverse -83 -93 5.97822 0.294
NP_443027.1_4 Forward -96 -86 5.78156 0.298
NP_439997.1_4 Reverse -288 -307 7.27595 0.266
NP_441812.1_3 Reverse -137 -151 9.63603 0.239
NP_441225.1_3 Reverse -20 -39 13.7658 0.171
NP_440784.1_7 Forward -237 -230 10.2655 0.0801
NP_440784.1_7 Forward -93 -86 6.23397 0.241
NP_440784.1_7 Reverse -86 -93 6.13563 0.241
NP_441054.1_1 Reverse -302 -316 15.0442 0.212
NP_441054.1_2 Forward -373 -354 9.24257 0.299
NP_442062.1_8 Forward -94 -84 9.32148 0.0633
NP_440761.1_4 Forward -99 -80 -13.1769 0.257
NP_441900.1_2 Reverse -231 -249 -4.01314 0.288
NP_440304.1_4 Forward -96 -86 9.22315 0.06
NP_440304.1_4 Reverse -227 -237 6.27322 0.167
NP_440304.1_4 Reverse -380 -390 2.04498 0.299
NP_440011.1_1 Reverse -277 -296 12.0942 0.265
NP_439918.1_2 Reverse -274 -293 -3.3438 0.253
NP_441208.1_1 Reverse -273 -292 -0.295539 0.25
NP_441594.1_6 Reverse -232 -251 7.86593 0.169
NP_442110.1_7 Forward -234 -220 1.57289 0.222
NP_442726.1_1 Forward -222 -203 12.2908 0.179
NP_440330.1_2 Forward -377 -358 9.24257 0.297
NP_441083.1_5 Reverse -85 -95 0.668351 0.22
NP_441083.1_5 Forward -94 -84 -0.904945 0.283
NP_441738.1_2 Reverse -87 -94 15.28 0.0102
NP_441558.1_5 Forward -143 -124 5.80098 0.24
NP_441558.1_7 Forward -285 -266 9.24257 0.276
NP_440209.1_1 Forward -94 -86 8.57422 0.0425
NP_442889.1_8 Reverse -89 -103 3.63724 0.273
NP_441713.1_1 Forward -100 -81 -12.6852 0.248
NP_441327.1_5 Reverse -26 -35 14.356 0.192
NP_441598.1_3 Forward -294 -275 11.606 0.292
NP_442111.1_4 Forward -95 -81 3.93283 0.226
NP_440343.1_3 Reverse -357 -375 17.9146 0.0832
NP_440343.1_9 Forward -374 -355 10.1275 0.248
NP_440906.1_5 Forward -93 -86 6.23397 0.234
NP_440906.1_5 Reverse -86 -93 6.13563 0.241
NP_440747.1_1 Reverse -27 -45 7.39397 0.251
NP_440747.1_10 Reverse -82 -94 -11.9574 0.178
NP_441130.1_10 Reverse -83 -97 7.27608 0.164
NP_442145.1_3 Reverse -21 -40 5.11266 0.267
NP_442634.1_4 Forward -96 -82 5.30946 0.0612
NP_442848.1_5 Reverse -237 -255 -3.52077 0.293
NP_441012.1_4 Reverse -221 -234 16.0472 0.158
NP_443018.1_3 Reverse -86 -93 11.7405 0.0655
NP_443018.1_3 Forward -93 -86 5.44732 0.193
NP_443018.1_3 Reverse -230 -237 4.26735 0.267
NP_443018.1_3 Forward -237 -230 4.16902 0.278
NP_441316.1_7 Reverse -83 -98 -2.28172 0.248
NP_441634.1_8 Reverse -307 -321 -2.55701 0.295
NP_441634.1_8 Reverse -227 -241 -2.55701 0.295
NP_441634.1_8 Reverse -233 -247 -4.13031 0.295
NP_440376.1_1 Forward -94 -85 5.99792 0.111
NP_440376.1_1 Reverse -273 -282 1.96635 0.236
NP_440376.1_1 Reverse -85 -94 -0.196935 0.285
NP_441857.1_6 Reverse -272 -282 15.0247 0.215
NP_441588.1_4 Reverse -87 -97 6.66654 0.185
NP_442730.1_8 Forward -314 -295 5.80018 0.239
NP_442687.1_7 Forward -113 -103 4.3066 0.255
NP_442191.1_4 Forward -237 -223 10.7022 0.288
NP_442485.1_3 Reverse -233 -252 0.687771 0.237
NP_442485.1_3 Forward -243 -224 -3.24547 0.272
NP_441846.1_10 Reverse -11 -30 -20.8467 0.256
NP_440642.1_10 Forward -33 -19 9.14375 0.197
NP_441013.1_2 Reverse -218 -236 5.42735 0.218
NP_441013.1_3 Forward -234 -215 9.14423 0.233
NP_440360.1_5 Reverse -355 -374 0.687771 0.297
NP_442658.1_1 Reverse -227 -237 11.091 0.0944
NP_442658.1_1 Forward -96 -86 6.17443 0.235
NP_441414.1_9 Forward -94 -75 -9.24366 0.256
NP_440800.1_7 Reverse -115 -129 11.3077 0.276
NP_440607.1_8 Reverse -7 -26 5.30933 0.209
NP_441487.1_9 Reverse -224 -243 -3.24547 0.298
NP_442937.1_5 Reverse -230 -249 8.16093 0.231
NP_442937.1_5 Reverse -298 -317 7.7676 0.241
NP_442321.1_4 Forward -48 -29 -8.752 0.29
NP_441958.1_5 Forward -95 -85 9.81313 0.0174
NP_440180.1_1 Reverse -227 -246 17.699 0.179
NP_441127.1_1 Reverse -229 -243 14.2576 0.152
NP_442836.1_10 Forward -365 -355 9.7148 0.269
