Your browser is old and dusty. Try Google Chrome!

Details for slr1260

ORF slr1260
Accession NP_441174.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -171 -157 1.17956 0.193
NP_440795.1_7 Forward -171 -164 14.6904 0.0123
NP_440795.1_7 Reverse -164 -171 14.6904 0.0123
NP_440795.1_7 Forward -345 -338 7.80726 0.232
NP_441418.1_6 Reverse -163 -182 -21.6334 0.156
NP_441418.1_6 Forward -94 -75 -30.4831 0.28
NP_441453.1_1 Forward -179 -161 5.32826 0.25
NP_441453.1_4 Reverse -163 -171 16.539 0.00633
NP_441453.1_4 Forward -172 -164 7.8859 0.0536
NP_442151.1_6 Reverse -163 -177 13.1759 0.0573
NP_442151.1_6 Forward -172 -158 6.88276 0.217
NP_442151.1_6 Forward -244 -230 5.1128 0.294
NP_441818.1_1 Forward -171 -160 15.4961 0.0264
NP_441818.1_1 Reverse -164 -175 11.6612 0.169
NP_440226.1_1 Forward -172 -153 8.06259 0.0944
NP_440226.1_1 Reverse -163 -182 2.45773 0.263
NP_441630.1_3 Forward -327 -308 0.196116 0.283
NP_442655.1_10 Forward -380 -361 -19.8634 0.292
NP_442173.1_1 Forward -171 -163 15.4574 0.00633
NP_442173.1_1 Reverse -164 -172 8.27922 0.101
NP_442752.1_3 Reverse -390 -400 16.6145 0.239
NP_442752.1_4 Reverse -163 -170 13.8055 0.0199
NP_442752.1_4 Forward -367 -360 9.18389 0.116
NP_443027.1_4 Reverse -161 -171 11.0914 0.107
NP_442975.1_10 Forward -176 -162 11.602 0.0497
NP_440784.1_7 Forward -171 -164 15.9687 0.0123
NP_440784.1_7 Reverse -164 -171 15.9687 0.0123
NP_442909.1_7 Forward -171 -157 6.0955 0.258
NP_440061.1_9 Reverse -161 -175 13.9619 0.0735
NP_441054.1_4 Forward -182 -164 -0.177514 0.18
NP_440878.1_9 Forward -356 -337 1.0811 0.185
NP_442062.1_8 Reverse -163 -173 9.41981 0.0625
NP_442062.1_8 Forward -172 -162 7.84651 0.0871
NP_441859.1_3 Forward -95 -76 8.94676 0.131
NP_440304.1_4 Forward -174 -164 8.1415 0.0859
NP_440304.1_4 Reverse -161 -171 1.84832 0.299
NP_442242.1_4 Forward -171 -164 14.3954 0.0124
NP_442242.1_4 Reverse -164 -171 14.3954 0.0124
NP_440044.1_8 Forward -243 -224 -1.37718 0.244
NP_441581.1_6 Forward -100 -81 9.87422 0.29
NP_440049.1_3 Forward -336 -317 16.6174 0.231
NP_441352.1_2 Forward -108 -89 0.491109 0.268
NP_441210.1_3 Reverse -257 -276 14.5524 0.255
NP_441208.1_9 Forward -349 -335 5.01447 0.282
NP_441594.1_6 Forward -110 -91 5.50599 0.209
NP_441594.1_6 Forward -247 -228 2.85105 0.242
NP_441083.1_3 Forward -236 -226 13.6475 0.205
NP_441083.1_5 Forward -172 -162 19.0562 0.00147
NP_441083.1_5 Reverse -163 -173 9.61647 0.0243
NP_442827.1_8 Reverse -155 -174 -3.04956 0.296
NP_441434.1_7 Forward -170 -156 4.12949 0.225
NP_441738.1_2 Forward -170 -163 15.28 0.0102
NP_441558.1_5 Forward -174 -155 17.8957 0.0179
NP_441558.1_5 Reverse -161 -180 6.29264 0.22
NP_440209.1_1 Reverse -163 -171 18.1123 0.00295
NP_440209.1_1 Forward -172 -164 15.1624 0.00583
NP_440178.1_7 Forward -173 -154 -20.945 0.204
NP_442706.1_5 Forward -29 -10 13.1515 0.262
NP_441716.1_1 Reverse -163 -177 16.8142 0.033
NP_441716.1_1 Reverse -337 -351 2.94952 0.284
NP_442111.1_4 Forward -173 -159 2.5562 0.271
NP_440906.1_5 Forward -171 -164 15.8704 0.0124
