Your browser is old and dusty. Try Google Chrome!

Details for slr1279

ORF slr1279
Accession NP_441603.1
Symbol ndhC
Category NADH dehydrogenase
Definition NADH dehydrogenase subunit 3
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -99 -113 15.4376 0.104
NP_440557.1_1 Reverse -100 -119 3.93269 0.192
NP_440795.1_7 Forward -107 -100 14.6904 0.0123
NP_440795.1_7 Reverse -100 -107 14.6904 0.0123
NP_441418.1_6 Forward -108 -89 -11.8986 0.0576
NP_441418.1_6 Reverse -99 -118 -20.4534 0.114
NP_441418.1_6 Forward -321 -302 -29.5982 0.23
NP_441453.1_4 Reverse -99 -107 16.539 0.00633
NP_441453.1_4 Forward -108 -100 16.539 0.00633
NP_441453.1_4 Reverse -269 -277 4.14932 0.264
NP_441453.1_7 Forward -66 -59 11.6422 0.298
NP_441623.1_1 Reverse -71 -89 5.82068 0.156
NP_441623.1_1 Reverse -105 -123 -4.20908 0.274
NP_442151.1_6 Forward -108 -94 13.1759 0.0573
NP_442151.1_6 Reverse -99 -113 10.4227 0.123
NP_440561.1_4 Forward -280 -261 13.7941 0.229
NP_440226.1_1 Reverse -99 -118 9.3409 0.0734
NP_440226.1_1 Forward -108 -89 4.52268 0.188
NP_442655.1_1 Reverse -94 -113 6.98095 0.121
NP_442173.1_1 Forward -107 -99 15.4574 0.00633
NP_442173.1_1 Reverse -100 -108 15.4574 0.00633
NP_442752.1_4 Forward -108 -101 13.8055 0.0199
NP_442752.1_4 Reverse -99 -106 13.8055 0.0199
NP_443027.1_4 Forward -110 -100 13.2547 0.0521
NP_442975.1_10 Reverse -95 -109 1.76896 0.291
NP_440784.1_7 Forward -107 -100 15.9687 0.0123
NP_440784.1_7 Reverse -100 -107 15.9687 0.0123
NP_440061.1_9 Forward -110 -96 13.7653 0.076
NP_440061.1_9 Reverse -267 -281 8.16044 0.18
NP_440110.1_4 Forward -119 -100 2.75272 0.244
NP_441054.1_4 Reverse -89 -107 0.805796 0.173
NP_442062.1_3 Forward -194 -175 1.17943 0.23
NP_442062.1_8 Forward -108 -98 17.6796 0.00193
NP_442062.1_8 Reverse -269 -279 12.6647 0.0292
NP_442062.1_8 Reverse -99 -109 10.3048 0.0493
NP_440761.1_4 Reverse -94 -113 -4.03212 0.132
NP_440761.1_4 Forward -283 -264 -11.9969 0.218
NP_440304.1_4 Forward -280 -270 14.0414 0.051
NP_440304.1_4 Forward -110 -100 10.8948 0.051
NP_440304.1_4 Reverse -97 -107 9.91146 0.051
NP_442242.1_4 Forward -107 -100 14.3954 0.0124
NP_442242.1_4 Reverse -100 -107 14.3954 0.0124
NP_442602.1_3 Reverse -260 -279 0.786102 0.197
NP_441208.1_9 Reverse -96 -110 16.6175 0.0647
NP_441208.1_9 Reverse -1 -15 5.50613 0.267
NP_440764.1_3 Reverse -21 -39 10.8356 0.277
NP_440370.1_10 Reverse -90 -109 9.43923 0.229
NP_442110.1_7 Reverse -99 -113 12.3893 0.0586
NP_442896.1_7 Forward -380 -361 20.059 0.0141
NP_441925.1_4 Forward -47 -28 -6.19614 0.185
NP_441925.1_4 Reverse -304 -323 -14.9476 0.263
NP_440014.1_6 Forward -117 -98 5.89931 0.299
NP_440856.1_4 Forward -115 -96 9.14423 0.0576
NP_441083.1_5 Forward -108 -98 19.3512 0.000718
NP_441083.1_5 Reverse -99 -109 11.2881 0.0159
NP_441083.1_5 Reverse -311 -321 2.14332 0.195
NP_441083.1_5 Forward -278 -268 -0.118297 0.256
NP_441083.1_5 Reverse -269 -279 -0.314959 0.265
NP_441738.1_2 Forward -106 -99 15.28 0.0102
NP_441738.1_2 Reverse -101 -108 15.28 0.0102
NP_441558.1_5 Forward -110 -91 11.0125 0.0879
NP_440209.1_1 Reverse -99 -107 18.1123 0.00295
NP_440209.1_1 Forward -108 -100 18.1123 0.00295
NP_440447.1_1 Forward -113 -95 14.6705 0.104
NP_440447.1_6 Reverse -91 -109 6.31233 0.145
NP_440056.1_9 Reverse -94 -113 14.263 0.272
NP_441713.1_1 Reverse -93 -112 -13.0786 0.252
NP_441713.1_1 Forward -114 -95 -16.0285 0.275
NP_440178.1_7 Reverse -3 -22 -22.5183 0.267
NP_440053.1_2 Forward -330 -311 16.7157 0.152
NP_442570.1_3 Reverse -369 -388 -5.40875 0.243
NP_442570.1_3 Reverse -363 -382 -7.57203 0.272
NP_441716.1_1 Reverse -269 -283 15.6342 0.0473
NP_441716.1_1 Forward -108 -94 5.1128 0.24
NP_442111.1_4 Reverse -98 -112 20.1574 0.00327
NP_442111.1_4 Forward -109 -95 5.89945 0.145
NP_441163.1_1 Forward -286 -269 15.9677 0.174
NP_441533.1_7 Reverse -299 -317 11.2281 0.299
NP_440906.1_5 Forward -107 -100 15.8704 0.0124
NP_440906.1_5 Reverse -100 -107 15.8704 0.0124
NP_441924.1_9 Forward -58 -39 17.4032 0.197
NP_440747.1_10 Forward -111 -99 17.1486 0.000663
NP_440747.1_10 Reverse -96 -108 5.54551 0.0128
NP_440747.1_10 Reverse -374 -386 -12.2524 0.254
NP_440747.1_10 Reverse -266 -278 -12.3507 0.27
NP_441486.1_1 Forward -111 -97 -2.26202 0.175
NP_441486.1_1 Reverse -96 -110 -2.75368 0.175
NP_442634.1_2 Reverse -93 -112 0.491109 0.287
NP_442634.1_4 Reverse -97 -111 6.58777 0.0489
NP_442634.1_4 Forward -110 -96 -2.06536 0.149
NP_441265.1_3 Forward -114 -100 2.94952 0.181
NP_440403.1_4 Forward -373 -354 -10.227 0.297
NP_440842.1_10 Forward -273 -259 5.1128 0.251
NP_442848.1_9 Reverse -263 -282 15.2408 0.114
NP_442848.1_9 Forward -66 -47 2.0644 0.255
NP_443018.1_3 Forward -107 -100 14.8871 0.0123
NP_443018.1_3 Reverse -100 -107 14.8871 0.0123
NP_443018.1_3 Reverse -270 -277 10.7572 0.0907
NP_443018.1_3 Forward -277 -270 4.56234 0.241
NP_441316.1_7 Reverse -97 -112 -1.88839 0.24
NP_441634.1_8 Reverse -233 -247 7.17775 0.114
NP_441634.1_8 Forward -110 -96 -3.73699 0.295
NP_441634.1_8 Reverse -267 -281 -3.93365 0.295
NP_441634.1_8 Forward -64 -50 -4.13031 0.295
NP_440376.1_1 Forward -108 -99 19.4693 0.000692
NP_440376.1_1 Reverse -99 -108 19.4693 0.000692
NP_440376.1_1 Forward -278 -269 6.48957 0.0963
NP_440376.1_1 Reverse -269 -278 6.19458 0.109
NP_440376.1_1 Forward -364 -355 3.14632 0.207