NP_440203.1_5 Forward -292 -282 13.0576 0.131
NP_440203.1_5 Reverse -123 -133 9.321 0.263
NP_442260.1_8 Reverse -24 -43 4.12936 0.245
NP_439905.1_1 Reverse -230 -243 15.0639 0.103
NP_439905.1_1 Reverse -86 -99 6.21414 0.295
NP_440984.1_7 Reverse -224 -238 9.34103 0.127
NP_441162.1_5 Forward -252 -234 17.1287 0.173
NP_439990.1_5 Forward -99 -86 5.52582 0.289
NP_442911.1_2 Reverse -75 -94 -0.4922 0.0759
NP_441580.1_6 Reverse -262 -281 -2.26216 0.217
NP_440153.1_5 Forward -237 -223 4.42448 0.199
NP_440153.1_5 Forward -93 -79 2.85119 0.219
NP_442064.1_1 Reverse -133 -152 -12.4886 0.277
NP_443055.1_3 Reverse -76 -95 12.8414 0.202
NP_443055.1_6 Forward -302 -284 0.706727 0.24
NP_440993.1_2 Reverse -80 -96 7.53169 0.171
NP_440934.1_2 Forward -243 -224 1.57275 0.265
NP_440934.1_5 Reverse -304 -323 16.3224 0.13
NP_440138.1_6 Forward -293 -274 17.5998 0.109
NP_439975.1_3 Reverse -18 -31 15.4572 0.274
NP_441129.1_3 Forward -381 -362 -17.0118 0.281
NP_440411.1_10 Reverse -271 -290 12.8967 0.26
NP_441646.1_1 Reverse -272 -291 7.37428 0.16
NP_442438.1_10 Reverse -80 -94 4.12949 0.152
NP_441398.1_5 Forward -384 -365 10.7175 0.258
NP_442771.1_1 Forward -96 -78 -8.83064 0.208
NP_440484.1_3 Forward -96 -82 10.816 0.242
NP_441550.1_8 Forward -96 -86 16.2041 0.0132
NP_441550.1_8 Reverse -130 -140 4.89613 0.281
NP_441331.1_5 Reverse -367 -386 14.0599 0.294
NP_441916.1_7 Reverse -85 -95 1.06167 0.294
NP_441041.1_4 Forward -376 -357 -3.63879 0.124
NP_441041.1_4 Forward -141 -122 -8.26035 0.199
NP_441041.1_4 Reverse -223 -242 -10.1286 0.228
NP_441041.1_7 Forward -97 -85 5.6684 0.245
NP_441547.1_2 Forward -105 -87 5.13236 0.228
NP_441547.1_2 Reverse -274 -292 3.26407 0.289
NP_442004.1_6 Forward -318 -304 3.04785 0.251
NP_441725.1_5 Forward -93 -83 0.275027 0.192
NP_441725.1_5 Reverse -86 -96 -0.904945 0.274
NP_439966.1_7 Reverse -83 -93 14.9258 0.0177
NP_439966.1_7 Forward -240 -230 11.5826 0.0611
NP_439966.1_7 Forward -96 -86 4.10949 0.289
NP_439966.1_9 Forward -96 -87 0.983037 0.253
NP_442941.1_3 Reverse -86 -96 1.16001 0.15
NP_442941.1_3 Forward -237 -227 -0.0199663 0.244
NP_441076.1_1 Reverse -184 -203 8.84447 0.295
NP_440260.1_7 Forward -372 -353 -1.37718 0.241
NP_440260.1_8 Reverse -270 -288 4.54237 0.154
NP_441678.1_9 Reverse -274 -293 1.67108 0.223
NP_442281.1_1 Reverse -80 -94 2.45727 0.266
NP_442256.1_2 Forward -240 -222 -7.84733 0.215
NP_440437.1_1 Reverse -79 -98 -1.08219 0.194
NP_442049.1_6 Reverse -277 -296 6.4893 0.215
NP_441087.1_6 Forward -397 -379 -3.12816 0.296
NP_441860.1_1 Reverse -202 -216 14.9676 0.277
NP_441556.1_6 Reverse -98 -116 13.2454 0.296
NP_441644.1_6 Reverse -85 -95 9.41933 0.0767
NP_441644.1_6 Forward -312 -302 5.48612 0.188
NP_441644.1_6 Forward -238 -228 5.19112 0.204
NP_441644.1_6 Forward -141 -131 4.69947 0.228
NP_441644.1_6 Forward -288 -278 4.20782 0.245
NP_442215.1_2 Forward -297 -281 11.2683 0.0414
NP_442215.1_2 Reverse -277 -293 2.61514 0.112
NP_442029.1_6 Forward -135 -116 3.6377 0.28
NP_442029.1_6 Reverse -274 -293 3.34271 0.282
NP_442029.1_10 Forward -245 -226 12.6841 0.158
NP_440929.1_8 Reverse -85 -94 14.651 0.0105
NP_440929.1_8 Forward -94 -85 7.66954 0.0624
NP_442933.1_10 Reverse -229 -238 3.83464 0.283
NP_441310.1_10 Reverse -24 -34 15.7909 0.131
NP_441751.2_8 Reverse -86 -100 0.392915 0.119
NP_441751.2_8 Forward -93 -79 -0.492064 0.128
NP_442554.1_8 Reverse -86 -96 9.32148 0.0608
NP_442554.1_8 Forward -93 -83 8.1415 0.0785
NP_442554.1_8 Forward -237 -227 6.76487 0.107
NP_442554.1_8 Reverse -280 -290 1.84832 0.292
NP_441762.1_7 Reverse -84 -96 -5.56589 0.217
NP_442142.1_4 Forward -241 -228 7.88518 0.127
NP_442142.1_4 Forward -291 -278 2.96866 0.269
NP_442142.1_4 Reverse -82 -95 2.18201 0.299
