Your browser is old and dusty. Try Google Chrome!

Details for slr1262

ORF slr1262
Accession NP_441176.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -206 -192 -1.47537 0.262
NP_441480.1_2 Forward -149 -130 9.24257 0.299
NP_441480.1_5 Forward -158 -139 9.43923 0.299
NP_441630.1_3 Reverse -365 -384 1.76941 0.239
NP_442287.1_5 Reverse -197 -207 14.9263 0.218
NP_441470.1_5 Forward -227 -208 9.97993 0.267
NP_441470.1_6 Forward -221 -202 5.60432 0.298
NP_442861.1_1 Reverse -167 -186 10.1275 0.295
NP_440061.1_9 Forward -384 -370 9.83206 0.137
NP_440061.1_9 Forward -322 -308 5.01387 0.298
NP_442062.1_8 Reverse -311 -321 11.0914 0.0493
NP_440304.1_4 Reverse -371 -381 4.10993 0.272
NP_442602.1_3 Forward -391 -372 -2.26216 0.256
NP_441594.1_6 Forward -323 -304 -0.295539 0.298
NP_440769.1_8 Forward -47 -28 6.88262 0.286
NP_441083.1_5 Forward -207 -197 2.83163 0.191
NP_442827.1_8 Reverse -365 -384 2.9486 0.153
NP_442570.1_3 Forward -154 -135 -8.752 0.292
NP_441792.1_5 Reverse -142 -158 8.80999 0.251
NP_441598.1_1 Reverse -278 -297 11.7992 0.172
NP_441598.1_3 Forward -374 -355 24.0448 0.00701
NP_441624.1_6 Reverse -133 -152 12.0933 0.295
NP_442848.1_1 Forward -307 -293 6.6861 0.0791
NP_443018.1_3 Forward -396 -389 6.62729 0.168
NP_440376.1_1 Reverse -311 -320 3.63797 0.2
NP_440376.1_1 Reverse -373 -382 2.55633 0.218
NP_441588.1_4 Forward -55 -45 8.04317 0.161
NP_442687.1_7 Reverse -372 -382 6.76487 0.154
NP_442530.1_2 Forward -184 -174 11.5831 0.284
NP_440571.1_5 Forward -22 -3 15.9291 0.221
NP_440667.1_2 Reverse -198 -217 -9.14533 0.297
NP_442658.1_1 Forward -322 -312 10.4026 0.119
NP_440607.1_8 Forward -239 -220 0.884433 0.28
NP_441256.1_8 Reverse -304 -323 2.85105 0.285
NP_441317.1_4 Reverse -209 -223 9.65494 0.29
NP_441958.1_5 Reverse -372 -382 -1.29827 0.236
NP_440203.1_5 Forward -318 -308 10.8943 0.209
NP_439905.1_1 Reverse -312 -325 9.45906 0.219
NP_440443.2_2 Forward -352 -334 23.1269 0.0352
NP_443055.1_6 Forward -382 -364 10.9331 0.114
NP_443055.1_6 Reverse -273 -291 -0.571569 0.263
NP_442002.1_9 Reverse -372 -379 11.3472 0.185
NP_442002.1_9 Forward -39 -32 11.1505 0.185
NP_442032.1_1 Reverse -300 -318 19.7837 0.252
NP_441646.1_1 Forward -327 -308 1.57275 0.231
NP_442431.1_6 Forward -290 -271 15.7324 0.224
NP_442431.1_10 Forward -240 -222 1.78911 0.247
NP_441674.1_6 Reverse -224 -243 5.211 0.261
NP_440147.1_4 Forward -384 -371 0.412608 0.255
NP_440569.1_5 Forward -243 -224 13.1758 0.164
NP_440674.1_3 Reverse -60 -79 8.35759 0.199
NP_440260.1_7 Reverse -201 -220 1.76941 0.241
NP_440260.1_8 Forward -156 -138 -1.65248 0.237
NP_442281.1_1 Reverse -287 -301 1.76896 0.29
NP_439983.1_7 Reverse -204 -222 10.5406 0.277