NP_440906.1_5 Reverse -164 -171 15.8704 0.0124
NP_440747.1_10 Reverse -160 -172 7.02048 0.0108
NP_440747.1_10 Forward -175 -163 -11.7607 0.142
NP_441130.1_10 Forward -174 -160 9.2427 0.128
NP_441130.1_10 Reverse -161 -175 8.25939 0.139
NP_441265.1_3 Forward -178 -164 12.6843 0.0762
NP_442848.1_1 Reverse -157 -171 -1.5737 0.263
NP_442848.1_5 Reverse -330 -348 3.3624 0.276
NP_442848.1_5 Reverse -336 -354 -0.7675 0.276
NP_443018.1_3 Forward -171 -164 14.8871 0.0123
NP_443018.1_3 Reverse -164 -171 14.8871 0.0123
NP_441316.1_7 Forward -174 -159 -3.26502 0.273
NP_441634.1_8 Reverse -161 -175 15.4376 0.0248
NP_440376.1_1 Reverse -163 -172 9.73449 0.0365
NP_440376.1_1 Forward -172 -163 9.63616 0.0385
NP_440376.1_1 Reverse -337 -346 5.50626 0.131
NP_441588.1_4 Forward -170 -160 6.46988 0.193
NP_442687.1_7 Forward -173 -163 15.8113 0.0125
NP_442687.1_7 Reverse -336 -346 8.92815 0.0994
NP_442687.1_7 Reverse -61 -71 6.27322 0.175
NP_442485.1_3 Forward -255 -236 2.0644 0.215
NP_442485.1_3 Forward -246 -227 -4.81876 0.285
NP_442946.1_7 Forward -217 -202 14.2504 0.284
NP_442958.1_3 Reverse -152 -171 1.96607 0.267
NP_440042.1_2 Forward -182 -163 1.57275 0.202
NP_441950.1_8 Reverse -91 -105 15.3392 0.0987
NP_442658.1_1 Forward -174 -164 15.5158 0.0122
NP_442658.1_1 Reverse -161 -171 7.94438 0.199
NP_441855.2_4 Forward -342 -323 10.1015 0.261
NP_442782.1_2 Reverse -215 -229 8.25939 0.198
NP_441414.1_9 Forward -172 -153 6.88262 0.0373
NP_440720.1_1 Forward -183 -164 1.37609 0.279
NP_442937.1_5 Forward -345 -326 6.4893 0.278
NP_441958.1_5 Forward -173 -163 10.6981 0.0112
NP_441958.1_5 Reverse -162 -172 3.12662 0.0364
NP_441127.1_1 Forward -107 -93 11.7993 0.215
NP_441127.1_1 Reverse -226 -240 10.1277 0.259
NP_439905.1_1 Forward -171 -158 18.1122 0.0324
NP_440984.1_7 Reverse -158 -172 11.0127 0.122
NP_440984.1_7 Reverse -90 -104 5.30946 0.259
NP_440984.1_7 Reverse -332 -346 4.52282 0.299
NP_439990.1_5 Reverse -158 -171 10.2457 0.128
NP_442911.1_2 Reverse -153 -172 -7.86702 0.221
NP_442911.1_2 Reverse -279 -298 -9.93197 0.267
NP_443055.1_6 Forward -327 -309 1.69003 0.225
NP_441099.1_5 Forward -182 -163 4.22769 0.05
NP_441099.1_5 Forward -344 -325 -7.4737 0.176
NP_441099.1_5 Reverse -153 -172 -11.8986 0.291
NP_441294.1_7 Forward -176 -162 15.9698 0.0176
NP_441000.1_6 Forward -173 -159 -1.37704 0.213
NP_440147.1_4 Reverse -161 -174 9.06573 0.0437
NP_440147.1_4 Forward -246 -233 2.87088 0.202
NP_440147.1_4 Forward -174 -161 2.18257 0.209
NP_441175.1_1 Forward -214 -195 19.7631 0.0454
NP_441175.1_3 Forward -331 -312 33.6286 0.0000731
NP_441175.1_4 Forward -106 -87 30.0887 0.000315
NP_441175.1_7 Forward -172 -153 25.7622 0.00218
NP_441175.1_8 Forward -236 -217 28.3645 0.00013
NP_441175.1_10 Forward -192 -174 8.37728 0.264
NP_441550.1_8 Forward -174 -164 16.2041 0.0132
NP_441550.1_8 Reverse -161 -171 15.1225 0.0132
NP_441916.1_7 Reverse -163 -173 7.55152 0.0639
NP_441916.1_7 Reverse -337 -347 2.53664 0.25
NP_441916.1_7 Forward -172 -162 2.04498 0.265
NP_440206.1_9 Reverse -331 -350 9.14423 0.272