NP_440376.1_1 Reverse -39 -48 -0.68859 0.291
NP_442687.1_7 Reverse -98 -108 18.5646 0.0028
NP_442687.1_7 Forward -279 -269 9.12481 0.0994
NP_442687.1_7 Forward -109 -99 9.02648 0.0994
NP_442687.1_7 Reverse -268 -278 7.35486 0.134
NP_442687.1_7 Reverse -203 -213 4.3066 0.255
NP_442191.1_4 Reverse -100 -114 18.2649 0.00956
NP_441797.1_8 Reverse -259 -278 21.6323 0.0443
NP_441846.1_10 Forward -330 -311 -21.4367 0.256
NP_441013.1_2 Reverse -372 -390 -2.53746 0.282
NP_441950.1_7 Forward -171 -152 -1.18052 0.191
NP_442658.1_1 Forward -280 -270 15.2208 0.0156
NP_442658.1_1 Reverse -97 -107 14.8275 0.0188
NP_442658.1_1 Forward -110 -100 14.2375 0.0237
NP_440141.1_8 Forward -287 -268 13.6675 0.156
NP_442782.1_2 Reverse -99 -113 8.16106 0.198
NP_442496.1_5 Forward -319 -301 4.44404 0.289
NP_441414.1_9 Forward -108 -89 -10.3253 0.28
NP_440184.1_5 Forward -374 -355 6.29264 0.224
NP_441487.1_9 Forward -109 -90 1.76941 0.196
NP_442937.1_5 Forward -317 -298 7.7676 0.241
NP_441958.1_5 Forward -109 -99 21.2195 0.000805
NP_441958.1_5 Reverse -98 -108 20.5312 0.000966
NP_441958.1_5 Forward -279 -269 1.06167 0.116
NP_441958.1_5 Reverse -268 -278 0.865012 0.12
NP_441127.1_1 Forward -321 -307 12.8809 0.206
NP_440203.1_5 Forward -105 -95 11.091 0.205
NP_440203.1_5 Reverse -272 -282 9.12434 0.271
NP_439905.1_1 Forward -121 -108 12.0157 0.204
NP_439905.1_1 Forward -107 -94 9.75405 0.216
NP_439905.1_1 Reverse -270 -283 7.88576 0.241
NP_440984.1_7 Reverse -94 -108 10.9143 0.122
NP_440984.1_7 Forward -113 -99 10.0294 0.126
NP_439990.1_5 Forward -113 -100 10.639 0.128
NP_442376.1_2 Reverse -94 -113 -12.6852 0.286
NP_442911.1_2 Forward -118 -99 -2.65548 0.1
NP_442911.1_2 Reverse -89 -108 -4.13045 0.126
NP_442911.1_2 Forward -288 -269 -7.4737 0.211
NP_440153.1_5 Reverse -100 -114 5.30946 0.191
NP_440153.1_8 Reverse -269 -282 3.85419 0.21
NP_442064.1_1 Reverse -94 -113 -12.9802 0.283
NP_443055.1_3 Reverse -90 -109 13.3189 0.179
NP_443055.1_6 Forward -122 -104 10.3431 0.126
NP_443055.1_6 Forward -48 -30 0.116744 0.249
NP_440993.1_2 Forward -113 -97 5.56507 0.234
NP_440993.1_3 Forward -118 -99 7.57013 0.141
NP_440827.1_3 Forward -119 -100 10.5209 0.298
NP_441099.1_5 Reverse -89 -108 -8.752 0.203
NP_442002.1_9 Reverse -98 -105 14.1004 0.074
NP_440809.1_9 Reverse -90 -108 -7.15901 0.225
NP_441646.1_7 Reverse -46 -60 15.9292 0.234
NP_442438.1_10 Forward -113 -99 1.76955 0.188
NP_442431.1_10 Forward -323 -305 3.55906 0.214
NP_441000.1_6 Reverse -98 -112 -3.04867 0.221
NP_442771.1_1 Reverse -97 -115 -3.71743 0.166
NP_440147.1_4 Reverse -97 -110 20.2755 0.00228
NP_440147.1_4 Forward -110 -97 10.639 0.0355
NP_440147.1_4 Reverse -267 -280 8.18076 0.0546
NP_440147.1_4 Forward -280 -267 -0.37404 0.282
NP_441550.1_8 Reverse -97 -107 17.6791 0.00754
NP_441550.1_8 Forward -110 -100 15.8108 0.0132
NP_441550.1_8 Reverse -267 -277 5.19112 0.26
NP_441916.1_7 Reverse -99 -109 18.9579 0.00144
NP_441916.1_7 Forward -108 -98 16.893 0.00407
NP_441916.1_7 Forward -278 -268 4.40493 0.178
NP_441916.1_10 Reverse -1 -20 1.57275 0.264
NP_441041.1_4 Forward -108 -89 -5.31042 0.151
NP_441041.1_4 Reverse -371 -390 -11.6036 0.25
NP_441041.1_7 Forward -111 -99 13.3454 0.0485
NP_441041.1_7 Reverse -96 -108 11.9849 0.0689
NP_440569.1_10 Reverse -113 -132 9.11906 0.231
NP_442004.1_6 Forward -108 -94 7.76774 0.156
NP_441725.1_4 Forward -113 -99 13.7653 0.0693
NP_441725.1_5 Reverse -270 -280 14.6313 0.0247
NP_441725.1_5 Forward -107 -97 11.7798 0.0247
NP_441725.1_5 Reverse -100 -110 1.94665 0.115
NP_439966.1_7 Forward -110 -100 14.3359 0.0203
NP_442941.1_3 Reverse -100 -110 19.2529 0.00262
NP_442941.1_3 Forward -107 -97 2.53664 0.14
NP_440289.1_2 Forward -111 -98 6.01747 0.0605
NP_440289.1_2 Reverse -96 -109 -2.34066 0.254
NP_440289.1_2 Reverse -266 -279 -4.20895 0.283
NP_440289.1_2 Forward -281 -268 -4.89726 0.294
NP_442281.1_1 Forward -113 -99 16.5185 0.00772
NP_442281.1_1 Reverse -94 -108 3.73557 0.221
NP_442281.1_1 Forward -379 -365 3.04726 0.246
NP_441334.1_7 Reverse -97 -116 -11.7019 0.124
NP_442256.1_2 Forward -110 -92 3.85406 0.107
NP_442256.1_2 Reverse -97 -115 -7.06068 0.214
NP_440437.1_1 Forward -114 -95 13.9625 0.0272
NP_440437.1_1 Reverse -339 -358 -0.885524 0.19
NP_440437.1_1 Forward -43 -24 -3.44213 0.236
NP_440647.1_9 Reverse -97 -115 10.6389 0.175
NP_440647.1_9 Forward -110 -92 6.90232 0.219
NP_442012.1_1 Forward -114 -95 5.99764 0.138
NP_441556.1_7 Forward -68 -49 6.98015 0.171
NP_441556.1_10 Reverse -94 -108 15.6727 0.144
NP_442982.1_5 Forward -118 -99 17.699 0.0484
NP_441644.1_6 Reverse -99 -109 19.0557 0.000803
NP_441644.1_6 Forward -108 -98 15.7125 0.0048
NP_441644.1_6 Reverse -269 -279 10.0093 0.0649
NP_441644.1_6 Forward -278 -268 4.69947 0.228
NP_441644.1_6 Reverse -4 -14 3.42118 0.282
NP_442215.1_2 Reverse -97 -113 0.648521 0.148
NP_442215.1_2 Reverse -50 -66 -2.69473 0.202
NP_442247.1_8 Forward -110 -96 10.7177 0.247
NP_440929.1_8 Forward -108 -99 19.2726 0.000701
NP_440929.1_8 Reverse -99 -108 19.2726 0.000701
NP_442933.1_10 Forward -108 -99 17.601 0.00325
NP_442933.1_10 Reverse -99 -108 17.601 0.00325
NP_442933.1_10 Forward -278 -269 4.52295 0.24
NP_441751.2_8 Reverse -100 -114 -2.16369 0.132
NP_441751.2_8 Forward -107 -93 -5.50694 0.214
NP_442554.1_8 Reverse -100 -110 17.2863 0.00543
NP_442554.1_8 Forward -107 -97 14.238 0.0144
