Your browser is old and dusty. Try Google Chrome!

Details for slr1278

ORF slr1278
Accession NP_441601.1
Symbol ycf62
Category hypothetical protein YCF62
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -327 -313 -1.96703 0.278
NP_440795.1_7 Forward -327 -320 14.6904 0.0123
NP_440795.1_7 Reverse -320 -327 14.6904 0.0123
NP_440795.1_7 Reverse -155 -162 8.00392 0.218
NP_441418.1_6 Forward -328 -309 -2.16383 0.0175
NP_441418.1_6 Reverse -364 -383 -29.4015 0.224
NP_441418.1_6 Reverse -319 -338 -29.6965 0.234
NP_440815.1_5 Forward -328 -309 6.58763 0.273
NP_441453.1_4 Reverse -319 -327 16.539 0.00633
NP_441453.1_4 Forward -328 -320 16.539 0.00633
NP_441453.1_4 Reverse -364 -372 6.80426 0.121
NP_441453.1_4 Forward -373 -365 6.11594 0.121
NP_441623.1_1 Reverse -257 -275 -0.7675 0.237
NP_442151.1_6 Reverse -319 -333 15.3392 0.0238
NP_442151.1_6 Forward -373 -359 10.226 0.127
NP_442151.1_6 Forward -328 -314 7.57108 0.194
NP_441818.1_1 Forward -327 -316 11.4645 0.177
NP_441818.1_1 Reverse -320 -331 9.79292 0.232
NP_440226.1_1 Reverse -319 -338 10.7175 0.0603
NP_440226.1_1 Forward -328 -309 9.53756 0.0719
NP_440226.1_1 Reverse -364 -383 5.30933 0.161
NP_442169.1_1 Forward -314 -295 -2.45882 0.277
NP_441098.1_3 Forward -201 -182 -1.14243 0.268
NP_440996.1_3 Forward -247 -229 15.5554 0.154
NP_440996.1_3 Reverse -371 -389 9.26226 0.281
NP_442173.1_1 Forward -327 -319 15.4574 0.00633
NP_442173.1_1 Reverse -320 -328 15.4574 0.00633
NP_442173.1_1 Forward -372 -364 12.0158 0.0316
NP_442173.1_1 Reverse -365 -373 4.83764 0.241
NP_442752.1_4 Reverse -364 -371 13.8055 0.0199
NP_442752.1_4 Forward -328 -321 13.8055 0.0199
NP_442752.1_4 Reverse -319 -326 13.8055 0.0199
NP_443027.1_4 Reverse -152 -162 8.53483 0.199
NP_443027.1_4 Reverse -317 -327 6.46988 0.275
NP_442975.1_10 Reverse -315 -329 11.307 0.0508
NP_440784.1_7 Forward -327 -320 15.9687 0.0123
NP_440784.1_7 Reverse -320 -327 15.9687 0.0123
NP_440784.1_7 Reverse -365 -372 6.23397 0.241
NP_440784.1_7 Forward -372 -365 6.13563 0.241
NP_440061.1_9 Forward -330 -316 19.1735 0.00631
NP_441054.1_4 Forward -338 -320 1.78911 0.17
NP_441054.1_4 Reverse -309 -327 -0.374176 0.182
NP_442062.1_8 Forward -328 -318 17.6796 0.00193
NP_442062.1_8 Reverse -319 -329 17.3846 0.00193
NP_441900.1_2 Reverse -247 -265 4.54162 0.174
NP_441859.1_3 Forward -329 -310 7.4718 0.157
NP_440304.1_4 Reverse -317 -327 17.9746 0.00654
NP_440304.1_4 Forward -330 -320 1.84832 0.299
NP_442242.1_4 Forward -327 -320 14.3954 0.0124
NP_442242.1_4 Reverse -320 -327 14.3954 0.0124
NP_440044.1_8 Reverse -320 -339 -1.08219 0.235
NP_442762.1_10 Forward -83 -64 -10.7186 0.257
NP_439918.1_3 Reverse -361 -380 7.86593 0.252
NP_441210.1_5 Forward -169 -150 19.8623 0.117
NP_441208.1_9 Forward -331 -317 8.45605 0.219
NP_441491.1_6 Forward -319 -305 17.7071 0.143
NP_441083.1_5 Reverse -319 -329 20.3345 0.00053
NP_441083.1_5 Forward -328 -318 19.3512 0.000718
NP_441083.1_5 Forward -373 -363 17.7779 0.00336
NP_441083.1_5 Reverse -364 -374 -1.00328 0.289
NP_441149.1_7 Forward -283 -264 1.47442 0.271
NP_441738.1_2 Forward -371 -364 15.28 0.0102
NP_441738.1_2 Forward -326 -319 15.28 0.0102
NP_441738.1_2 Reverse -321 -328 15.28 0.0102
NP_441558.1_5 Reverse -61 -80 12.0942 0.0717
NP_441558.1_5 Forward -375 -356 9.63589 0.117
NP_440209.1_1 Reverse -319 -327 18.1123 0.00295
NP_440209.1_1 Forward -328 -320 18.1123 0.00295
NP_440209.1_1 Reverse -364 -372 8.57422 0.0425
NP_440209.1_1 Forward -373 -365 5.52596 0.0821
NP_442136.1_4 Reverse -366 -385 13.3716 0.197
NP_442889.1_8 Reverse -316 -330 18.8785 0.00948
NP_440056.1_9 Reverse -128 -147 15.0437 0.272
NP_441713.1_3 Reverse -310 -329 4.12936 0.258
NP_440178.1_7 Forward -329 -310 -19.2734 0.174
NP_440178.1_7 Reverse -318 -337 -20.8467 0.201
NP_441792.1_1 Forward -380 -361 10.0292 0.157
NP_441716.1_1 Reverse -319 -333 7.57108 0.166
NP_441716.1_1 Forward -328 -314 6.09611 0.207
NP_441327.1_5 Forward -277 -268 16.2243 0.164
NP_442111.1_4 Forward -329 -315 11.701 0.0486
NP_442111.1_4 Forward -374 -360 9.34103 0.0609
NP_441624.1_7 Reverse -63 -77 8.75105 0.235
NP_441831.1_4 Reverse -53 -72 11.0125 0.25
NP_440343.1_9 Forward -338 -319 6.29264 0.3
NP_440906.1_5 Forward -327 -320 15.8704 0.0124
NP_440906.1_5 Reverse -320 -327 15.8704 0.0124
NP_440906.1_5 Reverse -365 -372 6.23397 0.234
NP_440906.1_5 Forward -372 -365 6.13563 0.241
NP_440747.1_10 Forward -331 -319 14.9853 0.00221
NP_440747.1_10 Reverse -361 -373 5.25052 0.0154
NP_440747.1_10 Reverse -316 -328 -2.02597 0.0196
NP_440747.1_10 Forward -376 -364 -2.51763 0.0509
NP_441847.1_2 Reverse -373 -392 14.2574 0.0835
NP_441130.1_10 Reverse -317 -331 8.25939 0.139
NP_441130.1_10 Reverse -335 -349 6.09611 0.202
NP_441486.1_1 Forward -331 -317 14.7492 0.00628
NP_441486.1_1 Reverse -316 -330 -2.45868 0.175
NP_442634.1_4 Reverse -317 -331 -4.81863 0.22
NP_441265.1_3 Reverse -313 -327 3.8345 0.181
NP_440842.1_10 Reverse -316 -330 10.7177 0.251
NP_440842.1_10 Forward -285 -271 1.37622 0.294
NP_441014.1_10 Forward -329 -310 -2.65624 0.283
NP_443018.1_3 Forward -327 -320 14.8871 0.0123
NP_443018.1_3 Reverse -320 -327 14.8871 0.0123
NP_443018.1_3 Forward -372 -365 11.7405 0.0655
NP_443018.1_3 Reverse -64 -71 9.38056 0.128
NP_443018.1_3 Reverse -365 -372 5.44732 0.193
NP_443018.1_3 Reverse -155 -162 4.07068 0.299
NP_441316.1_7 Reverse -317 -332 2.04485 0.156
NP_441634.1_8 Reverse -152 -166 2.5562 0.167
NP_441634.1_8 Forward -330 -316 -3.147 0.295
NP_440376.1_1 Forward -328 -319 19.4693 0.000692
NP_440376.1_1 Reverse -319 -328 19.4693 0.000692
NP_440376.1_1 Reverse -364 -373 5.99792 0.111
NP_440376.1_1 Forward -373 -364 -0.196935 0.285
NP_441857.1_5 Forward -335 -317 3.95239 0.222
NP_441588.1_4 Forward -371 -361 9.02648 0.14