NP_442049.1_2 Forward -162 -143 11.3075 0.176
NP_442982.1_5 Forward -378 -359 -1.47551 0.266
NP_440652.1_1 Forward -234 -215 10.9142 0.126
NP_442029.1_10 Reverse -356 -375 5.70265 0.284
NP_440253.1_2 Reverse -292 -310 -0.7675 0.223
NP_442554.1_8 Forward -300 -290 2.43831 0.272
NP_443009.1_5 Reverse -310 -321 11.7595 0.0602
NP_441865.1_3 Forward -180 -162 15.4571 0.234
NP_441015.1_9 Forward -217 -204 17.1282 0.246
NP_441637.1_9 Forward -46 -28 3.16574 0.264
NP_442719.1_2 Forward -45 -27 -1.75153 0.178
NP_442559.1_7 Forward -317 -298 21.8289 0.091
NP_442427.1_8 Forward -46 -27 5.211 0.274
NP_442808.1_1 Forward -322 -312 3.12618 0.248
NP_441176.1_1 Forward -194 -175 33.0387 0.0000601
NP_441176.1_2 Forward -107 -88 31.5637 0.0000515
NP_441176.1_3 Forward -341 -322 24.8772 0.0177
NP_441176.1_4 Forward -79 -60 28.8104 0.000664
NP_441176.1_5 Forward -263 -244 23.9922 0.0332
NP_441176.1_6 Forward -212 -198 25.7623 0.0018
NP_441176.1_9 Forward -172 -153 25.3688 0.0163
NP_440145.1_3 Forward -392 -373 -2.16383 0.163
NP_441114.1_3 Forward -319 -310 7.57121 0.231
NP_440162.1_2 Reverse -348 -367 6.88262 0.282
NP_440274.1_2 Reverse -259 -273 10.6187 0.296
NP_441518.1_4 Forward -214 -195 1.76863 0.299
NP_441878.1_6 Reverse -372 -382 -6.90313 0.198
NP_441878.1_6 Forward -321 -311 -7.59145 0.245
NP_441036.1_8 Reverse -121 -131 8.82982 0.174
NP_442066.2_4 Forward -382 -363 0.884433 0.157
NP_442830.1_5 Forward -322 -308 13.7653 0.168
NP_442919.1_3 Forward -225 -206 6.22677 0.282
NP_442397.1_9 Forward -327 -308 4.03102 0.26
NP_441549.1_7 Reverse -126 -145 13.0766 0.247
NP_440861.1_2 Reverse -129 -148 10.4872 0.27
NP_442965.1_2 Forward -366 -347 -7.86702 0.274
NP_442965.1_5 Forward -373 -355 12.8022 0.241
NP_442998.1_5 Forward -40 -30 7.25653 0.298
NP_441449.1_8 Reverse -34 -53 15.8248 0.21
NP_441449.1_8 Reverse -60 -79 14.4695 0.24
NP_442333.2_5 Reverse -91 -110 -10.7186 0.246
NP_440256.1_1 Reverse -308 -327 -3.83545 0.14
NP_440087.1_5 Forward -317 -298 13.6675 0.102
NP_441559.1_8 Reverse -306 -320 1.17956 0.156
NP_441559.1_8 Forward -387 -373 0.589577 0.165
NP_441559.1_8 Forward -325 -311 -4.7203 0.236
NP_441559.1_8 Reverse -137 -151 -5.50694 0.264
NP_441559.1_8 Reverse -307 -321 -6.78525 0.279
NP_441559.1_8 Forward -157 -143 -6.78525 0.279
NP_442860.1_7 Reverse -28 -46 7.83694 0.283
NP_440915.1_6 Forward -324 -310 -1.5737 0.239
NP_442158.1_4 Forward -159 -149 10.3048 0.299
NP_440702.1_8 Forward -308 -289 11.4058 0.233
NP_442386.1_5 Forward -220 -201 5.01354 0.263
NP_442386.1_9 Reverse -227 -236 7.96411 0.213
NP_442386.1_9 Forward -321 -312 7.17747 0.219
NP_442791.1_9 Forward -192 -173 14.1583 0.207
NP_441676.1_9 Reverse -129 -146 14.0011 0.253
