Your browser is old and dusty. Try Google Chrome!

Details for slr1283

ORF slr1283
Accession NP_441607.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY508b: 1877114 - 1878081]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_1 Forward -106 -87 12.5568 0.198
NP_442272.1_2 Forward -29 -10 15.9945 0.15
NP_442272.1_2 Forward -147 -128 11.7928 0.232
NP_441098.1_3 Forward -107 -88 -6.31045 0.28
NP_441470.1_4 Forward -147 -128 19.764 0.0183
NP_441675.1_4 Forward -143 -124 10.2259 0.203
NP_441675.1_4 Forward -142 -123 6.68596 0.236
NP_439979.1_7 Reverse -316 -333 14.8868 0.267
NP_440764.1_1 Forward -47 -33 18.5841 0.21
NP_441594.1_6 Forward -243 -224 0.0977854 0.293
NP_439957.1_10 Forward -81 -71 15.6147 0.287
NP_441149.1_9 Reverse -176 -195 0.0970122 0.26
NP_441434.1_1 Forward -300 -286 12.2346 0.233
NP_441770.1_1 Reverse -239 -258 13.2733 0.277
NP_442848.1_4 Reverse -272 -286 5.60446 0.288
NP_441077.1_6 Forward -153 -137 5.79048 0.244
NP_441077.1_6 Forward -102 -86 4.24797 0.258
NP_441553.1_4 Forward -26 -8 17.1905 0.254
NP_442782.1_2 Forward -253 -239 4.03116 0.257
NP_442544.1_6 Reverse -296 -315 -5.01543 0.279
NP_441487.1_7 Forward -256 -237 7.17762 0.291
NP_440984.1_7 Reverse -40 -54 11.7993 0.122
NP_439975.1_2 Forward -329 -311 4.83737 0.285
NP_441712.1_1 Forward -144 -125 10.9704 0.251
NP_441041.1_4 Forward -318 -299 -8.45701 0.203
NP_440703.1_9 Forward -47 -34 8.57349 0.226
NP_441678.1_9 Forward -253 -234 -3.93378 0.288
NP_442281.1_1 Forward -383 -369 2.8506 0.253
NP_442500.1_8 Forward -155 -141 10.4676 0.272
NP_442215.1_2 Forward -230 -214 -5.05468 0.244
NP_442933.1_10 Forward -268 -259 6.29291 0.128
NP_442554.1_8 Forward -53 -43 1.74999 0.298
NP_442301.1_3 Forward -390 -371 17.404 0.277
NP_441198.1_8 Forward -320 -310 11.8064 0.183
NP_441020.2_6 Forward -251 -234 8.20031 0.205
NP_441612.1_2 Forward -81 -71 15.0357 0.21
NP_441612.1_2 Forward -213 -203 10.9696 0.21
NP_442361.1_3 Forward -47 -34 7.88576 0.285
NP_441911.1_10 Forward -217 -198 16.1751 0.112
NP_441101.1_4 Reverse -171 -190 9.83255 0.191
NP_441101.1_4 Reverse -137 -156 8.25926 0.214
NP_442505.1_2 Forward -138 -119 18.823 0.132
NP_442903.1_2 Forward -196 -177 8.6416 0.165
NP_441590.1_4 Reverse -319 -338 2.55527 0.293
NP_441433.1_8 Forward -47 -28 0.884433 0.238
NP_440084.1_8 Forward -297 -283 11.1842 0.251
NP_441458.1_8 Reverse -82 -101 2.09991 0.295
NP_442397.1_9 Forward -54 -35 1.57275 0.283
NP_440899.1_8 Reverse -196 -215 -9.73531 0.268
NP_440899.1_8 Reverse -174 -193 -10.9153 0.292
NP_440256.1_1 Forward -275 -256 -5.60541 0.187
NP_440256.1_1 Forward -333 -314 -10.3253 0.299
NP_441118.1_2 Forward -359 -340 15.7324 0.0549
NP_440456.1_7 Forward -244 -230 13.1759 0.281
NP_440695.1_6 Forward -299 -285 12.1566 0.264
NP_440695.1_6 Forward -25 -11 9.05395 0.298
NP_441947.1_4 Forward -337 -318 13.0775 0.223
NP_441248.1_10 Forward -143 -133 14.6181 0.282
NP_441027.1_1 Reverse -168 -182 10.6187 0.277
NP_441138.1_5 Reverse -198 -211 11.3298 0.227
NP_442663.1_2 Forward -66 -48 17.6204 0.0723
NP_442384.1_10 Forward -54 -41 3.5592 0.186
NP_441018.1_7 Reverse -299 -318 6.19431 0.297
NP_442556.1_10 Reverse -21 -40 16.9475 0.136
NP_440350.1_5 Reverse -137 -156 -6.49039 0.296
NP_442280.1_10 Reverse -240 -258 9.35044 0.233
NP_440700.1_8 Forward -253 -239 11.111 0.28
NP_440999.1_2 Reverse -255 -274 13.2741 0.177
NP_442277.1_7 Forward -213 -197 -0.184182 0.219
NP_441543.1_2 Reverse -264 -273 4.91628 0.213
NP_442845.1_2 Reverse -39 -53 5.80112 0.224
NP_441178.1_6 Reverse -246 -265 1.27698 0.285