NP_441588.1_4 Reverse -321 -331 8.92815 0.14
NP_442687.1_7 Reverse -318 -328 18.5646 0.0028
NP_442687.1_7 Forward -329 -319 8.92815 0.0994
NP_441077.1_6 Forward -37 -21 8.20065 0.211
NP_442946.1_5 Forward -227 -209 18.6037 0.197
NP_442530.1_2 Forward -277 -267 15.2213 0.203
NP_441013.1_2 Forward -321 -303 -1.94747 0.282
NP_440042.1_2 Reverse -309 -328 10.4225 0.153
NP_441422.1_3 Forward -150 -131 15.0964 0.256
NP_441422.1_7 Forward -375 -358 -3.50107 0.235
NP_440887.1_7 Forward -399 -380 17.109 0.111
NP_442658.1_1 Reverse -317 -327 17.6791 0.00565
NP_442658.1_1 Forward -330 -320 6.76441 0.214
NP_442198.1_3 Forward -337 -318 12.3892 0.179
NP_442205.1_2 Reverse -317 -336 17.2516 0.14
NP_441414.1_9 Forward -328 -309 -2.0655 0.11
NP_441414.1_9 Reverse -319 -338 -4.42544 0.153
NP_440607.1_5 Forward -299 -280 -1.37718 0.296
NP_441487.1_7 Forward -87 -68 16.5191 0.132
NP_441487.1_9 Reverse -318 -337 2.0644 0.19
NP_442937.1_5 Reverse -314 -333 9.43923 0.192
NP_441958.1_5 Reverse -318 -328 20.5312 0.000966
NP_441958.1_5 Forward -329 -319 12.2714 0.00183
NP_441958.1_5 Forward -374 -364 1.55333 0.095
NP_441958.1_5 Reverse -363 -373 0.865012 0.12
NP_440203.1_5 Forward -370 -360 14.2375 0.0886
NP_440203.1_5 Reverse -322 -332 10.9926 0.206
NP_439905.1_1 Reverse -320 -333 10.049 0.216
NP_440984.1_7 Forward -333 -319 11.2093 0.122
NP_440984.1_7 Reverse -314 -328 8.55439 0.142
NP_439990.1_5 Forward -333 -320 8.9674 0.155
NP_442911.1_2 Reverse -309 -328 8.06259 0.0223
NP_442911.1_2 Forward -338 -319 -4.72043 0.14
NP_443055.1_6 Reverse -311 -329 16.7346 0.0593
NP_443055.1_6 Forward -328 -310 -2.63651 0.298
NP_441099.1_5 Reverse -309 -328 16.1257 0.0153
NP_442002.1_9 Reverse -318 -325 14.1004 0.074
NP_440809.1_9 Forward -337 -319 1.88744 0.118
NP_440809.1_9 Reverse -379 -397 0.21581 0.195
NP_441294.1_7 Forward -167 -153 11.3624 0.147
NP_441294.1_7 Reverse -315 -329 8.67469 0.289
NP_441646.1_1 Reverse -312 -331 3.24438 0.207
NP_441646.1_1 Reverse -351 -370 1.47442 0.231
NP_441646.1_1 Forward -170 -151 0.196116 0.254
NP_441646.1_1 Forward -79 -60 -0.590531 0.269
NP_440377.1_1 Reverse -237 -254 11.2737 0.291
NP_441000.1_6 Reverse -318 -332 -4.52363 0.245
NP_440147.1_4 Forward -330 -317 21.0621 0.00143
NP_440147.1_4 Reverse -362 -375 7.29578 0.0712
NP_440147.1_4 Reverse -317 -330 4.05085 0.173
NP_441550.1_8 Reverse -317 -327 19.8424 0.00352
NP_441550.1_8 Forward -330 -320 14.6309 0.0132
NP_441550.1_8 Reverse -362 -372 13.3526 0.0252
NP_441550.1_8 Forward -375 -365 11.1893 0.0536
NP_441916.1_7 Forward -328 -318 16.893 0.00407
NP_441916.1_7 Reverse -319 -329 10.3048 0.0261
NP_441916.1_10 Forward -74 -55 2.75272 0.241
NP_441916.1_10 Reverse -311 -330 1.67108 0.262
NP_440465.1_10 Reverse -316 -335 -0.000545616 0.29
NP_441041.1_4 Reverse -319 -338 -8.85033 0.208
NP_441041.1_4 Reverse -358 -377 -9.047 0.211
NP_441041.1_7 Reverse -316 -328 12.4708 0.0611
NP_440099.1_1 Forward -229 -210 6.88182 0.256
NP_442396.1_5 Forward -332 -319 11.7207 0.0913
NP_442004.1_6 Reverse -319 -333 7.47274 0.159
NP_441725.1_5 Forward -327 -317 18.7612 0.0119
NP_441725.1_5 Reverse -320 -330 2.04498 0.115
NP_439966.1_7 Forward -375 -365 14.0409 0.0226
NP_439966.1_7 Reverse -317 -327 8.14104 0.14
NP_439966.1_7 Forward -330 -320 7.25606 0.15
NP_439966.1_9 Reverse -317 -326 0.983037 0.253
NP_442941.1_3 Reverse -320 -330 11.0914 0.0116
NP_442941.1_3 Forward -327 -317 2.43831 0.14
NP_442941.1_3 Forward -372 -362 1.25834 0.15
NP_442941.1_3 Reverse -365 -375 0.0783647 0.231
NP_440289.1_2 Reverse -316 -329 11.4257 0.0196
NP_440289.1_2 Forward -331 -318 -2.04567 0.251
NP_441678.1_9 Forward -84 -65 -4.22878 0.292
NP_442281.1_1 Reverse -314 -328 10.717 0.055
NP_442281.1_1 Forward -378 -364 6.58715 0.122
NP_442281.1_1 Forward -77 -63 2.75226 0.257
NP_442256.1_2 Reverse -317 -335 1.00246 0.114
NP_442256.1_2 Forward -330 -312 -7.94566 0.216
NP_442500.1_8 Reverse -236 -250 10.2748 0.272
NP_442012.1_1 Forward -334 -315 9.83255 0.0878
NP_441087.1_6 Reverse -273 -291 -3.71814 0.296
NP_441556.1_10 Forward -333 -319 17.6194 0.0841
NP_441644.1_6 Reverse -319 -329 17.3841 0.00127
NP_441644.1_6 Forward -328 -318 15.7125 0.0048
NP_441644.1_6 Forward -373 -363 14.4342 0.0126
NP_441644.1_6 Reverse -364 -374 5.68278 0.18
NP_441644.1_6 Forward -72 -62 3.51951 0.277
NP_443049.1_6 Reverse -363 -373 14.4711 0.114
NP_440587.1_5 Reverse -193 -211 16.6911 0.167
NP_442215.1_2 Reverse -355 -371 2.02515 0.123
NP_442215.1_2 Reverse -349 -365 -6.52964 0.273
NP_442215.1_2 Reverse -317 -333 -6.92296 0.281
NP_442247.1_5 Reverse -257 -271 14.1043 0.267
NP_442247.1_8 Forward -330 -316 12.4876 0.247
NP_440253.1_2 Forward -328 -310 5.91901 0.0877
NP_440929.1_8 Forward -328 -319 19.2726 0.000701
NP_440929.1_8 Reverse -319 -328 19.2726 0.000701
NP_440929.1_8 Forward -373 -364 7.07956 0.0713
NP_440780.1_1 Forward -134 -115 13.2252 0.234
NP_442933.1_6 Reverse -188 -207 12.7478 0.287
NP_442933.1_10 Forward -328 -319 17.601 0.00325
NP_442933.1_10 Reverse -319 -328 17.601 0.00325
NP_440382.1_2 Forward -36 -17 2.55527 0.284
NP_441751.2_8 Forward -327 -313 -3.73699 0.154
NP_441751.2_8 Reverse -320 -334 -4.7203 0.179
NP_441751.2_8 Reverse -365 -379 -5.70361 0.231
NP_442554.1_8 Forward -327 -317 16.9913 0.0065
NP_442554.1_8 Reverse -320 -330 15.3197 0.00882
NP_442554.1_8 Forward -71 -61 9.12481 0.0634
NP_442554.1_8 Forward -372 -362 5.48657 0.146
NP_442554.1_8 Reverse -365 -375 5.38824 0.15
NP_442554.1_8 Forward -162 -152 3.81494 0.209
NP_442554.1_8 Reverse -64 -74 2.24165 0.276
NP_441586.1_6 Forward -375 -356 4.52268 0.277
NP_441762.1_7 Reverse -318 -330 8.9871 0.0142
NP_441762.1_7 Forward -329 -317 2.59558 0.0676
NP_442142.1_4 Forward -376 -363 7.00021 0.151
NP_442142.1_4 Reverse -316 -329 3.95196 0.239