NP_442474.1_9 Forward -134 -115 9.0459 0.264
NP_442240.1_2 Forward -300 -281 -20.2567 0.295
NP_440161.1_3 Reverse -129 -148 12.5858 0.174
NP_440161.1_10 Reverse -367 -386 13.1708 0.296
NP_441027.1_1 Reverse -26 -40 12.3887 0.27
NP_440586.1_8 Reverse -49 -56 7.51192 0.239
NP_439937.1_8 Forward -293 -274 2.85105 0.209
NP_439937.1_9 Forward -322 -305 -13.7281 0.287
NP_443039.1_7 Reverse -253 -267 4.52221 0.259
NP_440439.1_1 Reverse -308 -321 1.69091 0.147
NP_439943.1_4 Forward -180 -161 4.62101 0.287
NP_440819.1_5 Forward -226 -218 7.59091 0.272
NP_439977.1_5 Reverse -89 -108 -2.85214 0.29
NP_442384.1_10 Forward -320 -307 6.1158 0.11
NP_441980.1_6 Forward -378 -360 19.6853 0.281
NP_441018.1_7 Forward -145 -126 14.5524 0.118
NP_442790.1_4 Reverse -364 -383 -9.53865 0.187
NP_442262.1_10 Forward -396 -389 10.1672 0.162
NP_440562.1_10 Forward -391 -373 8.7706 0.284
NP_441965.1_10 Forward -323 -307 5.95839 0.192
NP_440297.1_9 Forward -320 -310 3.91327 0.253
NP_441896.1_3 Forward -329 -310 0.392778 0.226
NP_440888.1_2 Reverse -311 -325 8.75042 0.149
NP_442277.1_7 Forward -228 -212 -1.99853 0.289
NP_442033.1_10 Reverse -371 -390 -13.0786 0.281
NP_441123.1_6 Forward -383 -365 9.0656 0.279
NP_440105.1_7 Reverse -200 -219 13.4708 0.241
NP_441918.1_7 Reverse -197 -216 6.29264 0.262
NP_441469.1_8 Forward -321 -312 12.1928 0.123
NP_442315.1_1 Forward -106 -88 11.2289 0.161
NP_440220.1_4 Reverse -35 -54 -3.83621 0.297
NP_441462.1_2 Reverse -373 -383 -1.10161 0.281
NP_442204.1_5 Forward -235 -216 1.76941 0.228
NP_440783.1_5 Forward -247 -228 -4.72043 0.276
NP_441443.1_2 Forward -329 -310 -2.16383 0.26
NP_441893.1_8 Forward -104 -85 16.8141 0.209
NP_441321.1_5 Reverse -27 -46 2.16274 0.287
NP_440689.1_1 Reverse -91 -109 6.80398 0.297
NP_441336.1_10 Reverse -122 -141 12.0942 0.265
NP_441004.1_1 Reverse -367 -386 3.44104 0.106
NP_441004.1_1 Forward -240 -221 -17.8968 0.295
NP_441004.1_2 Forward -331 -312 3.6377 0.204
NP_441004.1_2 Reverse -362 -381 -1.86883 0.263
NP_441004.1_4 Reverse -370 -380 9.91146 0.259
NP_442813.1_4 Forward -113 -94 -6.88371 0.299
NP_442694.1_4 Forward -140 -131 11.4061 0.277
NP_442694.1_4 Reverse -207 -216 10.8161 0.294
NP_442694.1_9 Forward -148 -129 9.43923 0.244
NP_442206.1_1 Reverse -311 -330 -13.8652 0.263
NP_442515.1_1 Forward -383 -369 -4.91696 0.298
NP_441396.1_5 Reverse -199 -208 8.65285 0.21
NP_441046.1_2 Forward -184 -165 0.491109 0.268
NP_440588.1_2 Reverse -302 -321 -5.60541 0.256
NP_442006.1_2 Forward -375 -358 -16.8741 0.265
NP_441078.1_4 Forward -320 -311 5.60459 0.111
NP_440539.1_9 Reverse -130 -149 -1.7705 0.286
NP_442348.1_2 Reverse -206 -215 16.0277 0.113