NP_442554.1_8 Reverse -270 -280 6.66654 0.111
NP_442554.1_8 Forward -277 -267 4.89658 0.168
NP_441762.1_7 Reverse -98 -110 1.7106 0.0735
NP_441762.1_7 Forward -109 -97 0.432302 0.0747
NP_442142.1_4 Forward -111 -98 6.21356 0.17
NP_442142.1_4 Reverse -96 -109 3.36198 0.258
NP_442142.1_4 Forward -389 -376 2.28034 0.295
NP_442292.1_1 Reverse -100 -109 17.5026 0.00435
NP_442292.1_1 Forward -107 -98 9.53783 0.0183
NP_440919.1_1 Reverse -108 -127 -1.96717 0.221
NP_442381.1_8 Reverse -352 -371 -12.5869 0.267
NP_441523.1_6 Forward -112 -93 12.7825 0.161
NP_443009.1_5 Forward -109 -98 17.0694 0.00659
NP_443009.1_5 Reverse -98 -109 16.7744 0.00677
NP_443009.1_5 Reverse -268 -279 12.0545 0.0561
NP_443009.1_5 Forward -279 -268 7.43299 0.129
NP_442408.2_1 Reverse -99 -118 2.94938 0.16
NP_441715.1_4 Reverse -100 -110 16.7946 0.0106
NP_440357.1_3 Forward -281 -262 0.0977854 0.285
NP_440183.1_9 Forward -276 -257 -15.1435 0.273
NP_441198.1_8 Forward -280 -270 13.2713 0.108
NP_441198.1_8 Reverse -97 -107 12.5877 0.12
NP_440379.1_5 Reverse -95 -114 -5.9004 0.227
NP_440379.1_5 Reverse -21 -40 -11.1119 0.288
NP_441468.1_1 Forward -107 -100 15.8704 0.0124
NP_441468.1_1 Reverse -100 -107 15.8704 0.0124
NP_441468.1_1 Forward -277 -270 4.07068 0.263
NP_441618.1_7 Reverse -100 -119 12.626 0.295
NP_441020.2_6 Reverse -97 -114 13.4119 0.0736
NP_441020.2_6 Forward -323 -306 7.61033 0.225
NP_440742.1_10 Reverse -264 -283 10.4225 0.293
NP_441015.1_10 Reverse -26 -45 -0.885524 0.169
NP_441015.1_10 Forward -317 -298 -10.1286 0.283
NP_441015.1_10 Reverse -94 -113 -11.0136 0.29
NP_441673.1_1 Forward -108 -99 20.8459 0.000698
NP_441673.1_1 Reverse -99 -108 20.8459 0.000698
NP_441673.1_1 Forward -278 -269 1.37636 0.114
NP_441673.1_1 Reverse -269 -278 1.1797 0.163
NP_441731.1_3 Forward -116 -97 -4.72043 0.284
NP_441339.1_4 Forward -355 -336 -4.42544 0.249
NP_441876.1_9 Reverse -54 -64 11.6809 0.275
NP_441876.1_9 Reverse -275 -285 10.9926 0.28
NP_441826.1_2 Reverse -263 -277 2.06454 0.136
NP_441826.1_2 Forward -114 -100 -1.77037 0.254
NP_441826.1_5 Reverse -37 -56 15.3391 0.102
NP_441330.1_1 Forward -113 -94 -12.5869 0.183
NP_442868.1_6 Forward -110 -100 10.4031 0.038
NP_442868.1_6 Reverse -97 -107 9.12481 0.0539
NP_442868.1_6 Forward -280 -270 3.81494 0.192
NP_442719.1_2 Reverse -333 -351 -11.0929 0.287
NP_442227.1_2 Forward -50 -31 -3.44213 0.293
NP_442361.1_3 Forward -114 -101 10.049 0.272
NP_442427.1_5 Reverse -269 -288 1.86774 0.286
NP_442808.1_1 Reverse -98 -108 8.73102 0.0481
NP_442808.1_1 Forward -109 -99 8.73102 0.0481
NP_441101.1_10 Reverse -265 -284 0.687771 0.173
NP_441101.1_10 Forward -112 -93 -7.17871 0.29
NP_440918.1_2 Forward -163 -144 15.9291 0.233
NP_440145.1_3 Forward -118 -99 -5.80207 0.279
NP_440145.1_4 Reverse -312 -322 14.7292 0.231
NP_442820.1_3 Reverse -332 -342 14.8275 0.277
NP_442542.1_2 Forward -280 -267 16.9322 0.0522
NP_442542.1_9 Forward -115 -101 10.2254 0.119
NP_442050.1_5 Forward -110 -100 15.9091 0.0091
NP_442050.1_5 Reverse -97 -107 6.96107 0.27
NP_440038.1_4 Reverse -337 -356 0.294447 0.277
NP_441493.2_7 Reverse -138 -157 15.9291 0.159
NP_441114.1_3 Reverse -271 -280 7.57121 0.231
NP_440558.1_2 Reverse -266 -285 7.47261 0.119
NP_440558.1_2 Reverse -336 -355 -5.9004 0.267
NP_441518.1_4 Reverse -304 -323 14.1583 0.127
NP_441878.1_6 Reverse -98 -108 20.2362 0.0046
NP_441878.1_6 Forward -279 -269 12.0747 0.013
NP_441878.1_6 Reverse -268 -278 10.9931 0.0176
NP_441878.1_6 Forward -109 -99 10.5014 0.0176
NP_441878.1_6 Reverse -3 -13 -7.59145 0.245
NP_441036.1_8 Forward -109 -99 15.713 0.00724
NP_441036.1_8 Reverse -364 -374 11.4848 0.119
NP_441036.1_8 Reverse -98 -108 8.4365 0.174
NP_441557.1_5 Forward -108 -99 19.9609 0.000699
NP_441557.1_5 Reverse -99 -108 19.9609 0.000699
NP_441557.1_5 Forward -278 -269 0.491382 0.144
NP_441557.1_5 Reverse -269 -278 0.29472 0.174
NP_441557.1_8 Reverse -312 -322 10.5993 0.28
NP_441445.1_1 Reverse -90 -109 9.43923 0.104
NP_441445.1_1 Forward -287 -268 1.0811 0.262
NP_440101.1_3 Reverse -94 -113 12.5858 0.0849
NP_442166.1_7 Reverse -100 -114 13.3726 0.175
NP_440979.1_3 Forward -107 -89 12.7038 0.234
NP_441574.1_1 Forward -324 -305 1.76941 0.172
NP_441549.1_9 Reverse -95 -113 3.85406 0.0925
NP_442347.1_2 Reverse -53 -62 4.0313 0.284
NP_442347.1_2 Forward -107 -98 3.34298 0.284
NP_442347.1_2 Reverse -100 -109 3.34298 0.284
NP_442645.1_2 Reverse -261 -280 -16.6185 0.237
NP_442645.1_2 Reverse -91 -110 -21.7317 0.29
NP_442965.1_2 Forward -369 -350 -8.65367 0.294
NP_441037.1_4 Reverse -97 -107 17.3558 0.0127
NP_441037.1_4 Forward -280 -270 7.9999 0.237
NP_441037.1_4 Forward -110 -100 7.22024 0.237
NP_442594.1_8 Forward -332 -313 9.14423 0.199
NP_441633.1_3 Forward -110 -97 5.72248 0.0481
NP_441633.1_3 Reverse -267 -280 -3.52063 0.177
NP_441633.1_3 Reverse -97 -110 -6.07724 0.236
NP_440136.1_2 Forward -107 -100 15.9687 0.0123
NP_440136.1_2 Reverse -100 -107 15.9687 0.0123
NP_442590.1_10 Reverse -92 -111 12.3892 0.145
NP_442998.1_10 Forward -106 -99 15.5754 0.0102
NP_442998.1_10 Reverse -101 -108 15.5754 0.0102
NP_440899.1_2 Forward -119 -100 9.04509 0.187
NP_440299.1_1 Forward -112 -99 11.1301 0.0518
NP_440299.1_1 Reverse -95 -108 7.00021 0.124
NP_440299.1_1 Reverse -265 -278 6.50855 0.139
NP_441799.1_1 Reverse -95 -109 21.5334 0.0036