NP_442292.1_1 Reverse -320 -329 18.486 0.00229
NP_442292.1_1 Forward -327 -318 9.53783 0.0183
NP_442292.1_1 Forward -372 -363 8.65285 0.0335
NP_442292.1_1 Forward -162 -153 5.11294 0.162
NP_442476.1_6 Reverse -320 -334 5.99778 0.13
NP_442476.1_6 Forward -327 -313 0.982901 0.233
NP_440895.1_6 Forward -334 -321 11.819 0.202
NP_440895.1_6 Reverse -358 -371 11.0324 0.202
NP_442381.1_8 Reverse -308 -327 -14.4552 0.28
NP_442381.1_8 Forward -331 -312 -14.7502 0.284
NP_441711.1_4 Reverse -310 -329 19.3707 0.0413
NP_443009.1_5 Forward -329 -318 15.7911 0.0107
NP_443009.1_5 Reverse -318 -329 11.1696 0.066
NP_441715.1_4 Reverse -320 -330 7.94484 0.107
NP_440357.1_3 Reverse -317 -336 4.81767 0.242
NP_440357.1_3 Forward -165 -146 -0.885524 0.296
NP_441198.1_8 Reverse -317 -327 15.2245 0.0427
NP_440464.1_10 Reverse -320 -330 13.0082 0.169
NP_441468.1_1 Forward -327 -320 15.8704 0.0124
NP_441468.1_1 Reverse -320 -327 15.8704 0.0124
NP_441468.1_1 Reverse -155 -162 10.2655 0.0906
NP_441468.1_1 Reverse -365 -372 6.13563 0.209
NP_441468.1_1 Forward -372 -365 6.0373 0.223
NP_439939.1_6 Reverse -319 -338 12.4875 0.277
NP_441020.2_6 Forward -330 -313 15.9685 0.034
NP_441020.2_6 Reverse -362 -379 9.08529 0.18
NP_441015.1_8 Forward -367 -348 0.196116 0.28
NP_441015.1_10 Forward -309 -290 -9.83364 0.282
NP_441673.1_1 Forward -328 -319 20.8459 0.000698
NP_441673.1_1 Reverse -319 -328 20.8459 0.000698
NP_441673.1_1 Reverse -364 -373 1.37636 0.114
NP_441673.1_1 Forward -373 -364 1.1797 0.163
NP_441731.1_3 Reverse -356 -375 3.6377 0.159
NP_441826.1_2 Reverse -358 -372 6.6861 0.0907
NP_441637.1_9 Reverse -240 -258 -0.472507 0.292
NP_441764.1_1 Forward -29 -10 13.1758 0.127
NP_442868.1_6 Reverse -317 -327 16.7946 0.0131
NP_442868.1_6 Forward -330 -320 9.81313 0.038
NP_442868.1_6 Forward -375 -365 0.275027 0.243
NP_442868.1_6 Reverse -362 -372 0.0783647 0.248
NP_442719.1_2 Forward -240 -222 -2.63651 0.191
NP_441612.1_2 Forward -17 -7 11.7441 0.21
NP_441612.1_2 Reverse -319 -329 8.54929 0.21
NP_443058.1_7 Reverse -363 -382 3.83436 0.26
NP_442361.1_3 Reverse -358 -371 8.08242 0.285
NP_442427.1_8 Forward -242 -223 10.8159 0.156
NP_442427.1_8 Reverse -310 -329 10.0292 0.168
NP_442808.1_1 Forward -374 -364 9.71433 0.0481
NP_442808.1_1 Reverse -318 -328 8.73102 0.0481
NP_442808.1_1 Forward -329 -319 8.63269 0.0481
NP_441101.1_1 Reverse -152 -170 15.1621 0.231
NP_441849.1_2 Forward -201 -182 -0.334645 0.291
NP_442542.1_2 Reverse -317 -330 13.4906 0.114
NP_442050.1_5 Reverse -317 -327 14.9258 0.0175
NP_442050.1_5 Forward -375 -365 12.7626 0.0516
NP_442050.1_5 Forward -330 -320 7.64939 0.243
NP_441114.1_3 Reverse -65 -74 7.66954 0.231
NP_440558.1_2 Reverse -316 -335 -7.08038 0.287
NP_440111.2_2 Forward -378 -359 0.982764 0.201
NP_441518.1_3 Reverse -309 -328 -14.1602 0.269
NP_441878.1_6 Reverse -318 -328 20.2362 0.0046
NP_441878.1_6 Forward -329 -319 10.4031 0.0176
NP_441878.1_6 Forward -73 -63 0.766681 0.134
NP_441878.1_6 Forward -79 -69 -7.88644 0.278
NP_441036.1_8 Reverse -318 -328 8.4365 0.174
NP_441036.1_8 Forward -329 -319 8.33817 0.174
NP_441557.1_5 Forward -328 -319 19.9609 0.000699
NP_441557.1_5 Reverse -319 -328 19.9609 0.000699
NP_441557.1_5 Reverse -364 -373 1.08137 0.0794
NP_441557.1_5 Forward -373 -364 0.589713 0.134
NP_441445.1_1 Forward -337 -318 21.3373 0.021
NP_442066.2_9 Forward -377 -364 9.06573 0.181
NP_441433.1_8 Forward -49 -30 -3.54046 0.283
NP_440084.1_8 Reverse -21 -35 18.0596 0.161
NP_441739.1_2 Reverse -248 -264 5.17106 0.228
NP_442183.1_1 Forward -328 -314 18.2892 0.00781
NP_442183.1_1 Reverse -364 -378 6.78443 0.161
NP_442397.1_9 Forward -373 -354 2.75272 0.271
NP_441549.1_9 Forward -332 -314 -5.38906 0.198
NP_442347.1_2 Reverse -320 -329 12.4878 0.056
NP_442347.1_2 Forward -372 -363 10.3245 0.058
NP_442347.1_2 Forward -162 -153 3.53964 0.284
NP_442347.1_2 Forward -327 -318 3.34298 0.284
NP_442347.1_10 Reverse -283 -297 15.7319 0.224
NP_442645.1_2 Forward -336 -317 -21.9284 0.29
NP_441037.1_4 Reverse -317 -327 18.9151 0.00351
NP_441037.1_4 Forward -330 -320 7.9999 0.237
NP_442317.1_6 Forward -333 -314 13.1758 0.158
NP_441633.1_3 Forward -330 -317 20.3738 0.00512
NP_440136.1_2 Forward -327 -320 15.9687 0.0123
NP_440136.1_2 Reverse -320 -327 15.9687 0.0123
NP_440136.1_2 Reverse -365 -372 6.23397 0.171
NP_440136.1_2 Forward -372 -365 6.13563 0.193
NP_440136.1_2 Reverse -155 -162 4.26735 0.218
NP_442590.1_10 Forward -373 -354 10.0292 0.183
NP_442998.1_5 Forward -38 -28 12.7631 0.159
NP_442998.1_5 Forward -39 -29 11.8781 0.176
NP_442998.1_10 Forward -371 -364 15.5754 0.0102
NP_442998.1_10 Forward -326 -319 15.5754 0.0102
NP_442998.1_10 Reverse -321 -328 15.5754 0.0102
NP_440299.1_1 Forward -332 -319 10.2451 0.058
NP_440299.1_1 Reverse -315 -328 9.36014 0.0728
NP_440299.1_1 Reverse -360 -373 4.24695 0.213
NP_441799.1_1 Forward -332 -318 12.9786 0.0378
NP_441799.1_1 Reverse -315 -329 11.307 0.0591
NP_441799.1_1 Forward -377 -363 9.6354 0.0879
NP_441007.1_10 Reverse -314 -327 8.9674 0.108
NP_441007.1_10 Reverse -149 -162 8.37742 0.115
NP_441007.1_10 Forward -333 -320 1.59258 0.203
NP_441007.1_10 Forward -295 -282 -0.472371 0.285
NP_441007.1_10 Forward -378 -365 -0.865694 0.295
NP_440256.1_1 Reverse -354 -373 1.37609 0.0761
NP_440256.1_1 Reverse -361 -380 -6.78538 0.22
NP_440087.1_1 Forward -337 -318 -6.39206 0.252
NP_441559.1_8 Reverse -243 -257 -5.90027 0.271
NP_441559.1_8 Forward -333 -319 -6.88358 0.281
NP_441559.1_8 Forward -174 -160 -7.47356 0.294
NP_440915.1_6 Reverse -360 -374 11.2093 0.0267
NP_440915.1_6 Reverse -315 -329 5.40779 0.0903
NP_441179.1_1 Forward -331 -312 5.40766 0.247
NP_442785.1_7 Reverse -317 -331 8.55439 0.297
NP_441704.1_8 Forward -339 -320 6.68515 0.258
NP_442452.1_3 Forward -307 -288 6.39097 0.218