NP_442348.1_2 Forward -262 -253 7.96454 0.28
NP_442348.1_2 Forward -141 -132 6.5879 0.299
NP_440707.1_9 Forward -290 -271 3.14605 0.268
NP_441333.1_1 Reverse -211 -221 14.7357 0.208
NP_441732.1_2 Forward -386 -370 -16.6577 0.186
NP_441737.1_1 Forward -386 -367 4.42435 0.268
NP_442815.1_2 Forward -236 -218 2.47742 0.295
NP_440578.1_4 Reverse -217 -236 9.43923 0.286
NP_441057.1_3 Forward -159 -140 -3.73712 0.187
NP_442400.1_10 Reverse -30 -43 8.46506 0.278
NP_442489.1_7 Forward -320 -311 -1.6719 0.235
NP_442489.1_7 Forward -382 -373 -1.77023 0.247
NP_442489.1_7 Reverse -373 -382 -1.86856 0.259
NP_442489.1_7 Reverse -311 -320 -1.96689 0.28
NP_442346.1_5 Reverse -47 -57 7.35486 0.172
NP_440025.1_3 Forward -42 -28 11.7725 0.286
NP_440743.1_5 Reverse -277 -296 10.0284 0.242
NP_441585.1_5 Forward -389 -370 -1.47628 0.298
NP_441050.1_5 Reverse -167 -185 -2.43913 0.283
NP_440946.1_6 Reverse -362 -381 3.53937 0.294
NP_441044.1_4 Forward -218 -200 18.0137 0.198
NP_442028.1_1 Reverse -210 -223 7.03268 0.292
NP_442497.1_2 Reverse -375 -394 17.2074 0.162
NP_441239.1_9 Reverse -309 -321 3.2839 0.289
NP_442044.1_1 Forward -368 -349 -9.44032 0.268
NP_441017.1_8 Forward -285 -270 9.22301 0.231
NP_441874.1_1 Forward -272 -258 14.5526 0.178
NP_442216.1_4 Reverse -255 -263 8.08217 0.255
NP_440675.1_4 Reverse -369 -388 22.8122 0.0356
NP_441249.1_8 Forward -151 -132 2.26107 0.284
NP_441582.1_5 Forward -323 -304 2.55527 0.293
NP_440351.1_1 Forward -56 -37 -2.0655 0.251
NP_441252.1_6 Forward -41 -34 14.3954 0.168
NP_441252.1_6 Reverse -370 -377 11.9372 0.25
NP_440914.1_1 Forward -320 -310 12.6163 0.0518
NP_441011.1_3 Reverse -136 -155 13.8641 0.165
NP_442533.1_6 Forward -320 -311 6.98123 0.0992
NP_440263.1_3 Forward -158 -139 5.70265 0.243
NP_440263.1_5 Forward -81 -67 9.93102 0.294
NP_442322.1_4 Reverse -140 -157 -9.7949 0.297
NP_441482.1_7 Reverse -286 -300 -4.7203 0.156
NP_440007.1_4 Forward -162 -143 10.3242 0.251
NP_440007.1_9 Reverse -194 -208 2.75286 0.277
NP_440007.1_9 Reverse -288 -302 0.392915 0.298
NP_441680.1_4 Reverse -139 -158 3.04771 0.224
NP_441059.1_10 Forward -370 -357 15.0639 0.189
NP_442306.1_10 Reverse -306 -325 -9.53865 0.11
NP_440670.1_8 Reverse -373 -382 5.11294 0.171
NP_441930.1_2 Reverse -311 -321 14.0414 0.236
NP_441930.1_2 Forward -321 -311 13.0581 0.248
NP_440886.1_7 Forward -208 -198 5.97777 0.151
NP_442022.1_4 Forward -140 -121 8.75091 0.268
NP_439999.1_8 Reverse -136 -155 14.3549 0.236
NP_442794.1_1 Forward -61 -49 5.15219 0.231
NP_441836.1_2 Reverse -305 -324 -5.60541 0.284
NP_441193.1_1 Reverse -125 -144 13.2733 0.229
NP_442323.1_7 Reverse -287 -306 4.91521 0.21
NP_440492.1_7 Forward -39 -23 18.9381 0.295