NP_441007.1_10 Reverse -94 -107 1.88757 0.203
NP_441007.1_10 Forward -113 -100 1.29759 0.203
NP_442334.1_2 Reverse -28 -45 -13.9242 0.297
NP_442333.2_5 Forward -119 -100 -15.3402 0.291
NP_440256.1_1 Reverse -96 -115 -8.35868 0.259
NP_440087.1_1 Reverse -90 -109 -4.52377 0.246
NP_441559.1_8 Forward -113 -99 10.9143 0.0574
NP_441559.1_8 Reverse -328 -342 2.06454 0.148
NP_441559.1_8 Forward -283 -269 -0.295402 0.175
NP_441559.1_8 Reverse -360 -374 -5.50694 0.264
NP_441559.1_8 Reverse -338 -352 -6.58858 0.279
NP_441559.1_8 Reverse -94 -108 -6.78525 0.279
NP_440915.1_5 Reverse -29 -48 14.4212 0.283
NP_440915.1_6 Forward -112 -98 18.3875 0.0114
NP_440915.1_6 Forward -282 -268 2.06454 0.126
NP_440915.1_6 Reverse -265 -279 0.982901 0.148
NP_440915.1_6 Reverse -361 -375 -0.688726 0.205
NP_440915.1_6 Reverse -34 -48 -1.5737 0.239
NP_440915.1_6 Reverse -95 -109 -2.75368 0.28
NP_440717.1_1 Forward -121 -102 5.40766 0.272
NP_442785.1_7 Forward -110 -96 20.1574 0.0439
NP_442452.1_8 Forward -114 -100 11.897 0.273
NP_440748.1_5 Forward -389 -370 2.85105 0.214
NP_441464.1_8 Forward -108 -94 15.9292 0.0995
NP_441464.1_8 Reverse -269 -283 9.93102 0.187
NP_440026.1_4 Reverse -96 -115 8.75091 0.261
NP_440787.1_5 Forward -130 -116 10.3243 0.256
NP_440695.1_5 Forward -108 -89 4.81767 0.189
NP_441939.1_3 Reverse -100 -119 17.109 0.0325
NP_441494.1_6 Forward -113 -100 6.01747 0.289
NP_439985.1_7 Reverse -93 -112 3.6377 0.261
NP_441417.1_2 Reverse -40 -59 3.73603 0.167
NP_442386.1_9 Forward -109 -100 6.39082 0.219
NP_442386.1_9 Reverse -98 -107 6.39082 0.219
NP_441750.1_1 Forward -318 -299 -13.2752 0.3
NP_441340.1_5 Forward -107 -100 15.6737 0.0124
NP_441340.1_5 Reverse -100 -107 15.6737 0.0124
NP_441340.1_5 Reverse -270 -277 3.97235 0.274
NP_441947.1_4 Reverse -88 -107 11.2092 0.267
NP_440168.1_9 Forward -280 -261 -5.50708 0.296
NP_442240.1_1 Reverse -104 -123 4.62021 0.273
NP_442240.1_2 Reverse -100 -119 -0.787193 0.0609
NP_442240.1_2 Forward -71 -52 -12.6852 0.163
NP_442714.1_7 Reverse -270 -289 1.47442 0.226
NP_440586.1_1 Forward -322 -303 -4.13045 0.278
NP_440586.1_1 Forward -325 -306 -4.81876 0.278
NP_440586.1_8 Forward -107 -100 13.2151 0.026
NP_440586.1_8 Reverse -100 -107 13.2151 0.026
NP_440586.1_8 Forward -385 -378 9.18354 0.171
NP_442251.1_6 Forward -107 -100 15.2804 0.0124
NP_442251.1_6 Reverse -100 -107 15.2804 0.0124
NP_440684.1_9 Reverse -232 -246 7.07942 0.28
NP_441262.1_3 Reverse -99 -106 14.7888 0.0223
NP_441262.1_3 Forward -108 -101 14.7888 0.0223
NP_441262.1_5 Forward -334 -315 3.24438 0.285
NP_440027.1_3 Reverse -147 -165 6.50823 0.225
NP_440027.1_3 Reverse -269 -287 3.16499 0.278
NP_443051.1_1 Forward -109 -100 19.5676 0.00335
NP_443051.1_1 Reverse -98 -107 18.0926 0.00402
NP_439984.1_7 Forward -106 -88 -4.99573 0.292
NP_439937.1_9 Reverse -268 -285 10.5595 0.0407
NP_439937.1_9 Reverse -47 -64 -10.0899 0.221
NP_439937.1_9 Reverse -350 -367 -13.0398 0.279
NP_439937.1_9 Forward -109 -92 -14.4164 0.287
NP_440371.1_4 Reverse -270 -289 8.94676 0.286
NP_440439.1_1 Forward -111 -98 20.0788 0.0105
NP_440439.1_1 Reverse -96 -109 2.37923 0.135
NP_440372.1_2 Forward -107 -100 16.3621 0.0124
NP_440372.1_2 Reverse -100 -107 16.3621 0.0124
NP_440271.1_2 Forward -287 -268 -0.000545616 0.292
NP_441789.1_7 Reverse -302 -321 -1.67294 0.253
NP_441789.1_7 Reverse -313 -332 -3.04956 0.268
NP_440316.1_10 Forward -279 -269 6.8632 0.251
NP_442488.1_4 Reverse -20 -39 8.06259 0.298
NP_441803.1_2 Forward -66 -47 8.65258 0.112
NP_441803.1_2 Forward -113 -94 3.34271 0.191
NP_441572.1_7 Forward -114 -95 8.55425 0.074
NP_441155.1_2 Forward -255 -236 13.9625 0.28
NP_440267.1_2 Forward -113 -99 11.5037 0.125
NP_442384.1_10 Reverse -99 -112 18.8988 0.00338
NP_442384.1_10 Forward -108 -95 17.7189 0.00567
NP_442384.1_10 Forward -278 -265 11.229 0.0372
NP_441018.1_7 Forward -170 -151 8.75091 0.241
NP_442790.1_4 Forward -117 -98 -14.5535 0.278
NP_442262.1_10 Forward -107 -100 14.1988 0.0123
NP_442262.1_10 Reverse -100 -107 14.1988 0.0123
NP_442262.1_10 Reverse -270 -277 9.87221 0.164
NP_441689.1_5 Forward -110 -100 8.3377 0.132
NP_440344.1_10 Reverse -92 -109 -11.8592 0.231
NP_440531.1_6 Forward -116 -97 -4.03212 0.273
NP_440531.1_6 Reverse -91 -110 -4.81876 0.287
NP_442832.1_2 Forward -391 -372 13.9625 0.239
NP_442529.1_4 Reverse -90 -109 10.4225 0.227
NP_440297.1_9 Forward -107 -97 9.61647 0.0917
NP_440297.1_9 Reverse -270 -280 7.25653 0.136
NP_440297.1_9 Forward -277 -267 0.865012 0.282
NP_440297.1_9 Reverse -100 -110 -0.216628 0.282
NP_440350.1_5 Reverse -284 -303 -6.39206 0.296
NP_441896.1_3 Reverse -90 -109 -1.37718 0.258
NP_440894.1_10 Reverse -94 -113 5.11266 0.238
NP_443036.1_3 Reverse -108 -125 13.0185 0.299
NP_443036.1_8 Reverse -35 -54 11.4058 0.283
NP_440999.1_1 Forward -42 -23 2.6536 0.249
NP_440999.1_9 Forward -112 -98 7.9644 0.0802
NP_440999.1_9 Forward -41 -27 2.16287 0.154
NP_440999.1_9 Reverse -95 -109 -3.24533 0.289
NP_440888.1_2 Reverse -99 -113 15.9285 0.00837
NP_440888.1_2 Reverse -269 -283 7.57046 0.19
NP_440888.1_2 Reverse -339 -353 6.0955 0.249
NP_441771.1_4 Forward -144 -125 -3.54046 0.292
NP_440179.1_6 Forward -347 -328 18.9773 0.0681
NP_440179.1_6 Forward -107 -88 16.5191 0.0681
NP_440491.1_1 Reverse -96 -115 8.7687 0.228
NP_440052.1_5 Reverse -258 -277 -3.83545 0.246