NP_441464.1_8 Forward -328 -314 16.7159 0.083
NP_441464.1_8 Reverse -319 -333 6.19444 0.243
NP_442150.1_8 Forward -26 -7 15.4742 0.272
NP_441199.1_6 Forward -332 -313 0.884433 0.23
NP_442386.1_9 Forward -329 -320 13.8639 0.0289
NP_442386.1_9 Forward -164 -155 10.2257 0.136
NP_442386.1_9 Reverse -153 -162 8.94741 0.178
NP_442386.1_9 Reverse -318 -327 6.39082 0.219
NP_442386.1_9 Forward -374 -365 4.52254 0.297
NP_442386.1_10 Reverse -357 -370 3.16588 0.291
NP_440570.1_5 Reverse -309 -328 -3.3438 0.289
NP_441340.1_5 Forward -327 -320 15.6737 0.0124
NP_441340.1_5 Reverse -320 -327 15.6737 0.0124
NP_441340.1_5 Reverse -365 -372 13.5105 0.0314
NP_441340.1_5 Forward -372 -365 5.84064 0.208
NP_441340.1_9 Forward -39 -29 8.25522 0.256
NP_442714.1_5 Forward -281 -262 0.58944 0.253
NP_442714.1_7 Reverse -320 -339 9.43923 0.126
NP_441160.1_5 Forward -339 -320 -6.39206 0.288
NP_441027.1_1 Reverse -222 -236 10.5204 0.287
NP_440586.1_8 Forward -327 -320 13.2151 0.026
NP_440586.1_8 Reverse -320 -327 13.2151 0.026
NP_440586.1_8 Forward -372 -365 9.47853 0.146
NP_440586.1_8 Forward -135 -128 7.1186 0.272
NP_440586.1_8 Reverse -326 -333 7.1186 0.272
NP_440586.1_8 Reverse -365 -372 5.74197 0.283
NP_442251.1_6 Forward -327 -320 15.2804 0.0124
NP_442251.1_6 Reverse -320 -327 15.2804 0.0124
NP_440684.1_9 Reverse -205 -219 7.17775 0.275
NP_441262.1_3 Reverse -364 -371 14.7888 0.0223
NP_441262.1_3 Reverse -319 -326 14.7888 0.0223
NP_441262.1_3 Forward -328 -321 14.7888 0.0223
NP_443051.1_1 Reverse -318 -327 18.0926 0.00402
NP_443051.1_1 Forward -329 -320 10.4228 0.00754
NP_443051.1_1 Reverse -363 -372 7.47288 0.0571
NP_443051.1_1 Forward -374 -365 0.29472 0.195
NP_441232.1_10 Reverse -308 -327 4.22769 0.201
NP_439937.1_9 Reverse -318 -335 4.56135 0.0798
NP_442294.1_3 Reverse -245 -259 12.9786 0.274
NP_440408.1_7 Forward -84 -65 8.94757 0.265
NP_440408.1_7 Reverse -319 -338 8.06259 0.282
NP_440439.1_1 Forward -331 -318 4.54251 0.101
NP_440439.1_1 Forward -376 -363 -1.16069 0.255
NP_440372.1_2 Forward -327 -320 16.3621 0.0124
NP_440372.1_2 Reverse -320 -327 16.3621 0.0124
NP_440372.1_2 Reverse -365 -372 13.8055 0.0214
NP_440372.1_2 Forward -372 -365 6.52896 0.188
NP_440819.1_5 Reverse -40 -48 7.8859 0.266
NP_440819.1_5 Forward -39 -31 7.59091 0.272
NP_440316.1_10 Forward -73 -63 8.1415 0.24
NP_442384.1_10 Reverse -319 -332 17.1289 0.00642
NP_442384.1_10 Forward -373 -360 5.32916 0.131
NP_442384.1_10 Forward -328 -315 3.26421 0.197
NP_440221.1_8 Reverse -101 -120 20.354 0.0747
NP_442790.1_4 Reverse -355 -374 -4.42544 0.131
NP_442262.1_10 Forward -327 -320 14.1988 0.0123
NP_442262.1_10 Reverse -320 -327 14.1988 0.0123
NP_442262.1_10 Forward -372 -365 13.2155 0.0213
NP_442262.1_10 Reverse -64 -71 9.47889 0.187
NP_441689.1_5 Forward -330 -320 5.78111 0.197
NP_440344.1_10 Reverse -312 -329 -3.40274 0.0825
NP_440344.1_10 Forward -335 -318 -8.41762 0.127
NP_440531.1_6 Reverse -146 -165 4.42435 0.125
NP_440531.1_6 Forward -381 -362 -2.55715 0.253
NP_440531.1_6 Forward -336 -317 -5.21209 0.294
NP_442123.1_3 Forward -328 -309 14.7491 0.135
NP_442910.1_1 Forward -335 -316 -7.27704 0.254
NP_440189.1_10 Reverse -308 -327 7.7676 0.242
NP_440189.1_10 Reverse -270 -289 4.12936 0.279
NP_441965.1_10 Reverse -316 -332 20.413 0.0179
NP_441640.1_8 Forward -372 -353 -5.80207 0.289
NP_440297.1_9 Forward -327 -317 9.51814 0.0917
NP_440297.1_9 Reverse -320 -330 -0.118297 0.282
NP_440297.1_9 Forward -71 -61 -0.216628 0.282
NP_440297.1_9 Reverse -64 -74 -0.216628 0.282
NP_442187.1_3 Reverse -363 -373 15.6147 0.105
NP_441592.1_4 Forward -290 -271 -0.787193 0.247
NP_440999.1_9 Forward -377 -363 -2.65535 0.273
NP_440999.1_9 Forward -332 -318 -3.04867 0.283
NP_440888.1_2 Forward -328 -314 8.16044 0.171
NP_440888.1_2 Reverse -319 -333 7.3738 0.198
NP_440888.1_2 Forward -373 -359 6.78381 0.22
NP_442454.1_2 Forward -127 -108 8.83258 0.291
NP_440600.1_4 Forward -381 -363 5.13236 0.107
NP_440179.1_6 Reverse -320 -339 8.16093 0.206
NP_442225.1_10 Reverse -354 -373 6.29183 0.287
NP_442033.1_10 Reverse -317 -336 -0.590531 0.12
NP_441949.1_2 Reverse -309 -328 7.86593 0.261
NP_441543.1_2 Reverse -320 -329 16.9127 0.00359
NP_441543.1_2 Forward -327 -318 9.34117 0.0818
NP_441543.1_2 Forward -372 -363 7.07956 0.131
NP_442845.1_2 Reverse -358 -372 15.5359 0.0719
NP_442845.1_2 Forward -334 -320 13.2743 0.0955
NP_440739.1_8 Reverse -115 -134 3.24438 0.299
NP_441178.1_6 Forward -376 -357 7.4718 0.26
NP_442710.1_6 Forward -26 -7 5.50599 0.24
NP_441469.1_8 Forward -164 -155 15.0444 0.0256
NP_441469.1_8 Reverse -318 -327 13.3727 0.073
NP_441469.1_8 Forward -329 -320 6.48957 0.227
NP_443064.1_6 Forward -328 -318 13.8273 0.0796
NP_443064.1_6 Reverse -319 -329 12.5669 0.0796
NP_442578.1_7 Forward -327 -320 14.5921 0.026
NP_442578.1_7 Reverse -320 -327 14.5921 0.026
NP_442578.1_7 Reverse -365 -372 6.0373 0.18
NP_441462.1_2 Forward -328 -318 20.1379 0.000967
NP_441462.1_2 Reverse -364 -374 16.2046 0.00406
NP_441462.1_2 Reverse -319 -329 11.5831 0.00406
NP_441621.1_7 Reverse -317 -331 -4.81863 0.246
NP_441621.1_7 Forward -258 -244 -5.01529 0.248
NP_443062.1_1 Reverse -319 -337 5.91323 0.215
NP_443062.1_1 Forward -328 -310 5.03566 0.242
NP_443062.1_6 Forward -336 -317 11.7008 0.1
NP_441410.1_4 Reverse -348 -367 7.86512 0.297
NP_442204.1_1 Reverse -360 -371 8.7118 0.0852
NP_442204.1_1 Forward -76 -65 -0.0396598 0.285
NP_442204.1_6 Forward -376 -357 5.50599 0.271
NP_440516.1_2 Reverse -271 -289 10.0489 0.096
NP_440516.1_8 Reverse -364 -373 18.9776 0.00442
NP_440516.1_8 Forward -328 -319 16.9127 0.00442
NP_440516.1_8 Reverse -319 -328 16.9127 0.00442
NP_440516.1_8 Forward -373 -364 5.01461 0.118
NP_442428.1_5 Forward -327 -320 15.8704 0.0124
NP_442428.1_5 Reverse -320 -327 15.8704 0.0124