NP_440287.1_6 Forward -182 -163 2.85105 0.226
NP_440766.1_4 Forward -305 -291 1.27789 0.243
NP_439988.1_3 Reverse -361 -375 13.8643 0.185
NP_442867.1_8 Reverse -358 -377 3.93269 0.295
NP_441332.1_6 Forward -208 -198 13.583 0.184
NP_442509.1_9 Reverse -143 -153 6.46942 0.268
NP_440756.1_1 Forward -50 -31 14.1506 0.294
NP_440478.1_9 Reverse -135 -154 10.1275 0.255
NP_441428.1_8 Forward -328 -309 6.09597 0.226
NP_441122.1_1 Reverse -44 -59 3.02816 0.287
NP_441207.1_4 Forward -140 -121 3.6377 0.291
NP_441207.1_7 Reverse -108 -122 9.83628 0.273
NP_440175.1_7 Forward -174 -156 9.94867 0.272
NP_442495.1_4 Forward -297 -287 11.9764 0.251
NP_441105.1_3 Reverse -300 -319 -2.36049 0.159
NP_440172.1_1 Forward -382 -372 7.05986 0.0929
NP_440172.1_1 Forward -320 -310 2.33998 0.279
NP_441226.1_7 Forward -231 -224 6.82361 0.246
NP_441485.1_2 Forward -164 -145 17.3057 0.274
NP_442403.1_8 Forward -157 -138 9.14423 0.142
NP_440591.1_5 Reverse -79 -98 12.0933 0.207
NP_440261.1_5 Forward -319 -306 -8.43718 0.201
NP_440261.1_5 Forward -381 -368 -10.7971 0.21
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TATCCCGATTGAATCCTAGCCAATTGCCCCAAGCGGAAGGAAAAACGACGGTACTCTATTGTCAAAGTAGTAACCGTTCCGGCAATGCCCTGCAACAATTGAGATCTGCTGGGGTGGAAGGAATCATTCATTTGGAAGGGGGATTATTAGCTTGGAAACAGGCTGGGTTGCCGACGGTAAAAACAAAAAATGCCCCCATCAGCATTATGCGTCAGGTGCAAATTATTGCCGGTAGTTTGGTTTTGACCGGGGTTTTGCTGGGCAGTTTTGTCGCCCCTGGATTTTATTTTCTCAGTGGTTTTGTCGGCGCAGGATTATTATTTGCCGGACTTTCTGGCACCTGTATGATGGCTAATCTTTTGGGCAAATTACCCTACAACCAAATTAAGGACTAATAACC

CDS

ATGGCACTCCAAGTGGTGGGCTATTTTTTGGCAAGTTGCATTGGCCTAAGTTTGGGGCTTTTGGGAGGTGGCGGCTCGGTGTTAGCCCTGCCCATTTTGGTCTATGTCATGCAGGTTCCCCCCAAGGCGGCGATCGCCATGACGTTAGTGATTGTGGGGGCCGTGAGCTTGATTGGGGTCATTCCCCATTGGCATCGGGGTAATGTTAATCTCCCCAAGGCCCTGATTTTTGGTTCAGCCACCATGGTGGGAGCTTTTGGCGGGGCTAAGCTAGCCGCTCTTCCTTTAGTGACAGAAACGTTTCAGTTGATTTTATTTGCGGTGCTGATGCTGGTGGCGGCTATTTTTATGATCCGCAAAGCCCAACAACGACCCCAGTTATCCTCCACAGAGGATCCTGATTTAGCCACCTATCCCGCCCCCATTTGTAAATATTGTTGGCTGTGGCTACTGACGGAAGGCATTGCCATTGGCGTTTTAACCGGGCTGGTGGGAGTGGGGGGAGGATTTGCCATTGTACCCGCCCTAGTGTTGCTGGGAAAATTGCCCATGAAAGAGGCGATCGGGACTTCCCTGTTGATTATTGCCTTTAACTCTGTGGCCGGCTTTTTAGGTTATTTTGGCCAAGTTAGTTTGGATTATCATCTGATGGTGAGTTTTACGTTCTTCGCCGCCCTGGGAATTTTATTGGGTTCCTATCTATCCAGTTTTGTTGACGCCAAAAATCTCCAAAAAGGTTTTGCTTATTTCCTCATGGCGATCGCCGCCTTTATTTTGTTCCAACAACGGGATACTTTCCGAAGCTCCAAAGTTAATAGCTATCTGCCCGAAATAAGCTCCCAAGTATTGCTGCAAAAAGCACAGTAG

Protein

MALQVVGYFLASCIGLSLGLLGGGGSVLALPILVYVMQVPPKAAIAMTLVIVGAVSLIGVIPHWHRGNVNLPKALIFGSATMVGAFGGAKLAALPLVTETFQLILFAVLMLVAAIFMIRKAQQRPQLSSTEDPDLATYPAPICKYCWLWLLTEGIAIGVLTGLVGVGGGFAIVPALVLLGKLPMKEAIGTSLLIIAFNSVAGFLGYFGQVSLDYHLMVSFTFFAALGILLGSYLSSFVDAKNLQKGFAYFLMAIAAFILFQQRDTFRSSKVNSYLPEISSQVLLQKAQ