NP_439969.1_3 Reverse -94 -113 -1.7705 0.283
NP_442277.1_4 Forward -117 -98 13.47 0.0528
NP_442033.1_10 Reverse -267 -286 -2.75381 0.156
NP_442033.1_10 Reverse -353 -372 -3.14714 0.165
NP_442033.1_10 Reverse -97 -116 -9.24366 0.212
NP_441123.1_6 Forward -116 -98 14.0805 0.132
NP_441543.1_2 Reverse -100 -109 15.9293 0.00518
NP_441543.1_2 Forward -107 -98 9.34117 0.0818
NP_442845.1_2 Forward -354 -340 6.88276 0.201
NP_441551.1_5 Reverse -95 -111 9.89093 0.201
NP_441551.1_5 Reverse -236 -252 7.236 0.249
NP_441178.1_4 Forward -115 -96 14.1591 0.162
NP_441469.1_8 Reverse -98 -107 13.3727 0.073
NP_441469.1_8 Forward -279 -270 9.63616 0.227
NP_441469.1_8 Forward -109 -100 6.5879 0.227
NP_443064.1_6 Forward -108 -98 13.8273 0.0796
NP_443064.1_6 Reverse -99 -109 10.8217 0.13
NP_442578.1_5 Reverse -352 -371 -0.0988766 0.283
NP_442578.1_5 Forward -50 -31 -0.39387 0.289
NP_442578.1_7 Forward -107 -100 14.5921 0.026
NP_442578.1_7 Reverse -100 -107 14.5921 0.026
NP_440710.1_1 Forward -116 -98 1.29745 0.14
NP_440710.1_1 Reverse -261 -279 -0.964162 0.179
NP_441462.1_2 Reverse -99 -109 20.2362 0.000805
NP_441462.1_2 Forward -108 -98 20.1379 0.000967
NP_441462.1_2 Forward -278 -268 0.668351 0.135
NP_441462.1_2 Reverse -269 -279 0.471689 0.148
NP_441462.1_5 Forward -325 -306 1.0811 0.291
NP_441621.1_7 Reverse -97 -111 2.65453 0.123
NP_443062.1_6 Forward -286 -267 13.8641 0.088
NP_443062.1_6 Reverse -91 -110 4.12936 0.221
NP_441410.1_3 Forward -117 -98 12.8808 0.154
NP_440519.1_8 Forward -354 -338 3.20513 0.251
NP_442204.1_1 Forward -112 -101 21.1015 0.0035
NP_442204.1_2 Forward -118 -99 6.4893 0.287
NP_442204.1_6 Reverse -22 -41 4.42435 0.291
NP_440516.1_2 Reverse -93 -111 -0.472507 0.253
NP_440516.1_6 Reverse -270 -284 12.782 0.196
NP_440516.1_8 Forward -108 -99 16.9127 0.00442
NP_440516.1_8 Reverse -99 -108 16.9127 0.00442
NP_442428.1_5 Forward -107 -100 15.8704 0.0124
NP_442428.1_5 Reverse -100 -107 15.8704 0.0124
NP_442428.1_5 Forward -277 -270 4.46401 0.267
NP_441835.1_2 Forward -287 -268 4.916 0.27
NP_440673.1_2 Reverse -89 -108 10.1945 0.22
NP_440673.1_2 Forward -322 -303 8.341 0.273
NP_440673.1_2 Reverse -259 -278 8.341 0.273
NP_440673.1_3 Forward -106 -99 12.4288 0.0426
NP_440673.1_3 Reverse -101 -108 12.4288 0.0426
NP_440673.1_3 Reverse -271 -278 8.98723 0.203
NP_440865.1_9 Forward -380 -361 -8.55534 0.264
NP_443048.1_6 Forward -325 -306 22.8903 0.0428
NP_441052.1_2 Forward -108 -98 10.4031 0.0285
NP_441052.1_2 Reverse -99 -109 10.4031 0.0285
NP_441052.1_2 Forward -386 -376 4.69992 0.149
NP_442219.1_9 Forward -107 -98 8.25953 0.0681
NP_442219.1_9 Reverse -100 -109 8.25953 0.0681
NP_440436.1_4 Forward -107 -98 15.9289 0.00508
NP_440436.1_4 Reverse -270 -279 9.73406 0.0871
NP_440436.1_4 Reverse -100 -109 9.24241 0.0871
NP_441884.1_9 Reverse -96 -115 -23.895 0.284
NP_440314.1_9 Forward -107 -88 9.24257 0.0338
NP_440648.1_1 Reverse -99 -118 4.916 0.219
NP_441719.1_4 Forward -107 -100 16.3621 0.0124
NP_441719.1_4 Reverse -100 -107 16.3621 0.0124
NP_441733.1_10 Reverse -35 -48 5.32916 0.218
NP_441733.1_10 Forward -111 -98 4.05085 0.276
NP_441004.1_1 Forward -318 -299 -6.49039 0.188
NP_441004.1_1 Forward -370 -351 -15.0452 0.271
NP_441004.1_2 Forward -323 -304 10.9142 0.145
NP_441004.1_4 Forward -281 -271 10.3048 0.254
NP_441004.1_4 Forward -315 -305 9.22315 0.259
NP_441004.1_4 Reverse -1 -11 9.02648 0.259
NP_442366.1_3 Reverse -98 -116 9.85225 0.0535
NP_442366.1_5 Reverse -96 -106 17.2858 0.0141
NP_439949.1_7 Reverse -109 -123 10.0294 0.296
NP_440296.1_10 Reverse -96 -115 -14.0619 0.269
NP_440296.1_10 Forward -323 -304 -15.0452 0.281
NP_441115.1_4 Reverse -98 -116 8.76983 0.237
NP_442206.1_10 Reverse -99 -114 4.40479 0.178
NP_442854.1_4 Forward -113 -94 12.29 0.243
NP_440328.1_4 Forward -114 -95 20.059 0.0147
NP_440328.1_4 Reverse -93 -112 2.0644 0.211
NP_443054.1_2 Forward -110 -96 6.6861 0.185
NP_443054.1_2 Reverse -267 -281 0.294584 0.269
NP_441851.1_10 Reverse -98 -108 17.4829 0.0027
NP_441851.1_10 Forward -109 -99 8.53483 0.114
NP_441851.1_10 Forward -279 -269 6.27322 0.178
NP_441851.1_10 Reverse -268 -278 5.97822 0.19
NP_442622.1_3 Forward -56 -37 -0.688862 0.215
NP_442856.1_7 Forward -117 -98 -3.24547 0.242
NP_442515.1_1 Forward -109 -95 5.30946 0.107
NP_442515.1_1 Forward -279 -265 2.35953 0.137
NP_442515.1_1 Reverse -203 -217 0.786239 0.18
NP_442515.1_1 Reverse -268 -282 -4.62196 0.298
NP_442515.1_1 Reverse -98 -112 -4.7203 0.298
NP_440593.1_3 Forward -91 -72 2.3594 0.175
NP_440593.1_3 Reverse -298 -317 -3.83545 0.242
NP_440593.1_3 Forward -353 -334 -7.67036 0.298
NP_440165.1_5 Reverse -98 -117 -5.40875 0.22
NP_442709.1_3 Reverse -92 -111 11.7008 0.109
NP_442709.1_3 Forward -381 -362 3.93269 0.268
NP_441409.1_6 Reverse -93 -112 1.67108 0.0586
NP_441409.1_8 Forward -209 -190 8.17337 0.272
NP_440432.1_9 Reverse -100 -115 -3.06836 0.179
NP_441150.1_5 Forward -68 -50 14.3755 0.24
NP_442450.1_5 Reverse -97 -107 17.3846 0.0267
NP_440588.1_2 Forward -117 -98 8.84924 0.0446
NP_442243.1_1 Forward -114 -96 4.34495 0.2
NP_441570.1_1 Reverse -99 -117 -10.5023 0.171
NP_441078.1_4 Forward -108 -99 19.6659 0.0007
NP_441078.1_4 Reverse -99 -108 19.6659 0.0007
NP_441078.1_4 Forward -278 -269 8.1612 0.039
NP_441078.1_4 Reverse -269 -278 0.983037 0.151