NP_442428.1_5 Reverse -365 -372 6.13563 0.209
NP_442428.1_5 Forward -372 -365 6.0373 0.212
NP_442428.1_5 Reverse -155 -162 4.66067 0.244
NP_441443.1_10 Reverse -360 -378 6.80322 0.231
NP_441267.1_1 Forward -334 -315 4.52268 0.227
NP_440673.1_3 Forward -371 -364 12.4288 0.0426
NP_440673.1_3 Forward -326 -319 12.4288 0.0426
NP_440673.1_3 Reverse -321 -328 12.4288 0.0426
NP_440673.1_7 Reverse -143 -162 -0.295539 0.29
NP_441052.1_2 Reverse -319 -329 19.9412 0.00106
NP_441052.1_2 Forward -373 -363 10.6981 0.0285
NP_441052.1_2 Forward -328 -318 10.4031 0.0285
NP_441052.1_2 Reverse -295 -305 1.06167 0.252
NP_442219.1_9 Reverse -320 -329 17.7976 0.00718
NP_442219.1_9 Forward -327 -318 8.25953 0.0681
NP_442219.1_9 Forward -372 -363 7.96454 0.0696
NP_440436.1_4 Reverse -320 -329 17.2072 0.00233
NP_440436.1_4 Forward -327 -318 15.9289 0.00508
NP_440436.1_4 Forward -372 -363 7.57079 0.124
NP_441884.1_9 Reverse -316 -335 -14.9469 0.138
NP_441884.1_9 Forward -216 -197 -23.6983 0.284
NP_441893.1_10 Forward -84 -65 9.3409 0.291
NP_442864.1_3 Reverse -358 -377 11.7008 0.181
NP_440314.1_9 Reverse -320 -339 2.0644 0.0862
NP_440314.1_9 Forward -327 -308 -7.86702 0.243
NP_442577.1_9 Forward -177 -163 10.2254 0.288
NP_442577.1_10 Reverse -176 -195 7.37347 0.216
NP_441719.1_4 Forward -327 -320 16.3621 0.0124
NP_441719.1_4 Reverse -320 -327 16.3621 0.0124
NP_441719.1_4 Reverse -365 -372 6.82395 0.0855
NP_441719.1_4 Forward -372 -365 6.52896 0.188
NP_441733.1_10 Reverse -316 -329 7.29578 0.156
NP_441004.1_1 Forward -263 -244 -17.9951 0.296
NP_442813.1_4 Reverse -349 -368 -8.55534 0.299
NP_441231.1_3 Forward -186 -167 12.1917 0.261
NP_442366.1_3 Forward -374 -356 -4.70074 0.275
NP_442366.1_5 Forward -331 -321 17.2858 0.0141
NP_442366.1_5 Reverse -361 -371 14.0409 0.0497
NP_442873.1_3 Reverse -309 -328 7.66846 0.208
NP_442694.1_9 Forward -242 -223 11.2092 0.228
NP_442206.1_10 Reverse -364 -379 13.6479 0.0799
NP_440328.1_4 Reverse -358 -377 7.47261 0.124
NP_443054.1_2 Forward -330 -316 0.786239 0.254
NP_441851.1_10 Reverse -318 -328 17.4829 0.0027
NP_441851.1_10 Forward -329 -319 15.8113 0.00552
NP_441851.1_10 Reverse -153 -163 11.2881 0.0765
NP_442622.1_1 Forward -329 -310 -12.4886 0.27
NP_442622.1_8 Forward -328 -310 -19.1554 0.296
NP_441542.1_4 Forward -238 -224 4.42448 0.264
NP_441501.1_2 Forward -324 -305 21.6323 0.0743
NP_442011.1_1 Reverse -363 -382 -0.000545616 0.268
NP_442856.1_6 Reverse -66 -84 13.7847 0.287
NP_441668.1_5 Forward -39 -20 10.5209 0.225
NP_442515.1_1 Forward -329 -315 24.189 0.00534
NP_442515.1_1 Reverse -318 -332 11.0127 0.0431
NP_442515.1_1 Reverse -41 -55 -5.01529 0.298
NP_441982.1_6 Reverse -230 -239 11.7214 0.288
NP_441982.1_6 Forward -261 -252 10.48 0.296
NP_442689.1_8 Forward -242 -225 -8.0243 0.292
NP_441349.1_10 Forward -338 -319 2.0644 0.0774
NP_441349.1_10 Reverse -130 -149 -9.73531 0.297
NP_441409.1_6 Forward -334 -315 0.392778 0.0649
NP_440432.1_9 Forward -327 -312 27.0209 0.000471
NP_442843.1_1 Reverse -155 -174 -8.35868 0.255
NP_442843.1_1 Forward -281 -262 -9.73531 0.269
NP_442843.1_1 Reverse -196 -215 -11.9969 0.296
NP_440474.1_8 Forward -327 -313 7.07881 0.21
NP_441124.1_5 Forward -39 -29 12.7217 0.215
NP_440431.1_3 Reverse -318 -337 -5.99873 0.188
NP_442450.1_5 Reverse -317 -327 10.1081 0.115
NP_442450.1_5 Forward -330 -320 7.55152 0.13
NP_440588.1_2 Reverse -355 -374 8.06259 0.0477
NP_440588.1_2 Forward -337 -318 3.73603 0.0968
NP_440588.1_2 Reverse -129 -148 -2.85214 0.174
NP_440195.1_5 Reverse -313 -332 2.94938 0.276
NP_442006.1_2 Forward -367 -350 -10.8759 0.197
NP_442006.1_2 Reverse -69 -86 -13.7275 0.197
NP_442006.1_2 Reverse -310 -327 -19.0374 0.297
NP_442006.1_2 Forward -291 -274 -19.0374 0.297
NP_442006.1_3 Reverse -358 -376 -6.27403 0.298
NP_441003.1_9 Forward -376 -357 3.83436 0.291
NP_440483.1_1 Reverse -359 -378 -0.688862 0.208
NP_442243.1_1 Forward -373 -355 1.19838 0.219
NP_441570.1_1 Reverse -364 -382 -16.5005 0.247
NP_441570.1_1 Forward -328 -310 -17.1888 0.267
NP_441078.1_4 Forward -328 -319 19.6659 0.0007
NP_441078.1_4 Reverse -319 -328 19.6659 0.0007
NP_441078.1_4 Reverse -364 -373 0.196389 0.205
NP_441078.1_4 Forward -373 -364 -0.000272808 0.205
NP_442729.1_8 Reverse -315 -328 10.7374 0.125
NP_441663.1_8 Forward -379 -360 10.0292 0.0779
NP_441663.1_8 Reverse -358 -377 -3.73712 0.295
NP_442443.1_4 Forward -279 -269 18.1707 0.14
NP_440526.1_3 Forward -162 -151 18.0527 0.0393
NP_440526.1_3 Forward -327 -316 11.4645 0.0646
NP_440526.1_3 Reverse -320 -331 0.943182 0.267
NP_441432.1_8 Forward -329 -320 16.8143 0.00595
NP_441432.1_8 Reverse -363 -372 14.0611 0.0258
NP_441432.1_8 Reverse -318 -327 8.35786 0.0755
NP_441432.1_9 Reverse -191 -204 10.1497 0.256
NP_441333.1_1 Reverse -119 -129 14.0684 0.217
NP_442320.1_8 Reverse -313 -327 5.01447 0.0442
NP_441732.1_2 Forward -332 -316 -7.61128 0.0861
NP_441732.1_2 Reverse -315 -331 -15.1828 0.145
NP_440760.1_1 Forward -328 -309 -10.522 0.084
NP_440760.1_1 Reverse -319 -338 -22.0267 0.248
NP_442797.1_2 Reverse -314 -332 12.2663 0.283
NP_442797.1_9 Reverse -221 -239 13.2938 0.136
NP_442727.1_1 Forward -338 -324 11.111 0.297
NP_441072.1_2 Forward -315 -296 5.80098 0.296
NP_442400.1_10 Reverse -226 -239 9.80195 0.27
NP_442489.1_7 Forward -328 -319 20.1576 0.000695
NP_442489.1_7 Reverse -319 -328 20.1576 0.000695
NP_442489.1_7 Forward -373 -364 0.688044 0.152
NP_442489.1_7 Reverse -364 -373 0.688044 0.152
NP_440565.1_7 Forward -264 -245 -2.36049 0.3
NP_442079.1_7 Forward -327 -308 2.55606 0.226
NP_440559.1_1 Reverse -320 -329 17.4043 0.00658
NP_440559.1_1 Forward -327 -318 17.306 0.00658
NP_440559.1_1 Forward -372 -363 7.76787 0.0918
NP_441659.2_8 Forward -328 -318 19.3512 0.000966
NP_441659.2_8 Reverse -319 -329 18.1713 0.00133