NP_440465.1_10 Reverse -232 -251 5.60432 0.212
NP_441041.1_7 Forward -175 -163 9.94422 0.104
NP_440569.1_10 Reverse -98 -117 7.68668 0.231
NP_442004.1_6 Forward -172 -158 2.94952 0.254
NP_441725.1_4 Reverse -158 -172 3.14559 0.279
NP_441725.1_5 Reverse -164 -174 16.7946 0.0247
NP_441725.1_5 Forward -171 -161 2.04498 0.115
NP_439966.1_7 Reverse -161 -171 15.3192 0.0152
NP_439966.1_7 Forward -174 -164 8.82935 0.13
NP_439966.1_9 Forward -174 -165 9.93116 0.186
NP_442941.1_3 Forward -171 -161 19.2529 0.00262
NP_440289.1_2 Forward -175 -162 11.1307 0.0212
NP_440289.1_2 Reverse -160 -173 4.64084 0.0657
NP_440289.1_2 Forward -104 -91 -1.75067 0.246
NP_442281.1_1 Forward -249 -235 1.5723 0.296
NP_440177.1_9 Reverse -155 -174 12.6841 0.229
NP_442256.1_2 Forward -174 -156 0.510803 0.118
NP_442256.1_2 Reverse -161 -179 -8.83064 0.236
NP_440437.1_1 Reverse -304 -323 -2.0655 0.21
NP_441644.1_6 Forward -172 -162 14.7292 0.0105
NP_441644.1_6 Reverse -163 -173 11.9759 0.0408
NP_443049.1_6 Reverse -162 -172 13.8856 0.139
NP_442215.1_2 Forward -103 -87 4.48343 0.0838
NP_442247.1_8 Reverse -161 -175 17.8958 0.14
NP_440253.1_2 Forward -172 -154 -0.472507 0.212
NP_440253.1_2 Reverse -163 -181 -2.73412 0.274
NP_440929.1_8 Reverse -163 -172 9.93116 0.0249
NP_440929.1_8 Forward -172 -163 9.83282 0.0254
NP_442933.1_10 Reverse -163 -172 9.04618 0.063
NP_442933.1_10 Forward -172 -163 8.94785 0.0643
NP_442648.1_4 Reverse -78 -97 5.11266 0.18
NP_441751.2_8 Forward -171 -157 2.85119 0.0759
NP_442554.1_8 Forward -171 -161 16.2046 0.0065
NP_442554.1_8 Reverse -164 -174 7.45319 0.092
NP_442554.1_8 Reverse -236 -246 3.42162 0.226
NP_441762.1_7 Reverse -162 -174 4.66053 0.0458
NP_441762.1_7 Forward -173 -161 -5.66422 0.228
NP_442142.1_4 Forward -175 -162 6.70522 0.158
NP_442142.1_4 Forward -247 -234 6.11523 0.173
NP_442292.1_1 Forward -171 -162 18.486 0.00229
NP_442292.1_1 Reverse -164 -173 0.688044 0.23
NP_442476.1_6 Forward -171 -157 17.2075 0.0367
NP_441711.1_4 Reverse -76 -95 5.211 0.182
NP_443009.1_5 Reverse -357 -368 8.90795 0.0965
NP_443009.1_5 Reverse -162 -173 7.138 0.137
NP_441715.1_4 Forward -171 -161 17.3846 0.0106
NP_440777.1_8 Forward -118 -99 15.8307 0.182
NP_440835.1_1 Forward -88 -69 -9.83364 0.287
NP_441198.1_8 Forward -174 -164 12.0017 0.167
NP_441468.1_1 Forward -171 -164 15.8704 0.0124
NP_441468.1_1 Reverse -164 -171 15.8704 0.0124
NP_441020.2_6 Forward -174 -157 8.10198 0.209
NP_441015.1_10 Forward -324 -305 -2.65548 0.18
NP_441015.1_10 Forward -351 -332 -3.14714 0.185
NP_441673.1_1 Reverse -163 -172 11.1111 0.0121
NP_441673.1_1 Forward -172 -163 11.0128 0.018
NP_441673.1_1 Reverse -92 -101 -7.76842 0.168
NP_441673.1_1 Forward -101 -92 -8.06341 0.254
NP_442490.1_10 Forward -245 -227 7.59063 0.295
NP_442868.1_6 Reverse -161 -171 19.2529 0.00563
NP_442868.1_6 Forward -174 -164 16.4996 0.0156
NP_441056.1_1 Forward -172 -153 -7.76869 0.276
NP_442808.1_1 Forward -173 -163 9.12434 0.0481
NP_442808.1_1 Reverse -243 -253 5.58445 0.146