NP_442729.1_5 Forward -313 -303 8.4365 0.248
NP_441663.1_8 Forward -114 -95 15.1424 0.0471
NP_440707.1_6 Forward -116 -97 13.8633 0.172
NP_440707.1_7 Reverse -24 -43 9.14423 0.207
NP_441094.1_1 Forward -54 -40 19.1735 0.247
NP_440526.1_3 Forward -107 -96 1.6315 0.267
NP_440526.1_3 Reverse -270 -281 1.53316 0.267
NP_441432.1_8 Forward -109 -100 16.8143 0.00595
NP_441432.1_8 Reverse -98 -107 8.35786 0.0755
NP_441432.1_8 Forward -279 -270 6.5879 0.112
NP_441432.1_9 Reverse -117 -130 18.0032 0.0521
NP_441732.1_2 Forward -112 -96 3.20513 0.0141
NP_441732.1_2 Reverse -95 -111 -17.2477 0.247
NP_441030.1_6 Reverse -97 -116 16.3171 0.155
NP_442003.1_4 Forward -107 -88 11.7992 0.272
NP_440760.1_1 Forward -108 -89 -10.6203 0.084
NP_440760.1_1 Forward -278 -259 -11.8003 0.0882
NP_440760.1_1 Reverse -99 -118 -22.125 0.249
NP_442797.1_7 Forward -115 -97 -0.472507 0.283
NP_440913.1_1 Forward -168 -150 6.31233 0.228
NP_440913.1_3 Reverse -15 -28 17.2272 0.184
NP_441023.1_1 Reverse -99 -117 12.0155 0.233
NP_440713.1_4 Forward -358 -339 2.55606 0.26
NP_440713.1_4 Reverse -367 -386 1.27776 0.289
NP_442489.1_7 Forward -108 -99 20.1576 0.000695
NP_442489.1_7 Reverse -99 -108 20.1576 0.000695
NP_442489.1_7 Forward -278 -269 8.1612 0.0294
NP_442489.1_7 Reverse -269 -278 7.76787 0.0518
NP_440386.1_3 Forward -131 -112 -4.42544 0.221
NP_440559.1_1 Forward -107 -98 17.306 0.00658
NP_440559.1_1 Reverse -100 -109 8.65285 0.0586
NP_440559.1_1 Forward -277 -268 4.32629 0.288
NP_441659.2_8 Reverse -99 -109 20.9245 0.000805
NP_441659.2_8 Forward -108 -98 19.3512 0.000966
NP_441659.2_8 Reverse -269 -279 7.45319 0.0601
NP_441659.2_8 Forward -278 -268 0.176696 0.271
NP_440426.1_7 Forward -118 -99 0.491109 0.262
NP_442913.1_10 Reverse -90 -109 12.1925 0.0397
NP_442913.1_10 Forward -117 -98 -0.295539 0.158
NP_442913.1_10 Reverse -260 -279 -4.22878 0.23
NP_441040.1_2 Forward -117 -98 -14.8485 0.286
NP_441040.1_2 Reverse -261 -280 -15.4385 0.286
NP_439956.1_7 Forward -284 -265 4.12936 0.257
NP_442008.1_2 Reverse -96 -115 13.7658 0.0822
NP_442008.1_2 Forward -389 -370 6.88262 0.216
NP_442008.1_2 Forward -377 -358 2.65439 0.282
NP_440708.1_6 Reverse -345 -364 -10.4236 0.278
NP_442776.1_1 Reverse -52 -71 3.93269 0.279
NP_442346.1_5 Reverse -98 -108 17.9746 0.00128
NP_442346.1_5 Forward -109 -99 16.303 0.00248
NP_442346.1_5 Forward -279 -269 14.4347 0.0134
NP_442346.1_5 Reverse -268 -278 7.64985 0.162
NP_440545.1_3 Reverse -95 -112 15.0835 0.0136
NP_440545.1_3 Forward -112 -95 8.10198 0.0463
NP_440545.1_3 Forward -282 -265 6.92201 0.0532
NP_440545.1_3 Reverse -265 -282 -3.5994 0.208
NP_441856.1_3 Reverse -96 -115 0.786102 0.213
NP_441856.1_3 Forward -111 -92 -2.85214 0.272
NP_440025.1_3 Reverse -266 -280 18.3558 0.0917
NP_440025.1_3 Forward -216 -202 13.9024 0.235
NP_440025.1_3 Forward -125 -111 10.514 0.29
NP_441629.1_1 Reverse -91 -110 9.83255 0.186
NP_441629.1_3 Forward -115 -96 -2.65624 0.272
NP_440486.1_6 Reverse -139 -158 8.84924 0.235
NP_440486.1_6 Forward -319 -300 5.89931 0.287
NP_441943.1_8 Forward -69 -50 -13.3736 0.265
NP_442551.1_4 Reverse -267 -282 -1.5934 0.246
NP_442603.1_7 Reverse -99 -113 10.5204 0.125
NP_442603.1_7 Forward -108 -94 8.55376 0.171
NP_442603.1_7 Reverse -311 -325 5.99717 0.264
NP_441585.1_5 Reverse -146 -165 0.293673 0.291
NP_441888.1_7 Forward -113 -99 3.8345 0.225
NP_441888.1_7 Reverse -264 -278 1.67122 0.241
NP_440946.1_6 Forward -323 -304 1.0811 0.294
NP_440449.1_6 Forward -116 -98 6.69963 0.241
NP_441948.1_4 Reverse -92 -110 1.00246 0.134
NP_441833.1_4 Forward -107 -100 15.9687 0.0124
NP_441833.1_4 Reverse -100 -107 15.9687 0.0124
NP_442162.1_9 Forward -107 -100 16.2637 0.0124
NP_442162.1_9 Reverse -100 -107 16.2637 0.0124
NP_440224.1_1 Forward -119 -100 0.58944 0.133
NP_442943.1_1 Forward -230 -215 6.26385 0.206
NP_442140.1_3 Forward -107 -97 13.5497 0.0542
NP_442140.1_3 Reverse -100 -110 4.69992 0.238
NP_440875.1_9 Reverse -101 -111 16.5483 0.0145
NP_441813.1_5 Forward -110 -100 18.1713 0.00743
NP_441813.1_5 Reverse -97 -107 8.82982 0.0367
NP_440594.1_8 Forward -107 -94 10.9334 0.153
NP_440590.1_4 Reverse -100 -113 4.44418 0.0601
NP_440590.1_4 Forward -107 -94 3.36254 0.0746
NP_440567.1_1 Reverse -100 -114 6.78443 0.0803
NP_440567.1_1 Forward -107 -93 6.3911 0.0837
NP_442497.1_10 Forward -107 -98 19.8626 0.00532
NP_442497.1_10 Reverse -100 -109 17.601 0.00813
NP_442497.1_10 Forward -277 -268 0.393051 0.175
NP_442497.1_10 Reverse -270 -279 0.196389 0.208
NP_440821.1_4 Reverse -97 -107 10.9931 0.0146
NP_440821.1_4 Forward -110 -100 2.24165 0.131
NP_440821.1_4 Forward -280 -270 0.0783647 0.205
NP_441239.1_9 Forward -110 -98 16.5586 0.0166
NP_441239.1_9 Forward -280 -268 15.6736 0.0186
NP_441239.1_9 Reverse -97 -109 10.7571 0.0723
NP_441239.1_9 Reverse -267 -279 7.70879 0.15
NP_442568.1_8 Forward -301 -287 10.7177 0.257
NP_440400.1_1 Forward -55 -36 -1.37794 0.285
NP_441892.1_1 Reverse -90 -107 -4.77938 0.268
NP_441892.1_1 Forward -287 -270 -5.27103 0.276
NP_441892.1_1 Forward -117 -100 -5.66436 0.285
NP_442044.1_1 Forward -113 -94 -4.42544 0.177
NP_442044.1_1 Forward -320 -301 -8.35868 0.251
NP_442193.1_8 Reverse -330 -349 15.0432 0.211
NP_441017.1_6 Forward -55 -41 13.077 0.208
NP_442138.1_10 Reverse -99 -118 -2.85214 0.22
NP_442052.1_8 Reverse -97 -107 12.7631 0.253