NP_441659.2_8 Forward -373 -363 5.48657 0.106
NP_441659.2_8 Reverse -364 -374 1.84832 0.224
NP_441022.1_1 Forward -274 -265 13.7524 0.188
NP_442913.1_10 Reverse -310 -329 2.16274 0.131
NP_442913.1_10 Forward -337 -318 -4.91709 0.251
NP_440779.1_5 Forward -328 -311 -4.68105 0.116
NP_442346.1_5 Reverse -318 -328 17.9746 0.00128
NP_442346.1_5 Forward -329 -319 16.6963 0.00248
NP_442346.1_5 Forward -73 -63 5.5849 0.238
NP_440545.1_3 Reverse -360 -377 0.92382 0.129
NP_440545.1_3 Reverse -315 -332 -0.452814 0.154
NP_440545.1_3 Forward -332 -315 -1.82945 0.175
NP_440831.1_3 Forward -337 -318 5.61052 0.28
NP_441126.1_6 Forward -150 -136 14.0413 0.283
NP_440459.1_2 Forward -375 -358 20.1967 0.0386
NP_441653.1_2 Reverse -308 -327 14.256 0.0943
NP_441653.1_2 Reverse -300 -319 5.17239 0.248
NP_442551.1_4 Reverse -317 -332 -2.08505 0.256
NP_442311.1_5 Forward -304 -285 2.3594 0.251
NP_440847.1_3 Forward -380 -366 10.422 0.294
NP_442603.1_7 Reverse -319 -333 10.2254 0.132
NP_442603.1_7 Forward -373 -359 7.47213 0.205
NP_442603.1_7 Forward -328 -314 6.68548 0.232
NP_441050.1_5 Forward -294 -276 5.82068 0.188
NP_440449.1_6 Reverse -62 -80 9.71478 0.17
NP_441833.1_4 Forward -327 -320 15.9687 0.0124
NP_441833.1_4 Reverse -320 -327 15.9687 0.0124
NP_441833.1_4 Forward -372 -365 6.52896 0.0924
NP_441833.1_4 Reverse -365 -372 6.23397 0.163
NP_441895.1_10 Forward -263 -244 -27.6315 0.282
NP_442162.1_9 Forward -327 -320 16.2637 0.0124
NP_442162.1_9 Reverse -320 -327 16.2637 0.0124
NP_442162.1_9 Forward -372 -365 12.9205 0.0282
NP_442162.1_9 Reverse -365 -372 12.9205 0.0282
NP_440671.1_4 Reverse -358 -372 10.6193 0.154
NP_441973.1_1 Reverse -355 -370 0.668214 0.235
NP_442199.1_5 Reverse -311 -330 -3.04881 0.2
NP_442199.1_5 Reverse -55 -74 -5.70374 0.253
NP_442140.1_3 Forward -327 -317 14.828 0.0433
NP_442140.1_3 Reverse -320 -330 12.2714 0.0632
NP_442140.1_3 Forward -372 -362 10.2065 0.0902
NP_442140.1_3 Reverse -64 -74 6.66654 0.159
NP_442140.1_3 Reverse -155 -165 6.46988 0.168
NP_441813.1_5 Forward -375 -365 15.0247 0.0147
NP_441813.1_5 Reverse -317 -327 8.92815 0.0347
NP_441813.1_5 Forward -330 -320 8.63316 0.0367
NP_442254.1_1 Reverse -23 -42 1.67108 0.249
NP_442254.1_1 Reverse -346 -365 1.17943 0.249
NP_440590.1_4 Reverse -320 -333 11.7207 0.0187
NP_440590.1_4 Forward -372 -359 1.29759 0.127
NP_440590.1_4 Forward -327 -314 -5.78224 0.289
NP_440567.1_1 Reverse -320 -334 7.76774 0.0654
NP_440567.1_1 Forward -327 -313 6.98109 0.0795
NP_440567.1_1 Forward -372 -358 2.35953 0.176
NP_442497.1_10 Forward -327 -318 19.8626 0.00532
NP_442497.1_10 Reverse -320 -329 10.4228 0.0087
NP_442497.1_10 Forward -372 -363 0.589713 0.153
NP_442497.1_10 Reverse -365 -374 -1.18024 0.256
NP_440821.1_4 Reverse -317 -327 19.5479 0.00399
NP_440821.1_4 Forward -330 -320 9.41981 0.0286
NP_440821.1_4 Reverse -152 -162 4.50326 0.13
NP_440821.1_4 Reverse -362 -372 -0.314959 0.251
NP_441239.1_9 Reverse -317 -329 14.4936 0.0272
NP_441239.1_9 Reverse -61 -73 14.4936 0.0272
NP_441239.1_9 Forward -375 -363 11.4454 0.0607
NP_441239.1_9 Forward -330 -318 6.92215 0.173
NP_441727.1_3 Forward -335 -316 7.7676 0.218
NP_441892.1_1 Forward -81 -64 -6.05768 0.296
NP_440665.1_1 Forward -325 -306 -13.2752 0.257
NP_442270.1_9 Reverse -353 -372 -9.44032 0.234
NP_442643.1_1 Reverse -154 -173 -3.83545 0.223
NP_441874.1_1 Forward -269 -255 12.1926 0.24
NP_440354.1_7 Forward -326 -308 6.01734 0.294
NP_440546.1_4 Reverse -364 -374 15.6695 0.0459
NP_440546.1_4 Forward -328 -318 12.8578 0.0572
NP_440546.1_4 Reverse -319 -329 10.046 0.109
NP_440675.1_3 Forward -328 -309 17.2074 0.0975
NP_440462.1_6 Forward -375 -365 14.828 0.0176
NP_440462.1_6 Reverse -317 -327 10.4031 0.0396
NP_440462.1_6 Forward -330 -320 1.35667 0.294
NP_440868.1_4 Forward -332 -320 17.7386 0.0124
NP_440868.1_4 Forward -377 -365 8.9871 0.0582
NP_440868.1_4 Reverse -360 -372 3.57889 0.134
NP_440868.1_4 Reverse -315 -327 0.432302 0.212
NP_442499.1_1 Forward -327 -308 2.26107 0.289
NP_441582.1_5 Forward -330 -311 10.0284 0.164
NP_441474.1_1 Reverse -324 -343 -1.96793 0.267
NP_442402.1_1 Reverse -23 -42 7.66927 0.289
NP_442402.1_4 Reverse -242 -261 2.75194 0.154
NP_442402.1_4 Reverse -23 -42 -8.16275 0.278
NP_442402.1_10 Reverse -251 -261 16.2041 0.118
NP_441848.1_4 Forward -129 -113 7.64616 0.288
NP_441848.1_7 Reverse -263 -282 9.24175 0.196
NP_441084.1_6 Reverse -317 -331 10.8954 0.226
NP_441084.1_6 Reverse -193 -207 9.05325 0.295
NP_442023.1_2 Forward -374 -355 6.39097 0.275
NP_442039.1_4 Forward -327 -320 15.1821 0.0124
NP_442039.1_4 Reverse -320 -327 15.1821 0.0124
NP_442039.1_4 Reverse -365 -372 11.6422 0.0747
NP_441811.1_8 Forward -334 -320 6.88276 0.259
NP_440825.1_7 Reverse -320 -330 12.9096 0.152
NP_440825.1_7 Forward -372 -362 10.9578 0.278
NP_442837.1_3 Forward -327 -320 15.7721 0.0124
NP_442837.1_3 Reverse -320 -327 15.7721 0.0124
NP_442837.1_3 Forward -372 -365 6.0373 0.25
NP_442837.1_3 Reverse -365 -372 6.0373 0.25
NP_442053.1_1 Forward -328 -319 18.3876 0.0007
NP_442053.1_1 Reverse -319 -328 18.3876 0.0007
NP_442053.1_1 Forward -373 -364 14.4544 0.0114
NP_442053.1_1 Reverse -364 -373 7.86621 0.0863
NP_440505.1_3 Forward -330 -320 9.22315 0.122
NP_440505.1_3 Reverse -317 -327 7.84651 0.147
NP_440505.1_3 Reverse -362 -372 7.64985 0.151
NP_441701.1_3 Forward -300 -283 12.4285 0.207
NP_441102.1_1 Reverse -365 -384 6.58763 0.241
NP_441252.1_6 Forward -261 -254 11.6422 0.288
NP_441203.1_1 Forward -372 -353 -19.5684 0.297
NP_441777.1_3 Reverse -84 -102 21.2967 0.211
NP_441584.1_4 Reverse -41 -60 14.0608 0.29
NP_442844.1_6 Reverse -373 -392 16.1257 0.29
NP_442532.1_7 Forward -328 -314 4.03116 0.178
NP_441408.2_7 Forward -375 -356 3.04771 0.199
NP_440914.1_1 Reverse -319 -329 17.5935 0.000537