NP_442808.1_1 Reverse -336 -346 5.28945 0.162
NP_442808.1_1 Reverse -309 -319 4.10949 0.207
NP_442808.1_1 Reverse -286 -296 3.32285 0.244
NP_442542.1_2 Forward -174 -161 17.2272 0.0472
NP_442542.1_2 Forward -348 -335 8.77074 0.149
NP_442050.1_1 Reverse -213 -232 9.73422 0.247
NP_442050.1_5 Reverse -161 -171 14.3359 0.0206
NP_442050.1_5 Forward -174 -164 13.9425 0.0265
NP_441878.1_6 Forward -173 -163 10.4031 0.0176
NP_441878.1_6 Forward -347 -337 3.12662 0.0301
NP_441878.1_6 Forward -245 -235 0.668351 0.139
NP_441878.1_6 Reverse -162 -172 0.668351 0.139
NP_441036.1_8 Forward -173 -163 6.07655 0.242
NP_441557.1_5 Reverse -163 -172 10.8161 0.00464
NP_441557.1_5 Forward -172 -163 10.4228 0.00915
NP_441445.1_1 Forward -181 -162 0.491109 0.275
NP_442066.2_9 Reverse -159 -172 18.3088 0.0209
NP_442183.1_1 Reverse -163 -177 5.99778 0.193
NP_440440.1_10 Reverse -262 -276 14.4542 0.265
NP_441549.1_9 Reverse -349 -367 -8.24065 0.223
NP_441549.1_9 Reverse -159 -177 -8.33898 0.226
NP_442170.1_5 Reverse -163 -182 -3.14714 0.267
NP_442347.1_2 Forward -171 -162 12.4878 0.056
NP_442347.1_2 Forward -126 -117 3.7363 0.284
NP_442645.1_2 Reverse -155 -174 -12.1936 0.144
NP_441037.1_4 Forward -174 -164 9.75413 0.21
NP_441633.1_3 Reverse -161 -174 12.9006 0.0192
NP_441633.1_3 Reverse -90 -103 -2.83231 0.177
NP_441633.1_3 Reverse -335 -348 -3.52063 0.177
NP_440136.1_2 Forward -171 -164 15.9687 0.0123
NP_440136.1_2 Reverse -164 -171 15.9687 0.0123
NP_442590.1_10 Forward -374 -355 7.27595 0.23
NP_442998.1_10 Forward -170 -163 15.5754 0.0102
NP_442998.1_10 Reverse -165 -172 5.84064 0.235
NP_440299.1_1 Reverse -333 -346 7.19687 0.119
NP_440299.1_1 Reverse -159 -172 2.37867 0.291
NP_441799.1_1 Forward -176 -162 11.897 0.0503
NP_441799.1_1 Reverse -159 -173 5.21053 0.218
NP_441799.1_6 Forward -160 -141 17.0107 0.189
NP_441007.1_10 Reverse -158 -171 10.5407 0.0656
NP_441007.1_10 Forward -177 -164 0.707601 0.219
NP_441007.1_10 Forward -109 -96 0.117615 0.25
NP_440456.1_7 Forward -210 -196 20.0591 0.0939
NP_441559.1_8 Forward -99 -85 -6.58858 0.279
NP_440915.1_6 Reverse -159 -173 6.88276 0.0779
NP_440915.1_6 Forward -371 -357 4.42448 0.0953
NP_442158.1_4 Reverse -280 -290 11.4848 0.271
NP_442785.1_7 Reverse -328 -342 11.0127 0.228
NP_441464.1_8 Reverse -163 -177 12.4876 0.166
NP_440026.1_7 Forward -235 -220 14.0412 0.269
NP_441939.1_3 Forward -171 -152 16.3224 0.0401
NP_441494.1_6 Forward -339 -326 7.00078 0.269
NP_442386.1_9 Reverse -162 -171 13.8639 0.0289
NP_442386.1_9 Forward -173 -164 8.35743 0.201
NP_442386.1_9 Reverse -309 -318 5.0142 0.27
NP_441340.1_5 Forward -171 -164 15.6737 0.0124
NP_441340.1_5 Reverse -164 -171 15.6737 0.0124
NP_441340.1_9 Forward -204 -194 7.38756 0.27
NP_442240.1_2 Forward -171 -152 -10.4236 0.137
NP_440586.1_1 Reverse -225 -244 -5.99873 0.292
NP_440586.1_8 Forward -171 -164 13.2151 0.026
NP_440586.1_8 Reverse -164 -171 13.2151 0.026
NP_442251.1_6 Forward -171 -164 15.2804 0.0124
NP_442251.1_6 Reverse -164 -171 15.2804 0.0124
NP_440192.1_5 Forward -320 -301 3.83436 0.271