NP_442292.1_1 Reverse -86 -95 7.66954 0.0634
NP_442292.1_1 Forward -237 -228 5.11294 0.162
NP_442292.1_1 Forward -93 -84 -0.68859 0.268
NP_443009.1_5 Forward -95 -84 8.80962 0.099
NP_441715.1_4 Forward -237 -227 4.99491 0.24
NP_440279.1_2 Reverse -274 -293 8.84924 0.189
NP_440158.1_8 Forward -225 -206 11.3075 0.249
NP_441198.1_8 Forward -96 -86 11.0251 0.228
NP_441468.1_1 Reverse -230 -237 10.2655 0.0906
NP_441468.1_1 Forward -93 -86 6.13563 0.209
NP_441468.1_1 Reverse -86 -93 6.0373 0.223
NP_441020.2_6 Forward -96 -79 6.72535 0.257
NP_441015.1_10 Forward -382 -363 -7.4737 0.267
NP_441015.1_10 Reverse -10 -29 -9.44032 0.282
NP_441015.1_10 Reverse -127 -146 -9.83364 0.282
NP_441015.1_10 Reverse -16 -35 -11.0136 0.29
NP_441673.1_1 Forward -94 -85 1.37636 0.114
NP_441673.1_1 Reverse -85 -94 1.1797 0.163
NP_441673.1_1 Forward -141 -132 -8.06341 0.254
NP_441876.1_9 Forward -385 -375 12.5659 0.267
NP_441826.1_2 Reverse -79 -93 -0.885388 0.228
NP_441826.1_2 Forward -288 -274 -4.81863 0.3
NP_441826.1_5 Forward -237 -218 6.09597 0.225
NP_442719.1_2 Forward -207 -189 -8.733 0.255
NP_442719.1_2 Reverse -349 -367 -11.8796 0.297
NP_442808.1_1 Reverse -84 -94 10.4026 0.0481
NP_442808.1_1 Forward -239 -229 7.35439 0.0814
NP_442542.1_9 Reverse -222 -236 4.42388 0.297
NP_442050.1_1 Reverse -10 -29 6.4893 0.29
NP_442050.1_5 Forward -96 -86 7.45273 0.256
NP_441114.1_3 Forward -293 -284 17.1093 0.113
NP_441878.1_6 Reverse -228 -238 1.06167 0.116
NP_441878.1_6 Reverse -278 -288 -0.0199663 0.163
NP_441878.1_6 Forward -142 -132 -7.78811 0.266
NP_441036.1_8 Reverse -84 -94 7.45319 0.197
NP_441557.1_5 Reverse -85 -94 7.57121 0.049
NP_441557.1_5 Forward -94 -85 1.08137 0.0794
NP_441433.1_8 Reverse -281 -300 2.16274 0.225
NP_441433.1_8 Reverse -368 -387 1.76941 0.234
NP_440084.1_7 Forward -237 -218 22.5172 0.0121
NP_441308.1_8 Forward -96 -86 10.7964 0.22
NP_442830.1_5 Forward -240 -226 4.52221 0.239
NP_442469.1_1 Forward -388 -369 10.7175 0.215
NP_442183.1_1 Forward -94 -80 8.45605 0.115
NP_441574.1_1 Forward -262 -243 -3.73712 0.243
NP_441549.1_9 Forward -242 -224 -10.2073 0.273
NP_441467.1_8 Reverse -222 -241 17.109 0.266
NP_442645.1_2 Reverse -271 -290 -15.9302 0.217
NP_442645.1_2 Forward -320 -301 -17.3068 0.253
NP_442645.1_2 Forward -138 -119 -18.4868 0.274
NP_441037.1_4 Forward -96 -86 7.51261 0.237
NP_440690.1_5 Forward -193 -174 15.4374 0.206
NP_441633.1_3 Reverse -83 -96 -2.144 0.173
NP_440136.1_2 Forward -93 -86 6.23397 0.171
NP_440136.1_2 Reverse -86 -93 6.13563 0.193
NP_442998.1_5 Reverse -27 -37 16.008 0.149
NP_442998.1_5 Reverse -197 -207 7.55152 0.289
NP_442998.1_10 Reverse -87 -94 15.5754 0.0102
NP_440899.1_2 Reverse -218 -237 13.5683 0.103
NP_440299.1_1 Reverse -81 -94 5.32859 0.18
NP_441799.1_1 Forward -242 -228 4.62054 0.242
NP_441799.1_1 Forward -98 -84 4.52221 0.247
NP_441007.1_10 Forward -99 -86 5.23083 0.182
NP_442333.2_1 Forward -393 -374 -5.70374 0.25
NP_442333.2_5 Reverse -218 -237 -6.29373 0.227
NP_442333.2_5 Reverse -74 -93 -11.0136 0.246
NP_440256.1_1 Forward -380 -361 -5.01543 0.171
NP_440256.1_1 Forward -241 -222 -8.06369 0.251
NP_440256.1_1 Forward -133 -114 -9.93197 0.291
NP_441559.1_8 Forward -395 -381 4.32615 0.123
NP_441559.1_8 Forward -306 -292 -5.9986 0.271
NP_440915.1_6 Reverse -269 -283 -0.983719 0.217
NP_441296.1_9 Reverse -357 -370 8.67183 0.294
NP_442866.1_1 Forward -264 -245 2.16274 0.158
NP_442866.1_1 Forward -69 -50 -9.44032 0.293
NP_440695.1_5 Reverse -229 -248 -0.4922 0.284
NP_442993.1_1 Forward -357 -341 -9.97122 0.201
NP_442993.1_1 Forward -44 -28 -12.8228 0.281
NP_442386.1_9 Reverse -84 -93 10.619 0.121
NP_442386.1_9 Forward -239 -230 7.07914 0.219
NP_441340.1_5 Forward -93 -86 13.5105 0.0314