NP_440914.1_1 Forward -373 -363 13.1043 0.0386
NP_440914.1_1 Reverse -364 -374 10.8597 0.118
NP_440914.1_1 Forward -328 -318 8.51751 0.186
NP_441011.1_8 Forward -327 -318 14.356 0.0249
NP_441011.1_8 Reverse -365 -374 11.5045 0.0778
NP_441011.1_8 Reverse -320 -329 8.25953 0.144
NP_442533.1_6 Forward -328 -319 17.2076 0.00137
NP_442533.1_6 Reverse -319 -328 17.2076 0.00137
NP_442533.1_6 Forward -373 -364 4.42462 0.179
NP_442533.1_6 Reverse -63 -72 3.7363 0.204
NP_442533.1_6 Forward -366 -357 2.06468 0.275
NP_443016.1_1 Reverse -313 -332 -4.81876 0.237
NP_441482.1_7 Reverse -313 -327 -3.04867 0.106
NP_441482.1_7 Forward -379 -365 -6.78525 0.193
NP_441482.1_7 Forward -78 -64 -9.44018 0.202
NP_439944.1_9 Forward -327 -317 17.4829 0.00423
NP_439944.1_9 Reverse -320 -330 10.5014 0.0887
NP_441697.1_5 Forward -201 -182 1.38421 0.178
NP_441697.1_5 Forward -36 -17 -7.49654 0.246
NP_441028.1_6 Reverse -252 -262 7.74772 0.218
NP_441028.1_6 Reverse -32 -42 5.48612 0.255
NP_441028.1_6 Forward -228 -218 4.7978 0.277
NP_442202.1_6 Reverse -226 -245 0.0977854 0.265
NP_440116.1_5 Reverse -361 -378 17.4434 0.0499
NP_440116.1_5 Forward -331 -314 12.0352 0.103
NP_440116.1_8 Reverse -320 -339 -2.16383 0.126
NP_441527.1_4 Forward -289 -270 -4.4408 0.186
NP_440115.1_6 Reverse -316 -326 10.0098 0.115
NP_440115.1_6 Reverse -361 -371 9.32148 0.115
NP_440115.1_6 Forward -331 -321 8.33817 0.13
NP_440007.1_9 Reverse -360 -374 6.78443 0.217
NP_440007.1_9 Forward -76 -62 2.5562 0.277
NP_440608.1_6 Reverse -320 -339 4.22689 0.271
NP_441602.1_3 Forward -333 -314 -5.50708 0.288
NP_441972.1_5 Forward -327 -308 -9.44032 0.285
NP_441106.1_1 Reverse -318 -327 9.73449 0.0311
NP_441106.1_1 Forward -329 -320 9.63616 0.0311
NP_441106.1_9 Reverse -264 -274 16.303 0.286
NP_440429.1_9 Forward -164 -145 8.16093 0.211
NP_439903.1_6 Forward -376 -357 4.03023 0.203
NP_439903.1_6 Reverse -60 -79 -0.591301 0.283
NP_442588.1_6 Forward -346 -327 -2.65548 0.294
NP_001035870.1_3 Forward -84 -65 -5.50708 0.28
NP_442306.1_10 Forward -333 -314 7.66927 0.035
NP_441286.1_1 Forward -329 -317 24.2284 0.000758
NP_441286.1_1 Reverse -318 -330 3.48056 0.0467
NP_441286.1_1 Reverse -363 -375 -4.48425 0.161
NP_442674.1_3 Reverse -146 -165 2.35861 0.3
NP_440670.1_8 Forward -328 -319 18.3876 0.000699
NP_440670.1_8 Reverse -319 -328 18.3876 0.000699
NP_440670.1_8 Reverse -364 -373 8.75118 0.0606
NP_440670.1_8 Forward -373 -364 6.19458 0.124
NP_441479.1_1 Reverse -361 -380 12.1925 0.171
NP_442477.1_2 Forward -334 -315 4.81767 0.168
NP_440886.1_7 Reverse -318 -328 8.04271 0.0805
NP_440886.1_7 Forward -329 -319 7.94438 0.0805
NP_440886.1_7 Forward -374 -364 6.76441 0.114
NP_442614.1_2 Reverse -319 -333 15.4376 0.0773
NP_442072.1_9 Forward -329 -311 -20.4337 0.204
NP_440513.1_4 Reverse -364 -383 12.3892 0.217
NP_441753.1_10 Reverse -310 -329 16.8141 0.0654
NP_440907.2_8 Forward -327 -317 19.449 0.00351
NP_440907.2_8 Reverse -320 -330 7.64939 0.117
NP_440907.2_8 Forward -372 -362 5.87944 0.184
NP_442264.1_2 Forward -119 -102 4.95539 0.288
NP_441021.1_1 Forward -327 -308 5.11266 0.0751
NP_441021.1_1 Reverse -282 -301 -8.752 0.2
NP_441463.1_2 Reverse -115 -133 2.96562 0.215
NP_441463.1_3 Reverse -309 -328 10.9142 0.0481
NP_441463.1_3 Forward -338 -319 -9.047 0.276
NP_441463.1_3 Reverse -327 -346 -9.34199 0.278
NP_441463.1_6 Forward -330 -316 6.70583 0.267
NP_441626.1_2 Forward -327 -320 15.7721 0.0124
NP_441626.1_2 Reverse -320 -327 15.7721 0.0124
NP_441626.1_2 Reverse -365 -372 12.2322 0.0511
NP_441626.1_2 Forward -372 -365 5.93897 0.231
NP_442365.1_7 Forward -332 -313 2.55606 0.168
NP_442794.1_1 Reverse -360 -372 12.232 0.0721
NP_442794.1_1 Forward -224 -212 3.18557 0.286
NP_442794.1_1 Forward -332 -320 2.59558 0.287
NP_442615.1_1 Forward -337 -319 6.60732 0.0344
NP_442615.1_1 Reverse -355 -373 1.19912 0.0894
NP_442615.1_1 Reverse -310 -328 -2.43913 0.144
NP_441962.1_1 Reverse -99 -118 -3.54046 0.293
NP_441962.1_4 Forward -333 -314 -14.3569 0.286
NP_440387.1_1 Forward -328 -312 8.71166 0.0282
NP_440387.1_1 Reverse -319 -335 -4.46469 0.187
NP_440387.1_1 Forward -373 -357 -5.34967 0.227
NP_441431.1_2 Forward -376 -362 12.2903 0.123
NP_441431.1_2 Reverse -316 -330 9.6354 0.181
NP_441431.1_3 Reverse -357 -376 4.71934 0.263
NP_441488.1_8 Reverse -359 -373 22.1234 0.00202
NP_441488.1_8 Forward -77 -63 10.1271 0.146
NP_441836.1_2 Forward -334 -315 -6.09707 0.291
NP_441993.1_1 Reverse -358 -377 8.37887 0.147
NP_442383.1_3 Reverse -132 -144 15.0836 0.257
NP_440358.1_8 Forward -199 -180 7.17762 0.174
NP_440358.1_8 Forward -315 -296 -0.000545616 0.263
NP_440814.1_4 Forward -337 -318 -11.8986 0.228
NP_440114.1_10 Forward -328 -314 13.2743 0.0609
NP_440114.1_10 Forward -72 -58 8.84938 0.192
NP_440114.1_10 Reverse -311 -325 7.17775 0.243
NP_440114.1_10 Reverse -364 -378 6.88276 0.253
NP_441425.1_4 Forward -40 -26 14.8476 0.282
NP_442698.1_10 Reverse -315 -334 -1.57384 0.3
NP_442324.1_7 Reverse -300 -319 10.8718 0.268
NP_441510.2_2 Reverse -243 -262 4.81688 0.26
NP_441510.2_7 Forward -373 -359 9.6354 0.281
NP_441510.2_7 Reverse -358 -372 9.43874 0.281
NP_441272.1_4 Reverse -355 -374 3.34271 0.233
NP_440766.1_2 Forward -45 -29 15.1024 0.295
NP_440766.1_4 Reverse -360 -374 3.24451 0.151
NP_440766.1_5 Forward -41 -29 7.94227 0.288
NP_440766.1_5 Forward -19 -7 6.89186 0.291
NP_439988.1_3 Forward -371 -357 5.1128 0.289
NP_441237.1_9 Forward -327 -317 17.2863 0.00348
NP_441237.1_9 Reverse -320 -330 14.828 0.0242
NP_440324.1_5 Reverse -361 -380 22.1239 0.0404
NP_439910.1_2 Reverse -311 -328 -21.4956 0.183
NP_440502.1_7 Forward -368 -349 13.2741 0.268
NP_442867.1_8 Forward -162 -143 4.71934 0.277
NP_440457.1_1 Reverse -315 -327 8.20045 0.101
NP_440457.1_1 Reverse -360 -372 1.80894 0.223