NP_441262.1_3 Reverse -163 -170 14.7888 0.0223
NP_441262.1_3 Forward -172 -165 6.52896 0.0809
NP_440027.1_3 Forward -244 -226 7.29487 0.211
NP_443051.1_1 Reverse -162 -171 10.4228 0.00754
NP_443051.1_1 Forward -173 -164 8.65285 0.029
NP_439984.1_3 Reverse -156 -170 15.0436 0.161
NP_439937.1_9 Reverse -162 -179 -5.17337 0.157
NP_442294.1_3 Forward -165 -151 11.7003 0.298
NP_440836.1_6 Forward -263 -249 7.9644 0.263
NP_440439.1_1 Reverse -92 -105 1.69091 0.147
NP_440372.1_2 Forward -171 -164 16.3621 0.0124
NP_440372.1_2 Reverse -164 -171 16.3621 0.0124
NP_442511.1_5 Forward -134 -115 19.4958 0.181
NP_440819.1_5 Forward -22 -14 15.8507 0.185
NP_440316.1_10 Forward -347 -337 7.15819 0.251
NP_439977.1_5 Reverse -157 -176 0.786102 0.201
NP_440139.1_1 Reverse -331 -350 1.86696 0.245
NP_442384.1_10 Forward -172 -159 10.344 0.0461
NP_442384.1_10 Reverse -235 -248 7.39411 0.0822
NP_442114.1_4 Forward -172 -161 8.31847 0.208
NP_440530.1_6 Reverse -109 -123 15.8619 0.201
NP_442262.1_10 Forward -171 -164 14.1988 0.0123
NP_442262.1_10 Reverse -164 -171 14.1988 0.0123
NP_441689.1_5 Reverse -161 -171 5.78111 0.197
NP_440344.1_10 Forward -179 -162 0.0388413 0.0376
NP_440531.1_8 Forward -246 -227 3.73603 0.269
NP_441965.1_10 Forward -175 -159 11.0716 0.107
NP_441965.1_10 Reverse -232 -248 4.3851 0.242
NP_440297.1_9 Reverse -164 -174 1.06167 0.282
NP_440297.1_9 Forward -171 -161 -0.118297 0.282
NP_440297.1_9 Reverse -236 -246 -0.216628 0.282
NP_442187.1_3 Reverse -162 -172 17.188 0.0619
NP_442280.1_10 Forward -366 -348 6.42843 0.275
NP_441592.1_4 Forward -172 -153 -4.13045 0.296
NP_440999.1_9 Forward -105 -91 6.19444 0.101
NP_440999.1_9 Forward -176 -162 2.45787 0.149
NP_440999.1_9 Reverse -231 -245 -0.787057 0.217
NP_440999.1_9 Reverse -91 -105 -3.44199 0.293
NP_440888.1_2 Forward -172 -158 13.077 0.0339
NP_440888.1_2 Reverse -310 -324 8.45543 0.16
NP_440491.1_1 Forward -175 -156 9.54836 0.21
NP_439969.1_3 Reverse -230 -249 -1.47551 0.279
NP_442277.1_4 Reverse -328 -347 6.29183 0.165
NP_442033.1_10 Reverse -335 -354 -9.63698 0.22
NP_441543.1_2 Forward -171 -162 16.9127 0.00359
NP_441543.1_2 Forward -295 -286 5.40793 0.2
NP_442701.1_2 Reverse -243 -261 1.98577 0.282
NP_441469.1_8 Forward -173 -164 12.6844 0.0995
NP_441469.1_8 Forward -245 -236 7.66954 0.227
NP_441469.1_8 Reverse -162 -171 6.48957 0.227
NP_441548.1_3 Forward -93 -74 11.7983 0.24
NP_443064.1_6 Forward -172 -162 9.46426 0.219
NP_442578.1_7 Forward -171 -164 14.5921 0.026
NP_442578.1_7 Reverse -164 -171 14.5921 0.026
NP_440710.1_1 Reverse -329 -347 4.34571 0.113
NP_441462.1_2 Reverse -163 -173 17.8763 0.00406
NP_441462.1_2 Forward -172 -162 1.74999 0.0811
NP_441462.1_2 Reverse -337 -347 -0.904945 0.265
NP_441621.1_7 Reverse -335 -349 1.67122 0.138
NP_441621.1_7 Forward -174 -160 -4.7203 0.242
NP_441621.1_7 Reverse -93 -107 -6.49025 0.295
NP_440544.1_5 Reverse -198 -205 13.8024 0.28
NP_440516.1_8 Reverse -163 -172 18.9776 0.00442
NP_440516.1_8 Forward -172 -163 7.07956 0.0867
NP_442428.1_5 Forward -171 -164 15.8704 0.0124