NP_442052.1_8 Forward -280 -270 12.7631 0.253
NP_440546.1_4 Reverse -99 -109 13.5365 0.0459
NP_440546.1_4 Forward -108 -98 12.8578 0.0572
NP_440546.1_4 Forward -320 -310 9.17338 0.151
NP_441230.1_3 Reverse -267 -286 22.0256 0.014
NP_441230.1_5 Forward -113 -94 1.57275 0.239
NP_441230.1_5 Reverse -37 -56 -0.787193 0.292
NP_440462.1_6 Forward -110 -100 18.7612 0.00454
NP_440462.1_6 Reverse -97 -107 1.455 0.294
NP_442465.1_6 Forward -300 -281 18.8592 0.295
NP_442611.1_1 Reverse -99 -118 15.3391 0.0513
NP_440868.1_4 Reverse -95 -107 11.052 0.0358
NP_440868.1_4 Forward -112 -100 8.00379 0.0602
NP_440868.1_8 Reverse -95 -114 -4.72043 0.263
NP_442499.1_1 Forward -113 -94 5.99764 0.215
NP_442402.1_1 Reverse -347 -366 9.73422 0.268
NP_442402.1_4 Reverse -336 -355 -8.16275 0.278
NP_442402.1_4 Reverse -347 -366 -10.031 0.296
NP_441848.1_4 Reverse -197 -213 9.556 0.277
NP_441848.1_9 Forward -41 -30 11.5629 0.268
NP_440696.1_3 Reverse -95 -113 2.96908 0.213
NP_440696.1_3 Forward -166 -148 -3.22577 0.284
NP_440696.1_6 Forward -332 -313 6.09597 0.266
NP_442039.1_4 Forward -107 -100 15.1821 0.0124
NP_442039.1_4 Reverse -100 -107 15.1821 0.0124
NP_442039.1_7 Forward -127 -117 12.3697 0.236
NP_441811.1_8 Reverse -93 -107 14.9459 0.162
NP_441811.1_8 Forward -284 -270 6.58777 0.267
NP_440825.1_7 Forward -107 -97 11.8361 0.2
NP_442837.1_3 Forward -107 -100 15.7721 0.0124
NP_442837.1_3 Reverse -100 -107 15.7721 0.0124
NP_439994.1_3 Reverse -98 -117 12.2431 0.153
NP_439994.1_3 Reverse -268 -287 9.90183 0.23
NP_442053.1_1 Forward -108 -99 18.3876 0.0007
NP_442053.1_1 Reverse -99 -108 18.3876 0.0007
NP_440505.1_3 Forward -110 -100 17.188 0.00332
NP_440505.1_3 Forward -356 -346 8.53483 0.141
NP_440505.1_7 Forward -112 -93 -2.45882 0.289
NP_441252.1_6 Reverse -201 -208 14.3954 0.168
NP_441203.1_1 Reverse -100 -119 16.0274 0.00607
NP_440914.1_1 Reverse -99 -109 16.3248 0.00196
NP_440914.1_1 Forward -108 -98 8.51751 0.186
NP_441011.1_8 Reverse -100 -109 16.6177 0.00602
NP_441011.1_8 Forward -107 -98 14.356 0.0249
NP_442101.1_10 Forward -116 -97 3.6377 0.0679
NP_442533.1_1 Forward -329 -310 -6.29373 0.166
NP_442533.1_1 Reverse -25 -44 -6.98204 0.184
NP_442533.1_6 Forward -108 -99 17.2076 0.00137
NP_442533.1_6 Reverse -99 -108 17.2076 0.00137
NP_442533.1_6 Reverse -269 -278 8.25953 0.0776
NP_442533.1_6 Forward -278 -269 7.66954 0.0897
NP_442541.1_10 Reverse -269 -283 10.717 0.186
NP_442541.1_10 Reverse -339 -353 9.53707 0.204
NP_442232.1_3 Forward -286 -267 -6.39206 0.184
NP_442322.1_4 Forward -388 -371 -2.12512 0.228
NP_442322.1_4 Reverse -303 -320 -9.59824 0.295
NP_443016.1_1 Forward -114 -95 -5.40875 0.245
NP_441482.1_7 Forward -114 -100 6.88276 0.0257
NP_441482.1_7 Reverse -263 -277 -3.24533 0.115
NP_441482.1_7 Forward -380 -366 -11.1118 0.237
NP_439944.1_9 Reverse -100 -110 9.12481 0.1
NP_439944.1_9 Forward -107 -97 8.82982 0.101
NP_441028.1_6 Reverse -274 -284 15.5158 0.137
NP_441028.1_6 Forward -36 -26 3.8145 0.281
NP_440116.1_5 Reverse -96 -113 3.67709 0.225
NP_440116.1_8 Forward -107 -88 -1.67217 0.12
NP_441527.1_4 Forward -303 -284 -7.87851 0.239
NP_440115.1_6 Forward -111 -101 14.0414 0.0615
NP_440115.1_6 Reverse -96 -106 8.63316 0.128
NP_440115.1_6 Forward -281 -271 6.46988 0.181
NP_440007.1_9 Reverse -373 -387 2.06454 0.281
NP_440007.1_9 Forward -112 -98 1.96621 0.281
NP_441961.1_4 Forward -48 -29 7.66927 0.268
NP_441961.1_4 Forward -59 -40 2.94938 0.281
NP_441602.1_8 Reverse -78 -97 19.6656 0.0856
NP_441602.1_9 Reverse -131 -149 18.702 0.166
NP_441602.1_10 Reverse -42 -61 19.7631 0.0864
NP_441972.1_5 Forward -347 -328 -9.73531 0.293
NP_441106.1_1 Forward -109 -100 18.486 0.0028
NP_441106.1_1 Reverse -98 -107 9.73449 0.0311
NP_439903.1_6 Forward -111 -92 6.29183 0.17
NP_439903.1_7 Reverse -374 -393 4.52268 0.281
NP_442306.1_10 Forward -283 -264 -14.1602 0.197
NP_441286.1_1 Forward -109 -97 6.03717 0.0258
NP_441286.1_1 Reverse -98 -110 -3.50094 0.145
NP_441286.1_1 Reverse -268 -280 -4.87757 0.18
NP_440670.1_8 Forward -108 -99 18.3876 0.000699
NP_440670.1_8 Reverse -99 -108 18.3876 0.000699
NP_440670.1_8 Reverse -269 -278 5.3096 0.167
NP_440670.1_8 Forward -13 -4 3.14632 0.296
NP_441930.1_2 Forward -279 -269 15.9097 0.19
NP_440886.1_7 Forward -109 -99 8.04271 0.0805
NP_440886.1_7 Reverse -98 -108 8.04271 0.0805
NP_440886.1_7 Forward -38 -28 5.09279 0.201
NP_440886.1_7 Reverse -311 -321 3.42118 0.282
NP_440828.1_4 Reverse -302 -321 -7.96609 0.295
NP_442614.1_2 Forward -108 -94 16.5192 0.0675
NP_442614.1_2 Forward -354 -340 7.76774 0.265
NP_442072.1_3 Reverse -202 -220 16.344 0.214
NP_442072.1_9 Reverse -98 -116 -12.2722 0.0831
NP_442072.1_9 Forward -279 -261 -22.7936 0.259
NP_442213.1_5 Reverse -24 -43 -2.26216 0.295
NP_440907.2_8 Forward -107 -97 16.2041 0.0161
NP_440907.2_8 Reverse -100 -110 9.616 0.103
NP_441021.1_1 Reverse -100 -119 -5.60541 0.177
NP_441626.1_2 Forward -107 -100 15.7721 0.0124
NP_441626.1_2 Reverse -100 -107 15.7721 0.0124
NP_442794.1_1 Forward -112 -100 10.5604 0.0721
NP_442615.1_1 Forward -117 -99 -0.0791831 0.111
NP_442615.1_1 Reverse -90 -108 -0.374176 0.115
NP_440387.1_1 Reverse -99 -115 7.63002 0.0282
NP_440387.1_1 Forward -108 -92 4.97508 0.0365
NP_441431.1_2 Forward -111 -97 17.0102 0.0303
NP_441431.1_2 Forward -243 -229 6.88214 0.257