NP_441340.1_5 Reverse -86 -93 5.84064 0.208
NP_441340.1_5 Forward -237 -230 4.07068 0.239
NP_441271.1_1 Forward -100 -82 12.4081 0.236
NP_440327.1_6 Reverse -274 -293 2.75272 0.29
NP_442240.1_2 Forward -237 -218 -3.3438 0.0766
NP_440586.1_8 Reverse -86 -93 9.47853 0.146
NP_440586.1_8 Reverse -326 -333 7.02027 0.279
NP_440586.1_8 Forward -93 -86 5.74197 0.283
NP_442959.1_6 Reverse -184 -203 -0.197208 0.299
NP_441262.1_3 Forward -94 -87 14.7888 0.0223
NP_440027.1_3 Reverse -219 -237 17.5212 0.0812
NP_440027.1_3 Forward -238 -220 4.34495 0.262
NP_440027.1_3 Forward -383 -365 2.96833 0.282
NP_440027.1_8 Forward -241 -222 3.73524 0.297
NP_443051.1_1 Forward -95 -86 16.6177 0.00754
NP_443051.1_1 Reverse -228 -237 0.29472 0.195
NP_440451.1_10 Reverse -256 -275 9.04509 0.264
NP_439937.1_9 Forward -185 -168 -15.2031 0.287
NP_439937.1_9 Reverse -84 -101 -17.1697 0.294
NP_440408.1_7 Reverse -273 -292 8.06259 0.282
NP_440439.1_1 Reverse -82 -95 3.16588 0.119
NP_440439.1_1 Forward -97 -84 -0.0790467 0.207
NP_440439.1_1 Forward -241 -228 -0.964025 0.244
NP_440439.1_1 Forward -92 -79 -1.45568 0.269
NP_442239.1_8 Reverse -222 -241 5.89931 0.266
NP_440372.1_2 Forward -93 -86 13.8055 0.0214
NP_440372.1_2 Reverse -86 -93 6.52896 0.188
NP_440316.1_10 Reverse -228 -238 16.1063 0.153
NP_440316.1_10 Forward -148 -138 6.46988 0.257
NP_441803.1_2 Reverse -220 -239 2.0644 0.22
NP_441803.1_2 Reverse -356 -375 1.86774 0.223
NP_439977.1_5 Forward -244 -225 5.11266 0.15
NP_441572.1_7 Forward -100 -81 6.98095 0.0785
NP_442887.1_5 Forward -143 -124 -14.1602 0.293
NP_442384.1_10 Forward -141 -128 8.08242 0.0692
NP_442384.1_10 Reverse -368 -381 2.47756 0.224
NP_440364.1_2 Reverse -274 -293 15.5901 0.218
NP_441018.1_7 Forward -98 -79 9.93088 0.218
NP_441018.1_7 Reverse -269 -288 6.98095 0.278
NP_442262.1_10 Reverse -86 -93 13.2155 0.0213
NP_441689.1_5 Forward -96 -86 5.87944 0.197
NP_440344.1_10 Forward -325 -308 -13.4325 0.285
NP_440282.1_10 Forward -292 -273 -9.14533 0.272
NP_440531.1_6 Reverse -221 -240 14.1591 0.0397
NP_441965.1_7 Forward -29 -10 11.3067 0.292
NP_441965.1_10 Forward -321 -305 5.17175 0.216
NP_440297.1_9 Forward -93 -83 -0.118297 0.282
NP_441896.1_1 Forward -358 -339 10.2251 0.231
NP_441103.1_9 Forward -34 -24 15.3217 0.192
NP_440999.1_9 Forward -242 -228 2.65453 0.146
NP_440999.1_9 Forward -248 -234 -0.393733 0.205
NP_440999.1_9 Reverse -249 -263 -1.5737 0.242
NP_440888.1_2 Reverse -132 -146 15.4369 0.0107
NP_440888.1_2 Forward -238 -224 11.7003 0.0611
NP_442033.1_10 Forward -240 -221 2.16274 0.0882
NP_441917.1_2 Forward -261 -243 16.0471 0.152
NP_441543.1_2 Reverse -139 -148 8.75118 0.0968
NP_441543.1_2 Reverse -86 -95 6.09625 0.153
NP_441543.1_2 Forward -237 -228 4.22796 0.267
NP_442845.1_2 Reverse -273 -287 13.9626 0.088
NP_442845.1_2 Forward -100 -86 11.3077 0.131
NP_442845.1_2 Reverse -303 -317 6.48943 0.209
NP_442845.1_2 Forward -270 -256 4.52282 0.258
NP_441551.1_5 Forward -242 -226 13.5292 0.123
NP_441551.1_5 Reverse -81 -97 13.0375 0.137
NP_441918.1_7 Forward -313 -294 -1.27885 0.297
NP_441469.1_8 Reverse -84 -93 6.68623 0.227
NP_443064.1_6 Forward -318 -308 9.46426 0.219
NP_442578.1_7 Forward -93 -86 6.0373 0.18
NP_440071.1_1 Reverse -366 -383 14.1977 0.223
NP_440071.1_5 Reverse -220 -239 8.84924 0.276
NP_440220.1_4 Forward -307 -288 5.30853 0.205
NP_441462.1_2 Forward -94 -84 0.963343 0.109
NP_441462.1_2 Reverse -85 -95 0.57002 0.144
NP_441621.1_7 Reverse -83 -97 -4.91696 0.248
NP_443062.1_1 Forward -94 -76 6.79079 0.192
NP_443062.1_1 Reverse -85 -103 4.06059 0.276
NP_441601.1_4 Reverse -221 -240 2.94938 0.206
NP_441601.1_4 Forward -242 -223 -4.03212 0.293
NP_442204.1_1 Reverse -225 -236 10.7767 0.0678
NP_440516.1_2 Forward -386 -368 -2.43913 0.299