NP_442428.1_5 Reverse -164 -171 15.8704 0.0124
NP_440783.1_5 Reverse -215 -234 0.491109 0.209
NP_441443.1_2 Reverse -329 -348 5.211 0.181
NP_442859.1_2 Forward -171 -152 7.27595 0.199
NP_440673.1_2 Reverse -225 -244 10.8773 0.194
NP_440673.1_3 Reverse -165 -172 13.1171 0.0426
NP_440673.1_3 Forward -170 -163 12.4288 0.0426
NP_441052.1_2 Forward -172 -162 20.5312 0.00106
NP_441052.1_2 Forward -296 -286 2.63497 0.197
NP_441052.1_2 Forward -244 -234 0.865012 0.256
NP_441052.1_2 Reverse -163 -173 0.668351 0.256
NP_442219.1_9 Forward -171 -162 17.7976 0.00718
NP_442219.1_9 Reverse -164 -173 8.84951 0.0681
NP_440436.1_4 Forward -171 -162 17.2072 0.00233
NP_440436.1_4 Reverse -164 -173 6.78414 0.147
NP_441884.1_9 Forward -247 -228 -21.1417 0.229
NP_442086.1_3 Reverse -164 -183 7.7676 0.254
NP_442086.1_3 Forward -171 -152 5.89931 0.288
NP_440314.1_9 Forward -171 -152 -8.35868 0.247
NP_440314.1_9 Reverse -164 -183 -9.44032 0.268
NP_441719.1_4 Forward -171 -164 16.3621 0.0124
NP_441719.1_4 Reverse -164 -171 16.3621 0.0124
NP_441733.1_3 Reverse -260 -278 18.2104 0.217
NP_441733.1_10 Reverse -160 -173 7.59077 0.153
NP_439949.1_7 Forward -288 -274 13.3726 0.257
NP_440296.1_10 Forward -349 -330 -13.6686 0.269
NP_443054.1_2 Reverse -90 -104 -0.590395 0.299
NP_441851.1_10 Reverse -162 -172 8.33817 0.118
NP_441851.1_10 Forward -173 -163 8.1415 0.122
NP_442856.1_7 Reverse -226 -245 -3.63879 0.244
NP_442515.1_1 Reverse -162 -176 12.6843 0.0333
NP_442515.1_1 Forward -173 -159 10.4227 0.052
NP_442515.1_1 Forward -392 -378 -1.5737 0.257
NP_441396.1_5 Forward -373 -364 8.65285 0.21
NP_440165.1_5 Forward -95 -76 -1.08219 0.185
NP_441046.1_2 Reverse -152 -171 6.98095 0.221
NP_441409.1_6 Forward -178 -159 -5.40875 0.103
NP_440432.1_9 Reverse -164 -179 -2.08505 0.167
NP_440432.1_9 Reverse -311 -326 -2.67504 0.175
NP_440432.1_9 Forward -171 -156 -5.03498 0.233
NP_440474.1_8 Reverse -93 -107 6.29216 0.228
NP_440431.1_3 Forward -32 -13 -10.522 0.276
NP_442450.1_5 Forward -174 -164 10.4031 0.115
NP_440195.1_5 Forward -178 -159 8.94757 0.17
NP_441078.1_4 Reverse -163 -172 9.93116 0.0203
NP_441078.1_4 Forward -172 -163 9.83282 0.0226
NP_441078.1_4 Forward -346 -337 6.39124 0.0775
NP_441078.1_4 Reverse -337 -346 -1.77023 0.266
NP_440526.1_3 Reverse -164 -175 2.12315 0.267
NP_440526.1_3 Reverse -311 -322 1.23817 0.267
NP_440526.1_3 Forward -171 -160 1.04151 0.267
NP_441432.1_8 Reverse -162 -171 16.8143 0.00595
NP_442320.1_8 Reverse -157 -171 -2.55701 0.0913
NP_442320.1_9 Reverse -222 -236 14.7492 0.246
NP_440760.1_1 Forward -172 -153 5.89931 0.0115
NP_442146.1_6 Reverse -307 -326 17.0107 0.0729
NP_442489.1_7 Reverse -163 -172 10.4228 0.0151
NP_442489.1_7 Forward -172 -163 10.3245 0.0193
NP_442489.1_7 Forward -346 -337 -1.37691 0.195
NP_441706.1_10 Reverse -89 -108 14.4541 0.132
NP_440559.1_1 Forward -171 -162 17.4043 0.00658
NP_440559.1_1 Reverse -164 -173 9.14451 0.0586
NP_441659.2_8 Reverse -163 -173 9.81313 0.0269
NP_441659.2_8 Forward -172 -162 8.63316 0.0405