NP_441431.1_2 Reverse -96 -110 5.70218 0.291
NP_441488.1_7 Reverse -93 -112 0.58944 0.296
NP_441488.1_8 Forward -113 -99 9.73373 0.146
NP_441836.1_2 Reverse -93 -112 0.491109 0.202
NP_441993.1_3 Reverse -305 -324 19.0748 0.144
NP_440814.1_4 Reverse -90 -109 -12.4886 0.23
NP_440114.1_10 Forward -108 -94 13.0776 0.0662
NP_440114.1_10 Reverse -269 -283 6.09611 0.285
NP_442323.1_7 Forward -113 -94 12.1917 0.116
NP_442323.1_7 Reverse -58 -77 10.7167 0.147
NP_440293.1_3 Reverse -29 -48 3.34271 0.192
NP_440293.1_3 Forward -360 -341 -5.70374 0.281
NP_440293.1_9 Forward -166 -152 11.5375 0.257
NP_440293.1_10 Reverse -40 -59 -2.16383 0.271
NP_440766.1_4 Forward -112 -98 5.21113 0.113
NP_439988.1_3 Reverse -101 -115 6.98109 0.278
NP_439988.1_3 Forward -71 -57 4.12949 0.295
NP_441237.1_9 Forward -107 -97 17.188 0.00445
NP_441237.1_9 Reverse -270 -280 14.1397 0.0488
NP_442743.1_4 Reverse -100 -119 0.982764 0.174
NP_441311.1_2 Forward -114 -100 14.7486 0.229
NP_440457.1_1 Forward -112 -100 7.70879 0.101
NP_440457.1_1 Forward -282 -270 7.31547 0.105
NP_440457.1_1 Reverse -95 -107 2.89058 0.205
NP_440457.1_1 Reverse -34 -46 0.23564 0.25
NP_440798.1_6 Forward -107 -94 5.03416 0.14
NP_440798.1_6 Reverse -100 -113 2.08423 0.186
NP_440142.1_6 Forward -151 -134 17.3451 0.133
NP_441984.1_3 Reverse -259 -277 8.7706 0.218
NP_441984.1_3 Forward -282 -264 5.62401 0.279
NP_440473.1_1 Forward -111 -92 20.2232 0.0276
NP_442509.1_9 Forward -108 -98 17.3841 0.00128
NP_442509.1_9 Reverse -99 -109 8.04271 0.192
YP_003858595.1_2 Reverse -234 -251 9.08455 0.146
NP_440554.1_4 Reverse -100 -110 17.9746 0.0131
NP_441885.1_5 Forward -108 -98 11.3864 0.00668
NP_441885.1_5 Reverse -99 -109 11.3864 0.00668
NP_440478.1_10 Reverse -353 -367 6.3911 0.291
NP_442703.1_1 Forward -306 -287 5.68135 0.278
NP_442341.1_7 Forward -59 -45 9.2427 0.0751
NP_442341.1_7 Forward -109 -95 4.22782 0.198
NP_442341.1_9 Forward -110 -96 19.5668 0.00907
NP_441756.1_5 Forward -112 -93 -4.22878 0.294
NP_441756.1_5 Reverse -95 -114 -4.72043 0.295
NP_441173.1_9 Reverse -117 -125 12.1137 0.21
NP_441173.1_9 Forward -258 -250 10.6388 0.261
NP_442395.2_4 Reverse -98 -117 2.6536 0.22
NP_442534.1_7 Forward -355 -336 5.70265 0.292
NP_443000.1_7 Forward -110 -100 20.3345 0.00223
NP_443000.1_7 Reverse -97 -107 2.04498 0.226
NP_441842.1_1 Forward -106 -93 14.965 0.0837
NP_441842.1_7 Reverse -348 -367 13.0766 0.213
NP_440275.1_3 Forward -110 -100 16.1063 0.0155
NP_440275.1_3 Reverse -97 -107 9.91146 0.046
NP_441902.1_3 Reverse -201 -211 13.3704 0.23
NP_442638.1_3 Forward -135 -116 12.3658 0.298
NP_441389.1_5 Reverse -139 -158 15.2408 0.219
NP_439962.1_8 Forward -282 -263 10.3242 0.21
NP_442495.1_4 Reverse -103 -113 16.303 0.0771
NP_441105.1_3 Forward -119 -100 -7.57203 0.255
NP_440216.1_1 Reverse -99 -113 17.1092 0.00188
NP_440216.1_1 Forward -108 -94 -1.08205 0.0293
NP_440216.1_1 Forward -278 -264 -2.36035 0.0494
NP_440216.1_1 Reverse -269 -283 -11.7018 0.212
NP_440172.1_1 Reverse -99 -109 17.5813 0.00421
NP_440172.1_1 Forward -108 -98 16.303 0.00854
NP_440172.1_1 Forward -278 -268 10.3048 0.0524
NP_440172.1_1 Reverse -269 -279 3.61828 0.222
NP_442015.1_10 Forward -112 -99 13.4906 0.0354
NP_442015.1_10 Reverse -95 -108 11.3273 0.0372
NP_441226.1_7 Forward -107 -100 14.4934 0.0123
NP_441226.1_7 Reverse -100 -107 14.4934 0.0123
NP_441226.1_7 Reverse -312 -319 6.52862 0.253
NP_441111.1_7 Forward -107 -99 18.7023 0.00294
NP_441111.1_7 Reverse -100 -108 18.7023 0.00294
NP_442379.1_10 Forward -115 -98 -0.157821 0.223
NP_441766.1_2 Forward -108 -99 17.5026 0.00297
NP_441766.1_2 Reverse -99 -108 17.5026 0.00297
NP_442417.1_5 Reverse -99 -113 14.3559 0.0633
NP_440416.1_9 Forward -115 -96 4.42435 0.0355
NP_440416.1_9 Reverse -338 -357 -16.1268 0.208
NP_440416.1_9 Reverse -370 -389 -18.3884 0.256
NP_440416.1_9 Reverse -14 -33 -18.9784 0.267
NP_443052.1_8 Forward -257 -238 1.57275 0.0601
NP_443052.1_8 Reverse -89 -108 -6.58872 0.143
NP_443052.1_9 Forward -41 -22 -4.03212 0.254
NP_441940.1_4 Reverse -267 -286 7.17762 0.286
NP_442154.1_1 Forward -323 -305 -9.71562 0.188
NP_442154.1_1 Reverse -32 -50 -18.7621 0.285
NP_440261.1_5 Forward -107 -94 14.7689 0.0173
NP_440261.1_5 Reverse -100 -113 6.70579 0.0318
NP_440261.1_5 Forward -277 -264 -4.11062 0.14
NP_440261.1_5 Reverse -270 -283 -4.7006 0.165
NP_440261.1_5 Forward -121 -108 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTCAATCAATCCACGCCAACGACAGGCCGAACTCTGGGGACAGACGGGGGTAGCACTGGGCAACACTGTCGAATTTGGGGCGGATGGGGTCATGGTGAAAGAATGACAAGAAATCATGGGGGGCAATGGCCCGAGGTTCCATTCTACAAAAGAGCGGGCACCGAAATGTGAATCGTTTCAGAATTGGATTATTGCCCAAACGATTAATAAGCATAGGTTAAACATATAGTTCAGGGCTTGGTCTGTCCTGGTTGGAGTCCTATAATCAGAAAAATTGGCAGAATGCCCCCAGGCGATCGCCCACAAGTCCGGTAAGCTTGACCCAGGTGTAATCCCTTGGGGTGCAACACCGCTGGACCCCCCCTGACCACCATTAGCCGTGAGGAGACCATTGGCCCT

CDS

GTGTTTGTTTTAACCGGTTACGAATATTTTCTTGGCTTTCTCTTTATATGCTCCCTGGTGCCAGTGTTGGCCCTGACCGCATCCAAACTCCTCCGTCCTAGGGATGGTGGCCCAGAACGGCAAACTACCTATGAATCCGGTATGGAGCCCATTGGCGGAGCTTGGATTCAGTTCAACATCCGCTACTACATGTTTGCTCTGGTGTTTGTGGTCTTTGATGTGGAGACGGTGTTTCTTTATCCCTGGGCCGTTGCCTTTAATCAATTGGGCCTGTTAGCCTTTGTAGAAGCATTGATCTTCATTGCCATTTTGGTGGTTGCCCTGGTCTACGCTTGGCGCAAAGGGGCTCTGGAGTGGTCCTAG

Protein

MFVLTGYEYFLGFLFICSLVPVLALTASKLLRPRDGGPERQTTYESGMEPIGGAWIQFNIRYYMFALVFVVFDVETVFLYPWAVAFNQLGLLAFVEALIFIAILVVALVYAWRKGALEWS