NP_440516.1_8 Forward -94 -85 9.53783 0.0136
NP_440516.1_8 Reverse -85 -94 5.01461 0.118
NP_440516.1_8 Reverse -229 -238 -0.295266 0.232
NP_442428.1_5 Forward -93 -86 6.13563 0.209
NP_442428.1_5 Reverse -86 -93 6.0373 0.212
NP_442428.1_5 Reverse -230 -237 4.66067 0.244
NP_442859.1_2 Forward -237 -218 2.85105 0.262
NP_442859.1_2 Forward -93 -74 2.0644 0.28
NP_441867.1_2 Forward -374 -355 -15.7335 0.291
NP_440673.1_3 Reverse -87 -94 12.4288 0.0426
NP_441052.1_2 Reverse -132 -142 5.09324 0.132
NP_441052.1_2 Forward -318 -308 -0.314959 0.273
NP_442219.1_9 Reverse -133 -142 1.76968 0.298
NP_441884.1_8 Forward -239 -220 -11.4069 0.269
NP_440314.1_9 Reverse -192 -211 -5.80207 0.225
NP_440314.1_9 Reverse -312 -331 -10.3253 0.295
NP_440041.1_6 Forward -37 -18 10.52 0.285
NP_441719.1_4 Forward -93 -86 6.82395 0.0855
NP_441719.1_4 Reverse -86 -93 6.52896 0.188
NP_441719.1_6 Forward -34 -15 6.09517 0.288
NP_441733.1_10 Forward -97 -84 9.95071 0.106
NP_441004.1_1 Forward -382 -363 -13.9635 0.263
NP_441004.1_1 Reverse -375 -394 -17.9951 0.296
NP_442813.1_4 Forward -385 -366 -1.08219 0.236
NP_442873.1_5 Reverse -221 -240 18.9765 0.123
NP_441115.1_4 Reverse -249 -267 7.98318 0.266
NP_442206.1_10 Forward -94 -79 3.91314 0.181
NP_443054.1_2 Reverse -83 -97 1.67122 0.245
NP_443054.1_2 Forward -284 -270 0.294584 0.269
NP_443054.1_2 Reverse -26 -40 0.0979218 0.278
NP_442308.1_8 Forward -244 -225 11.7008 0.231
NP_441851.1_10 Reverse -84 -94 4.60159 0.259
NP_442515.1_1 Reverse -234 -248 -0.000409212 0.206
NP_440593.1_3 Forward -293 -274 -5.50708 0.261
NP_440463.1_4 Forward -279 -260 16.6165 0.17
NP_440463.1_6 Reverse -82 -101 7.7676 0.259
NP_441046.1_2 Forward -152 -133 -0.197208 0.276
NP_440940.1_7 Reverse -240 -258 10.1465 0.148
NP_442314.1_4 Forward -382 -364 16.3421 0.113
NP_440432.1_9 Reverse -86 -101 -4.34667 0.207
NP_442843.1_1 Forward -93 -74 -8.45701 0.255
NP_439960.1_10 Reverse -222 -240 -1.16082 0.242
NP_439960.1_10 Reverse -364 -382 -4.40575 0.293
NP_440474.1_8 Reverse -86 -100 4.22722 0.287
NP_440474.1_8 Reverse -242 -256 4.12889 0.291
NP_442168.1_5 Reverse -215 -234 -0.39387 0.264
NP_442006.1_2 Forward -382 -365 -15.2025 0.22
NP_442006.1_2 Reverse -373 -390 -18.4474 0.291
NP_440483.1_1 Reverse -224 -243 -8.94866 0.297
NP_442243.1_1 Forward -295 -277 8.08151 0.176
NP_442243.1_1 Reverse -35 -53 -3.02983 0.298
NP_441570.1_1 Forward -94 -76 -16.0088 0.237
NP_441570.1_1 Forward -238 -220 -17.7788 0.291
NP_441078.1_4 Forward -94 -85 0.196389 0.205
NP_441078.1_4 Reverse -85 -94 -0.000272808 0.205
NP_441078.1_4 Forward -141 -132 -1.57357 0.266
NP_441078.1_4 Reverse -229 -238 -1.86856 0.272
NP_440707.1_9 Forward -372 -353 3.24438 0.268
NP_442443.1_1 Forward -372 -353 8.84924 0.119
NP_442443.1_1 Reverse -221 -240 -4.6221 0.275
NP_442443.1_1 Forward -233 -214 -5.99873 0.289
NP_440526.1_3 Reverse -86 -97 2.02482 0.267
NP_441432.1_8 Forward -95 -86 14.0611 0.0258
NP_441432.1_8 Reverse -228 -237 4.71961 0.197
NP_441432.1_8 Forward -148 -139 2.94966 0.28
NP_443024.1_3 Forward -367 -357 17.4829 0.251
NP_441732.1_2 Reverse -128 -144 -16.7561 0.195
NP_441732.1_5 Forward -287 -273 23.599 0.0126
NP_441057.1_3 Forward -45 -26 -11.5053 0.236
NP_442353.1_4 Reverse -229 -248 8.35677 0.156
NP_442489.1_7 Forward -94 -85 0.688044 0.152
NP_442489.1_7 Reverse -85 -94 0.688044 0.152
NP_442489.1_7 Forward -141 -132 -1.27858 0.185
NP_442489.1_7 Reverse -229 -238 -1.37691 0.195
NP_440559.1_1 Forward -93 -84 5.11294 0.151
NP_441659.2_8 Reverse -85 -95 8.23984 0.0462
NP_441659.2_8 Forward -238 -228 -0.0199663 0.282
NP_440363.1_7 Forward -232 -213 17.137 0.283
NP_442913.1_10 Reverse -372 -391 -5.80207 0.279
NP_442346.1_5 Forward -95 -85 5.87989 0.225