NP_441659.2_8 Reverse -337 -347 4.60159 0.13
NP_440779.1_5 Reverse -310 -327 -6.25434 0.17
NP_442346.1_5 Forward -173 -163 14.1397 0.0164
NP_442346.1_5 Forward -245 -235 12.1731 0.0475
NP_442346.1_5 Reverse -162 -172 8.23984 0.143
NP_442346.1_5 Reverse -234 -244 8.1415 0.146
NP_440352.1_5 Reverse -34 -53 11.001 0.267
NP_440545.1_3 Reverse -231 -248 -1.0428 0.162
NP_440545.1_3 Forward -176 -159 -3.00942 0.197
NP_440545.1_3 Reverse -333 -350 -5.1727 0.242
NP_440831.1_3 Reverse -226 -245 5.12514 0.29
NP_441653.1_2 Reverse -152 -171 3.33635 0.268
NP_441943.1_8 Reverse -328 -347 -5.70374 0.261
NP_440847.1_3 Forward -390 -376 10.6187 0.287
NP_442603.1_7 Reverse -163 -177 10.9137 0.125
NP_442603.1_7 Forward -172 -158 7.66879 0.198
NP_441833.1_4 Forward -171 -164 15.9687 0.0124
NP_441833.1_4 Reverse -164 -171 15.9687 0.0124
NP_442162.1_9 Forward -171 -164 16.2637 0.0124
NP_442162.1_9 Reverse -164 -171 16.2637 0.0124
NP_442073.1_6 Forward -181 -162 3.04771 0.25
NP_442140.1_3 Reverse -164 -174 16.598 0.0255
NP_442140.1_3 Forward -171 -161 10.3048 0.0902
NP_441813.1_5 Reverse -161 -171 18.1713 0.00743
NP_441813.1_5 Forward -174 -164 8.92815 0.0347
NP_442254.1_7 Reverse -112 -131 14.4541 0.262
NP_442089.1_1 Reverse -89 -108 2.0644 0.226
NP_440590.1_4 Forward -171 -158 9.75405 0.0335
NP_440590.1_4 Reverse -164 -177 -4.60227 0.263
NP_440567.1_1 Reverse -164 -178 6.29277 0.085
NP_442497.1_10 Reverse -164 -173 10.8161 0.0087
NP_442497.1_10 Forward -171 -162 10.4228 0.0087
NP_440821.1_4 Forward -174 -164 17.188 0.00705
NP_440821.1_4 Reverse -161 -171 9.41981 0.0286
NP_441239.1_8 Forward -353 -335 7.39397 0.278
NP_441239.1_9 Forward -174 -162 14.1986 0.0288
NP_442216.1_5 Forward -163 -144 20.059 0.111
NP_440546.1_4 Reverse -163 -173 14.0213 0.0459
NP_440546.1_4 Forward -382 -372 8.49468 0.186
NP_440546.1_4 Forward -172 -162 7.33119 0.246
NP_440462.1_6 Reverse -161 -171 9.61647 0.0429
NP_440462.1_6 Forward -174 -164 9.41981 0.044
NP_440868.1_4 Forward -176 -164 11.347 0.0327
NP_440868.1_4 Reverse -159 -171 9.97041 0.0405
NP_442499.1_1 Reverse -158 -177 4.22769 0.244
NP_441582.1_5 Reverse -161 -180 6.88182 0.19
NP_442402.1_4 Reverse -191 -210 -7.27777 0.272
NP_441084.1_6 Forward -246 -232 9.05325 0.295
NP_440696.1_6 Forward -379 -360 3.14605 0.288
NP_442039.1_4 Forward -171 -164 15.1821 0.0124
NP_442039.1_4 Reverse -164 -171 15.1821 0.0124
NP_441811.1_8 Reverse -157 -171 6.6861 0.265
NP_441053.1_3 Forward -277 -258 12.0942 0.0922
NP_442837.1_3 Forward -171 -164 15.7721 0.0124
NP_442837.1_3 Reverse -164 -171 15.7721 0.0124
NP_442053.1_1 Reverse -163 -172 17.601 0.00138
NP_442053.1_1 Forward -172 -163 16.2243 0.00451
NP_440505.1_3 Reverse -161 -171 18.3679 0.00213
NP_441252.1_6 Forward -210 -203 11.6422 0.288
NP_442532.1_7 Reverse -163 -177 4.32615 0.174
NP_442174.1_6 Reverse -162 -181 13.5691 0.193
NP_440914.1_1 Forward -172 -162 15.0561 0.00832
NP_440914.1_1 Reverse -163 -173 7.24882 0.242
NP_441011.1_8 Reverse -164 -173 12.7828 0.0397
NP_441011.1_8 Forward -171 -162 8.25953 0.144