NP_442578.1_7 Reverse -264 -271 9.38056 0.138
NP_440148.1_1 Forward -143 -124 -4.81876 0.222
NP_443062.1_1 Reverse -298 -316 3.67056 0.289
NP_440544.1_5 Reverse -74 -81 13.8024 0.28
NP_440992.1_8 Forward -51 -32 19.8623 0.0433
NP_441004.1_1 Forward -246 -227 2.3594 0.106
NP_441004.1_2 Forward -251 -232 -0.787193 0.259
NP_441004.1_4 Forward -243 -233 9.02648 0.259
NP_442430.1_6 Forward -105 -86 5.30933 0.271
NP_440165.1_5 Reverse -239 -258 -3.54046 0.22
NP_441409.1_8 Forward -157 -138 16.5608 0.209
NP_442843.1_1 Reverse -370 -389 -11.6036 0.291
NP_439960.1_6 Reverse -314 -333 8.65258 0.255
NP_441432.1_9 Reverse -31 -44 10.6345 0.245
NP_440760.1_7 Reverse -170 -189 6.58682 0.192
NP_442510.1_7 Forward -197 -178 19.9606 0.245
NP_442400.1_10 Forward -92 -79 9.70646 0.271
NP_441022.1_1 Forward -143 -134 11.0666 0.284
NP_442008.1_2 Forward -136 -117 7.47261 0.209
NP_442346.1_5 Reverse -368 -378 8.33817 0.14
NP_441888.1_5 Reverse -10 -29 10.4225 0.189
NP_441888.1_9 Reverse -369 -388 17.2883 0.26
NP_441329.1_6 Forward -93 -74 5.87233 0.191
NP_441329.1_6 Forward -216 -197 1.38421 0.239
NP_441329.1_6 Forward -160 -141 -2.62645 0.294
NP_440912.1_3 Reverse -70 -89 8.35677 0.275
NP_440772.1_8 Reverse -353 -372 9.73422 0.253
NP_441671.1_10 Forward -260 -241 -0.39387 0.293
NP_440212.1_9 Reverse -60 -79 11.3255 0.14
NP_442465.1_2 Reverse -133 -152 0.981987 0.259
NP_441848.1_4 Forward -33 -17 12.3253 0.206
NP_441848.1_4 Forward -151 -135 10.5109 0.252
NP_441848.1_4 Forward -84 -68 7.35968 0.29
NP_441848.1_7 Reverse -190 -209 0.293673 0.228
NP_442679.1_1 Forward -205 -186 -5.11376 0.29
NP_442360.1_2 Reverse -253 -266 19.5865 0.181
NP_441252.1_6 Forward -243 -236 11.9372 0.25
NP_441203.1_1 Reverse -33 -52 -15.2418 0.22
NP_442532.1_1 Forward -85 -71 8.94748 0.292
NP_442533.1_6 Reverse -369 -378 2.16301 0.27
NP_442269.1_10 Reverse -27 -46 3.83436 0.248
NP_441697.1_5 Reverse -158 -177 -8.92892 0.268
NP_441697.1_5 Forward -310 -291 -10.2658 0.278
NP_441697.1_5 Forward -151 -132 -11.6982 0.298
NP_442202.1_7 Reverse -133 -152 17.0099 0.243
NP_442202.1_10 Forward -48 -34 3.53951 0.278
NP_441527.1_4 Forward -95 -76 -4.15432 0.179
NP_441527.1_4 Forward -44 -25 -7.78302 0.237
NP_441527.1_4 Forward -154 -135 -9.31089 0.256
NP_441527.1_4 Forward -92 -73 -10.7433 0.274
NP_441527.1_4 Reverse -110 -129 -11.4117 0.282
NP_441286.1_1 Forward -369 -357 -3.00928 0.145
NP_441886.1_2 Reverse -321 -340 6.29264 0.26
NP_442893.1_4 Forward -26 -7 -2.45958 0.281
NP_440387.1_8 Forward -77 -58 13.2733 0.191
NP_441156.1_1 Reverse -111 -130 12.3892 0.208
NP_442087.1_7 Reverse -171 -190 4.52188 0.155
NP_439988.1_3 Forward -252 -238 7.47274 0.276
NP_442930.1_1 Reverse -290 -300 14.5325 0.239
NP_441984.1_10 Forward -265 -251 19.3708 0.296
NP_442703.1_1 Forward -157 -138 6.2543 0.266
NP_441397.1_8 Forward -185 -172 18.3007 0.142
NP_441902.1_3 Forward -260 -250 11.9127 0.283
NP_440149.1_8 Forward -54 -35 -5.9004 0.235
NP_440216.1_9 Forward -239 -230 8.55452 0.286
NP_442371.1_1 Reverse -327 -337 13.0576 0.215
NP_441045.1_1 Forward -45 -26 14.6508 0.26
NP_441766.1_9 Reverse -213 -232 -2.65548 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGAATCCATAAACAACTAAATCAGTCATGGCTTACGATCTTGATTTACGTATTAAGGTAATAGATTTCATCGAGAGTGGTGGTGGAATCACAAAGGCTTCGAAAATATTTAAGGTGGGCAGAGCAACAATTTATCGCTGGTTGGGCAGAGAAGAGCTTGGGGCAACGAAAGTTGAGACCCGCCAGCGTAAGATAAACAGAAAAGAATTGGAAGAGGATGTGAAAAATAATCCTGATATGCTTTTAAAAGAAAGAGCTAAAAAATTTGGTGTAACTCCTGCTTCACTCTGTTATCAATTCAAAAAAATGAAAGTTACTAAGAAGAAAAACAGTTACTTTATCAAGAGAGAGATGCCCAAAAGCGAGCAGAATATCAGAAAATCTTGAGCCAATTAGTTTTA