NP_440352.1_5 Reverse -369 -388 9.83295 0.289
NP_440545.1_3 Reverse -215 -232 0.92382 0.129
NP_440545.1_3 Forward -98 -81 -5.27103 0.245
NP_440545.1_3 Reverse -225 -242 -6.84433 0.289
NP_441856.1_3 Reverse -368 -387 -2.36049 0.26
NP_441126.1_8 Reverse -226 -239 25.2903 0.0188
NP_440459.1_2 Forward -382 -365 10.8552 0.189
NP_440459.1_2 Reverse -220 -237 8.49531 0.259
NP_440010.1_10 Reverse -299 -318 1.47442 0.299
NP_441943.1_8 Forward -291 -272 -5.99873 0.261
NP_440847.1_3 Reverse -357 -371 15.6336 0.17
NP_442603.1_7 Reverse -132 -146 5.40719 0.296
NP_441585.1_5 Forward -397 -378 2.9486 0.256
NP_441358.1_2 Reverse -375 -394 7.57094 0.275
NP_441833.1_4 Reverse -86 -93 6.52896 0.0924
NP_441833.1_4 Forward -93 -86 6.23397 0.163
NP_442799.1_2 Forward -296 -277 3.6377 0.202
NP_441895.1_10 Reverse -336 -355 -27.7299 0.29
NP_442162.1_9 Forward -93 -86 12.9205 0.0282
NP_442162.1_9 Reverse -86 -93 12.9205 0.0282
NP_440671.1_4 Reverse -79 -93 15.9292 0.0359
NP_440671.1_4 Reverse -29 -43 10.1277 0.164
NP_442140.1_3 Reverse -86 -96 5.87989 0.194
NP_442140.1_3 Reverse -230 -240 5.48657 0.207
NP_441671.1_1 Forward -384 -365 -0.787193 0.273
NP_440875.1_9 Reverse -87 -97 16.8403 0.0145
NP_440875.1_9 Forward -236 -226 8.5667 0.233
NP_441813.1_5 Reverse -83 -93 13.2547 0.0178
NP_441813.1_5 Forward -240 -230 0.176696 0.215
NP_441259.1_3 Reverse -366 -385 5.89931 0.277
NP_440590.1_4 Reverse -9 -22 0.0192843 0.173
NP_440590.1_4 Reverse -67 -80 -1.06236 0.21
NP_440590.1_4 Reverse -86 -99 -4.7006 0.265
NP_440567.1_1 Reverse -86 -100 -0.197071 0.27
NP_442497.1_10 Reverse -86 -95 7.76787 0.0731
NP_442497.1_10 Forward -93 -84 -1.18024 0.256
NP_440821.1_4 Reverse -83 -93 8.63316 0.0454
NP_440821.1_4 Forward -96 -86 1.06167 0.142
NP_441239.1_9 Reverse -83 -95 12.0354 0.0512
NP_441239.1_9 Forward -240 -228 5.05386 0.231
NP_441239.1_9 Reverse -227 -239 4.5622 0.251
NP_441239.1_9 Reverse -366 -378 4.26721 0.256
NP_441239.1_9 Forward -96 -84 3.57889 0.283
NP_441951.1_9 Reverse -230 -249 0.392778 0.261
NP_441892.1_1 Reverse -220 -237 3.57876 0.123
NP_440665.1_2 Forward -290 -271 -4.03212 0.246
NP_442193.1_8 Forward -303 -284 11.7 0.257
NP_442270.1_6 Forward -374 -356 17.1287 0.279
NP_442643.1_3 Reverse -220 -239 -5.60541 0.261
NP_442643.1_7 Forward -26 -7 2.65439 0.288
NP_441017.1_6 Forward -292 -278 14.4536 0.15
NP_441874.1_1 Reverse -299 -313 15.4376 0.165
NP_440863.1_1 Reverse -340 -354 13.612 0.254
NP_440833.1_6 Forward -304 -290 8.94708 0.267
NP_440876.1_5 Reverse -87 -106 7.07928 0.283
NP_442809.1_6 Reverse -238 -257 7.66927 0.256
NP_440546.1_4 Reverse -229 -239 8.39772 0.192
NP_441656.1_6 Forward -235 -216 10.7175 0.193
NP_440462.1_6 Forward -96 -86 9.91146 0.0429
NP_440462.1_6 Reverse -83 -93 3.81494 0.228
NP_440868.1_4 Forward -98 -86 6.92215 0.0822
NP_440868.1_4 Forward -242 -230 4.16888 0.125
NP_442479.1_5 Forward -207 -188 8.24996 0.222
NP_442402.1_2 Forward -392 -378 10.3237 0.292
NP_442402.1_4 Reverse -60 -79 -9.44104 0.29
NP_442402.1_10 Forward -387 -377 12.6642 0.204
NP_440696.1_3 Forward -238 -220 0.0191479 0.237
NP_440696.1_3 Forward -244 -226 -1.75081 0.265
NP_442039.1_4 Forward -93 -86 11.6422 0.0747
NP_442837.1_3 Forward -317 -310 6.43063 0.212
NP_442837.1_3 Forward -93 -86 6.0373 0.25
NP_442837.1_3 Reverse -86 -93 6.0373 0.25
NP_439994.1_3 Reverse -84 -103 9.70673 0.233
NP_442053.1_1 Reverse -85 -94 7.07956 0.105
NP_442053.1_1 Forward -238 -229 5.3096 0.197
NP_440505.1_3 Forward -96 -86 13.8447 0.0247
NP_440505.1_7 Forward -251 -232 -2.55715 0.289
NP_442532.1_7 Reverse -229 -243 3.34284 0.201
NP_440914.1_1 Forward -141 -131 10.1766 0.151
NP_440914.1_1 Forward -294 -284 9.39583 0.186
NP_441011.1_1 Forward -147 -128 14.5524 0.195