NP_440457.1_1 Forward -76 -64 -0.74767 0.273
NP_440798.1_6 Forward -372 -359 3.36254 0.151
NP_440798.1_6 Forward -327 -314 1.9859 0.188
NP_442680.1_7 Forward -242 -223 -6.98204 0.279
NP_442297.1_4 Reverse -360 -379 14.4749 0.195
NP_441984.1_3 Forward -83 -65 9.95058 0.195
NP_441436.1_8 Reverse -159 -178 10.4225 0.262
NP_440473.1_1 Forward -376 -357 17.7166 0.0823
NP_440473.1_9 Reverse -308 -327 -8.94866 0.26
NP_442509.1_9 Forward -328 -318 17.3841 0.00128
NP_442509.1_9 Reverse -319 -329 8.14104 0.192
NP_442582.1_3 Forward -130 -116 13.7625 0.257
NP_442514.1_5 Reverse -62 -81 -2.75457 0.222
NP_442514.1_5 Forward -374 -355 -2.95123 0.222
NP_441610.1_10 Reverse -218 -237 13.6675 0.241
NP_440554.1_4 Forward -327 -317 6.27322 0.123
NP_440554.1_4 Reverse -365 -375 1.65166 0.293
NP_441845.1_6 Reverse -307 -325 -1.84914 0.299
NP_441885.1_5 Reverse -319 -329 20.9245 0.000538
NP_441885.1_5 Forward -328 -318 11.3864 0.00668
NP_441885.1_5 Forward -373 -363 1.25834 0.11
NP_441885.1_5 Reverse -364 -374 -0.0199663 0.186
NP_442341.1_7 Reverse -318 -332 11.701 0.052
NP_442341.1_7 Forward -329 -315 8.65272 0.0858
NP_442341.1_9 Forward -375 -361 16.4202 0.0364
NP_441173.1_9 Reverse -252 -260 13.1954 0.184
NP_441173.1_9 Reverse -253 -261 12.507 0.206
NP_443000.1_7 Forward -330 -320 10.3048 0.0345
NP_443000.1_7 Reverse -317 -327 2.14332 0.226
NP_443000.1_7 Forward -375 -365 1.455 0.247
NP_443000.1_7 Reverse -362 -372 0.57002 0.294
NP_440727.1_2 Forward -336 -317 1.37609 0.288
NP_441842.1_1 Reverse -321 -334 18.8982 0.0142
NP_441842.1_10 Forward -335 -321 6.6861 0.278
NP_441842.1_10 Reverse -312 -326 6.19444 0.297
NP_440275.1_3 Reverse -317 -327 19.5479 0.00756
NP_440275.1_3 Forward -330 -320 8.04317 0.0602
NP_440275.1_3 Reverse -362 -372 5.48657 0.145
NP_440091.1_1 Reverse -315 -327 1.51394 0.197
NP_441397.1_8 Forward -41 -28 17.0593 0.142
NP_440679.1_10 Forward -344 -325 -16.4218 0.261
NP_442451.1_2 Forward -336 -317 -5.80207 0.226
NP_441122.1_1 Reverse -353 -368 5.09311 0.28
NP_442495.1_3 Reverse -147 -165 13.3922 0.259
NP_441105.1_3 Forward -83 -64 -6.39206 0.234
NP_441730.1_2 Reverse -114 -132 5.62401 0.299
NP_440216.1_1 Forward -328 -314 5.30946 0.0215
NP_440216.1_1 Reverse -319 -333 -9.24352 0.145
NP_440216.1_1 Reverse -364 -378 -12.1934 0.247
NP_440216.1_1 Forward -373 -359 -12.5868 0.288
NP_440216.1_9 Forward -280 -271 6.78456 0.289
NP_440216.1_9 Reverse -37 -46 5.89959 0.289
NP_440216.1_9 Forward -42 -33 5.40793 0.294
NP_440172.1_1 Forward -328 -318 16.303 0.00854
NP_440172.1_1 Reverse -319 -329 15.0247 0.00945
NP_440172.1_1 Reverse -364 -374 8.82982 0.0586
NP_440172.1_1 Forward -373 -363 2.24165 0.279
NP_442015.1_10 Forward -332 -319 10.4424 0.0391
NP_442015.1_10 Reverse -360 -373 0.60927 0.221
NP_442015.1_10 Reverse -37 -50 -1.06236 0.293
NP_441226.1_7 Forward -327 -320 14.4934 0.0123
NP_441226.1_7 Reverse -320 -327 14.4934 0.0123
NP_441226.1_7 Reverse -365 -372 12.7234 0.0312
NP_441226.1_7 Forward -372 -365 11.5435 0.0757
NP_441226.1_7 Forward -162 -155 11.2485 0.0971
NP_441111.1_7 Forward -327 -319 18.7023 0.00294
NP_441111.1_7 Reverse -320 -328 18.7023 0.00294
NP_441111.1_7 Forward -372 -364 8.86921 0.0589
NP_439971.2_9 Forward -86 -67 20.354 0.107
NP_441766.1_2 Forward -328 -319 17.5026 0.00297
NP_441766.1_2 Reverse -319 -328 17.5026 0.00297
NP_441766.1_2 Forward -373 -364 14.7494 0.00772
NP_442417.1_5 Forward -373 -359 7.17775 0.195
NP_440416.1_9 Reverse -357 -376 -10.3253 0.14
NP_443052.1_8 Reverse -309 -328 0.294447 0.0669
NP_442116.1_6 Reverse -115 -132 11.8931 0.189
NP_442116.1_6 Reverse -187 -204 6.83207 0.271
NP_442116.1_6 Forward -242 -225 5.59067 0.293
NP_442154.1_1 Reverse -146 -164 -16.7954 0.245
NP_440261.1_5 Reverse -320 -333 5.03416 0.0478
NP_440261.1_5 Forward -327 -314 -0.767364 0.0655
NP_440261.1_5 Forward -372 -359 -10.7971 0.21
NP_440988.1_10 Reverse -317 -331 8.4809 0.205
NP_440988.1_10 Forward -117 -103 3.34982 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATGGCTATTAATTTCCAACTCATCCACCCGATCGCCAAGGGCCAAGTTAAAAGTACGAACACGGTTTTGTTGGCGATCGCCCCATTGTTGGAGTTGTTGATAGGGTAGGGGCAAGGGTTCAAAGGCAAAAATTTGAGCTTGGGGAAAATAGCGGCGCATTTTTTTGGCAAATTGTCCCTTATTAGCGCCAATATCAATAATGGTTTGAATATTTAATTGCCTAATTCCCAGAAGTCTGCCATCCCAACTAGGGGTGAGCAAGTTGCCAACAAAGTTAAAAAAATTGTCACTGCAACGGCGGATAAAAGCGTTATTCAACAGAGCCTGGGCCATGGGATTATTAAATCTTGATGTTTCCCGTGGGAAAAATTGAAAATTTAGTGGACAAAAATAATATAA

CDS

ATGGCTTGGACATTACTGCACAGTAAGCTCCATCAAAATTTGCAACGGCGCTTCCCCGAGTTGCAAGGAACTCGAATTTTAGTGGCGGTATCCGGGGGACAAGACTCCCTCTGTTTACTGCATCTACTTAATGATTTAACCAAACAATGGCAGTGGCATTTGGCCGTAGCCCACTGTGACCACCGTTGGCCCACCGATGCAGGCATTGCCGACCACGTACAAGGCCTAGCCCAAGGTTATAAACTACCCTATTTCCAACGGGATGCCCAAGATTTACCCCAAACGGAAGCCGCCGCCCGCCATTGGCGTTACCACGCCCTCACGGCGATCGCCAAAGCAGAAAATTTTCCGGTGGTTATGACTGGCCATACCCAGAGCGACCGGGCAGAAACTTTATTGTTTAACCTCGTGCGGGGCAGTGGCAGTGACGGCTTACAAGCGATGAATTGGGTGAGGAATTTGGAAGAGTCCGGCTCAGACAAAAGCCCGATTAGGCTAATCCGTCCCCTCTTGGAAATTAGTCGTCAAGAAACTGGAGATTTTTGCCAGCAACAACAATTGTCTGTGTGGGAAGACGTGCTCAACGAAAAGTTGACCTATCGCCGCAACCGCATTCGAGGAGAATTGATTCCCTACTTAAAGAAACATTTCAATCCCCAGGTGGAAAAAAGTTTAGCTCAAACGGTGGAATTGTTAACAGCAGAAGTGGCTTATTTAGAGCAAGTTAGTGGAGAAATTTATCAAACCCTAAGCCAAACGGATCAAAAAAGTTTAAACTGTCGTTTACTCAGTCAAAAACCCCTGGCCTTACAACGGCGTATCATTCGCCAATTTCTACAATCCTGTCAAAGCCAATCTCCCAATTTTGAGGAAATTGAACAGATAGTAGGGTTGATTAATGCCCCCAACCGCTCCCAAACTTCTTCCCTACCAGGTCAAGGAATAGTTAGGGTGGAAGGGGACTTTTTGCGATACATTTACCAGGGTAAATAG

Protein

MAWTLLHSKLHQNLQRRFPELQGTRILVAVSGGQDSLCLLHLLNDLTKQWQWHLAVAHCDHRWPTDAGIADHVQGLAQGYKLPYFQRDAQDLPQTEAAARHWRYHALTAIAKAENFPVVMTGHTQSDRAETLLFNLVRGSGSDGLQAMNWVRNLEESGSDKSPIRLIRPLLEISRQETGDFCQQQQLSVWEDVLNEKLTYRRNRIRGELIPYLKKHFNPQVEKSLAQTVELLTAEVAYLEQVSGEIYQTLSQTDQKSLNCRLLSQKPLALQRRIIRQFLQSCQSQSPNFEEIEQIVGLINAPNRSQTSSLPGQGIVRVEGDFLRYIYQGK