CDS

ATGTACGATACTAAAAGTCCAGTATTTATAGACGAAGCTGGTTTTGAGGAATTTGTATCCTCACTTTATGGATGGTCTAAAAAGGGAGAAAGAGTATATGGAGAAAATCAGGGAAAAAGAGGGAAAAAAGAAAATCTTGCAGCAGGAAGAAGAAAAACGAAAAAAGACTTAATAGTGCCGATGTTATTCACAGGAAGCTTAAATGCAACGGGTTTTGAAGGATGGCTGGAATTCTTTTTAATACCAGCATTAACAGCTACATCAATCTTGATTATGGATAACGCCCCCATTCATCGAAAAAATAAGATTAGGGAAATAGTGAAATCCGCAGGACACACGGTGTTATTTTTGCCAACTTATTCCCCAGATTTGAATGATATAGAGCATGACTTTAGTGCATTAAAGAGAGCGAGAATGTACGCACCTTCCGGTACTAGCATAGATAAAGTTATTCAAGATTACTGCATATCTTAA

Protein

MYDTKSPVFIDEAGFEEFVSSLYGWSKKGERVYGENQGKRGKKENLAAGRRKTKKDLIVPMLFTGSLNATGFEGWLEFFLIPALTATSILIMDNAPIHRKNKIREIVKSAGHTVLFLPTYSPDLNDIEHDFSALKRARMYAPSGTSIDKVIQDYCIS