NP_441011.1_8 Reverse -86 -95 6.78456 0.184
NP_441011.1_8 Forward -93 -84 5.70292 0.237
NP_442533.1_1 Reverse -12 -31 -15.6352 0.257
NP_442533.1_6 Forward -288 -279 10.9145 0.0503
NP_442533.1_6 Forward -238 -229 5.01461 0.16
NP_442533.1_6 Forward -141 -132 4.42462 0.179
NP_442533.1_6 Reverse -85 -94 4.42462 0.179
NP_442533.1_6 Reverse -368 -377 1.37636 0.3
NP_442541.1_10 Forward -288 -274 1.47397 0.286
NP_442232.1_3 Reverse -211 -230 -7.4737 0.201
NP_442322.1_4 Forward -240 -223 -5.07504 0.265
NP_442322.1_9 Forward -355 -337 9.6548 0.286
NP_441219.1_1 Forward -240 -221 8.55425 0.113
NP_441482.1_7 Reverse -223 -237 -12.1934 0.29
NP_439944.1_9 Reverse -86 -96 7.94484 0.123
NP_441028.1_6 Forward -386 -376 13.5492 0.158
NP_441028.1_6 Forward -347 -337 5.19112 0.265
NP_441527.1_4 Reverse -335 -354 -9.1199 0.255
NP_440115.1_6 Forward -97 -87 7.84651 0.146
NP_442728.1_7 Forward -295 -281 11.0127 0.291
NP_441680.1_4 Reverse -366 -385 -0.885524 0.256
NP_441602.1_3 Forward -243 -224 -1.86883 0.231
NP_441602.1_3 Forward -252 -233 -4.81876 0.274
NP_441602.1_4 Reverse -218 -237 9.14423 0.279
NP_441170.1_2 Reverse -266 -285 0.0977854 0.288
NP_441170.1_4 Forward -326 -308 1.78911 0.297
NP_441972.1_5 Reverse -74 -93 -6.88371 0.238
NP_441972.1_5 Reverse -110 -129 -9.24366 0.282
NP_441106.1_1 Forward -95 -86 8.75118 0.0469
NP_441106.1_1 Reverse -228 -237 5.80125 0.124
NP_439903.1_1 Reverse -375 -394 -2.55715 0.274
NP_439903.1_6 Reverse -129 -148 1.86696 0.239
NP_439903.1_7 Reverse -369 -388 5.01433 0.281
NP_442588.1_6 Reverse -221 -240 -2.65548 0.294
NP_441286.1_1 Reverse -84 -96 -5.95921 0.235
NP_442674.1_1 Reverse -189 -208 10.6585 0.261
NP_440670.1_8 Forward -94 -85 16.0277 0.00443
NP_440670.1_8 Reverse -85 -94 12.5861 0.0253
NP_440670.1_8 Reverse -191 -200 3.24465 0.29
NP_441479.1_9 Reverse -279 -297 15.7521 0.271
NP_441930.1_2 Reverse -285 -295 13.2547 0.248
NP_441930.1_2 Forward -365 -355 12.3697 0.262
NP_440886.1_7 Forward -239 -229 8.53436 0.0805
NP_440886.1_7 Reverse -84 -94 7.64939 0.0865
NP_440886.1_7 Forward -18 -8 7.0594 0.106
NP_440828.1_1 Forward -236 -217 -0.39464 0.269
NP_442382.1_9 Forward -394 -375 7.86512 0.29
NP_441399.1_6 Forward -288 -269 17.6982 0.166
NP_442072.1_9 Forward -283 -265 -13.9439 0.126
NP_440028.1_6 Forward -375 -357 15.1621 0.218
NP_440907.2_8 Reverse -86 -96 17.3841 0.00764
NP_441463.1_3 Forward -248 -229 -10.0303 0.288
NP_441626.1_2 Forward -93 -86 12.2322 0.0511
NP_441626.1_2 Reverse -86 -93 5.93897 0.231
NP_442211.1_3 Forward -376 -357 13.6968 0.22
NP_442221.1_4 Reverse -222 -241 6.29264 0.296
NP_442221.1_4 Forward -380 -361 5.99764 0.296
NP_441901.1_1 Reverse -270 -289 -1.18052 0.287
NP_441962.1_4 Reverse -236 -255 -1.18052 0.121
NP_440387.1_1 Forward -94 -78 4.87675 0.0377
NP_440387.1_1 Reverse -311 -327 -2.39974 0.147
NP_440855.1_5 Reverse -227 -246 4.32522 0.285
NP_441836.1_1 Forward -105 -86 15.4927 0.147
NP_442805.1_5 Reverse -357 -376 -3.63955 0.262
NP_440467.1_3 Forward -237 -218 11.7445 0.265
NP_442437.1_3 Forward -309 -290 9.93006 0.262
NP_442437.1_8 Reverse -230 -249 6.39097 0.242
NP_442698.1_10 Reverse -331 -350 -1.08219 0.297
NP_441510.2_2 Reverse -81 -100 14.7483 0.16
NP_440766.1_4 Forward -98 -84 2.45787 0.184
NP_440457.1_1 Forward -98 -86 0.628964 0.25
NP_440798.1_6 Forward -93 -80 1.49425 0.212
NP_442680.1_5 Reverse -194 -213 -0.416223 0.284
NP_441984.1_10 Reverse -7 -21 18.5841 0.296
NP_442509.1_9 Forward -94 -84 9.71433 0.192
NP_440524.1_3 Reverse -221 -240 12.6841 0.253
NP_442514.1_5 Forward -296 -277 2.55527 0.167
NP_441159.1_7 Reverse -28 -47 -8.94866 0.264
NP_440554.1_4 Reverse -86 -96 12.4681 0.0323
NP_440554.1_4 Forward -93 -83 6.17489 0.126
NP_440554.1_4 Forward -237 -227 5.5849 0.139
NP_441885.1_5 Forward -94 -84 0.0783647 0.183
NP_441614.1_1 Forward -327 -308 29.4987 0.000561
NP_441614.1_2 Forward -112 -93 34.4153 0.0000354
NP_441614.1_3 Forward -354 -335 33.6286 0.00002
NP_441614.1_4 Forward -375 -356 26.9421 0.00346
NP_441614.1_5 Forward -258 -239 26.2538 0.00382
NP_441614.1_6 Forward -183 -164 20.8447 0.113
NP_441614.1_7 Forward -218 -199 23.2056 0.00966
NP_441614.1_10 Forward -237 -223 20.1574 0.0783
NP_442703.1_9 Reverse -331 -349 3.06741 0.3
NP_442341.1_7 Reverse -237 -251 3.63784 0.217
NP_442341.1_9 Forward -272 -258 4.52221 0.299
NP_441756.1_5 Reverse -364 -383 3.73603 0.199
NP_441173.1_9 Forward -204 -196 12.1137 0.21
NP_443000.1_7 Reverse -227 -237 1.25834 0.26
NP_443000.1_7 Forward -96 -86 1.06167 0.274
NP_441842.1_1 Reverse -87 -100 10.2451 0.3
NP_440275.1_3 Forward -96 -86 16.1063 0.0155
NP_442932.1_9 Forward -370 -351 7.07928 0.249
NP_440091.1_1 Reverse -81 -93 1.12062 0.212
NP_443010.1_10 Reverse -306 -323 2.48089 0.275
NP_441359.1_5 Forward -380 -361 11.2092 0.121
NP_441359.1_5 Forward -383 -364 1.76941 0.289
NP_442451.1_2 Forward -236 -217 -7.17871 0.232
NP_439962.1_4 Forward -242 -223 10.1275 0.134
NP_439962.1_4 Reverse -220 -239 -4.13045 0.267
NP_441105.1_3 Reverse -274 -293 -5.31042 0.216
NP_441105.1_3 Reverse -121 -140 -6.88371 0.243
NP_442127.1_5 Reverse -282 -301 11.6025 0.299
NP_440216.1_1 Forward -238 -224 -11.0135 0.159
NP_440216.1_1 Forward -94 -80 -12.5868 0.288
NP_440678.1_6 Reverse -233 -252 19.3707 0.21
NP_440172.1_1 Reverse -85 -95 4.79825 0.166
NP_440172.1_1 Forward -141 -131 2.53664 0.277
NP_442015.1_10 Reverse -81 -94 9.16406 0.053
NP_442015.1_10 Forward -145 -132 2.2809 0.196
NP_442015.1_10 Forward -232 -219 -0.570702 0.272
NP_441226.1_7 Forward -93 -86 12.7234 0.0312
NP_441226.1_7 Reverse -86 -93 11.5435 0.0757
NP_441111.1_7 Reverse -86 -94 8.86921 0.0589
NP_441111.1_7 Forward -237 -229 -0.570565 0.233
NP_442379.1_10 Reverse -78 -95 -2.3211 0.228
NP_441766.1_2 Reverse -85 -94 12.6844 0.0158
NP_440416.1_9 Forward -384 -365 -0.39387 0.0598
NP_443052.1_9 Forward -239 -220 6.4893 0.138
NP_443052.1_9 Reverse -221 -240 -1.47551 0.228
NP_443052.1_9 Forward -242 -223 -5.31042 0.266
NP_443052.1_9 Reverse -357 -376 -5.9004 0.274
NP_442154.1_1 Forward -261 -243 -17.2871 0.251
NP_442564.1_2 Reverse -231 -250 7.66927 0.253
NP_440261.1_5 Reverse -86 -99 -3.4223 0.132
NP_440988.1_10 Forward -296 -282 3.73707 0.281
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTAGACCCAGACATTTCCCCCCGGTCAGCGGCGGAGGAATTGGGCTACACTTTTTTACCCTGTGTATTGATGGGACTGAGTCGGGCTCCCCATTACCAAAGATTTCCCAATGCCCAGGGCCAAACCCTCTGGAGTCGGGATGTGAATGCTGTGGTTGTGCCCGCCAGCGCCTGCGGTGGTTCCGCTTTGATGAGTTTTAGCCAATCTTCTGCCCGCATCATTGCAGTGGAAAATAACTCTACCCAGCTAGAAGTCTATGGCGAAGACCTAGGCATTTCTGTGGTTAGGGTAAACTCTTATTTAGAGGCGATCGGAGTGCTCTGTGCAGACCGTGCAGGCATTAACCTTGATTGTTTCCAACCGGATTTTCCCCTTCTTCACCGCCTACCCTGAATATCT

CDS

GTGTCTTCATCCAATAGTCCTTCCGAAATGGAGCCCCTAAGCCGTACCCAAATTTTGGGGGTGATGGGATTCACAGCGGTGCTACTGCTGATCATTGCTAAGCTTTGGCAATGGTGGGGGGATGTCACCCTGTTAAAAATCAGTTTTAATGTTCCAGACGCTTTATTGGGATTGGGTTTAGCAACTGCAATCATTCTGACCAGTGGGTTAATTTATCGGATTTGGCCTGCCTATCGGGTCAGTGCCGATGCCTACCTTGCCTTTGTGATTAAACCCCTGGTATGGGCAGATTTGCTCTGGTTAGGACTATTGCCCGGTTTAAGTGAAGAATTACTGTTTCGGGGAGTGATGCTTTCCGCCTTGGGGGGAGGTGTTTTGGCGGTGGTGGTTTCCAGCCTAGTATTTGGCGTTTTGCACCTCAGTAGTACGGAGCAATGGCCCTACGTGGTGTGGGCAACGGTGGTGGGGTTAGTGTTGGGCTATGGGGCGATCGCCAGCGGCAATTTAATGGTGCCTATTGTGGCCCACATTCTCACCAACTGGGTTTCCAGTGCCCTATGGAAATTCAACCACCGTCAAGGGTAA

Protein

MSSSNSPSEMEPLSRTQILGVMGFTAVLLLIIAKLWQWWGDVTLLKISFNVPDALLGLGLATAIILTSGLIYRIWPAYRVSADAYLAFVIKPLVWADLLWLGLLPGLSEELLFRGVMLSALGGGVLAVVVSSLVFGVLHLSSTEQWPYVVWATVVGLVLGYGAIASGNLMVPIVAHILTNWVSSALWKFNHRQG