NP_442533.1_6 Forward -244 -235 11.8978 0.0362
NP_442533.1_6 Reverse -92 -101 9.34117 0.0634
NP_442533.1_6 Reverse -163 -172 7.86621 0.0862
NP_442533.1_6 Forward -172 -163 7.37455 0.0898
NP_442533.1_6 Forward -346 -337 4.91628 0.165
NP_442533.1_6 Forward -104 -95 3.14632 0.224
NP_442541.1_10 Forward -235 -221 0.883986 0.295
NP_441482.1_7 Reverse -157 -171 6.58777 0.0271
NP_439944.1_9 Forward -171 -161 10.5014 0.0887
NP_439944.1_9 Reverse -164 -174 8.4365 0.108
NP_440115.1_6 Forward -175 -165 9.02648 0.123
NP_440115.1_6 Reverse -160 -170 6.76487 0.167
NP_441602.1_3 Reverse -158 -177 -1.37718 0.226
NP_441106.1_1 Reverse -162 -171 9.63616 0.0311
NP_439903.1_6 Reverse -190 -209 -0.492971 0.282
NP_442588.1_1 Reverse -223 -242 5.50599 0.281
NP_442306.1_10 Reverse -158 -177 -20.945 0.237
NP_441286.1_1 Reverse -162 -174 23.2451 0.00109
NP_441286.1_1 Forward -173 -161 -5.76255 0.223
NP_440670.1_8 Reverse -163 -172 9.04618 0.0606
NP_440670.1_8 Forward -172 -163 8.75118 0.0606
NP_440886.1_7 Forward -173 -163 8.04271 0.0805
NP_440886.1_7 Reverse -336 -346 6.76441 0.114
NP_440886.1_7 Reverse -162 -172 6.66608 0.115
NP_440886.1_7 Reverse -309 -319 5.87944 0.158
NP_440886.1_7 Forward -95 -85 3.71617 0.267
NP_440828.1_4 Forward -245 -226 -6.68779 0.276
NP_441001.1_10 Reverse -225 -244 6.29264 0.249
NP_440083.1_6 Reverse -276 -295 14.4533 0.296
NP_442614.1_2 Reverse -163 -177 9.14437 0.242
NP_442072.1_9 Forward -173 -155 -22.1053 0.22
NP_440907.2_8 Reverse -164 -174 10.3043 0.103
NP_441021.1_1 Forward -171 -152 1.37609 0.0848
NP_441021.1_1 Reverse -164 -183 -9.34199 0.215
NP_441626.1_2 Forward -171 -164 15.7721 0.0124
NP_441626.1_2 Reverse -164 -171 15.7721 0.0124
NP_442794.1_1 Reverse -159 -171 7.31547 0.142
NP_442615.1_1 Reverse -154 -172 2.28076 0.0709
NP_442615.1_1 Reverse -83 -101 -6.37237 0.244
NP_441962.1_4 Reverse -221 -240 -10.1286 0.224
NP_441962.1_4 Reverse -230 -249 -10.3253 0.226
NP_441962.1_4 Forward -177 -158 -12.4886 0.259
NP_440387.1_1 Forward -172 -156 1.63183 0.0994
NP_441431.1_2 Forward -175 -161 7.76712 0.234
NP_441836.1_2 Reverse -229 -248 -4.52377 0.259
NP_441836.1_2 Forward -178 -159 -5.21209 0.275
NP_440634.1_1 Reverse -335 -354 13.8641 0.26
NP_441174.1_1 Forward -376 -361 18.1711 0.231
NP_441174.1_2 Forward -107 -93 14.4542 0.161
NP_440114.1_10 Reverse -163 -177 11.3077 0.118
NP_440114.1_10 Forward -172 -158 7.17775 0.243
NP_442090.1_8 Forward -43 -33 17.2619 0.246
NP_441853.1_7 Reverse -349 -368 14.2574 0.245
NP_440293.1_3 Forward -354 -335 -4.72043 0.264
NP_439988.1_7 Reverse -336 -350 16.6169 0.292
NP_441237.1_9 Reverse -164 -174 16.893 0.01
NP_442930.1_1 Forward -283 -273 13.0576 0.239
NP_441133.1_1 Forward -354 -335 15.7324 0.191
NP_439910.1_2 Forward -180 -163 -12.6459 0.0924
NP_440457.1_1 Forward -350 -338 1.80894 0.223
NP_440457.1_1 Forward -176 -164 0.432302 0.25
NP_440457.1_1 Reverse -159 -171 -0.74767 0.273
NP_440798.1_6 Reverse -164 -177 2.77255 0.16
NP_442680.1_7 Reverse -13 -32 -5.99873 0.265
NP_442509.1_9 Reverse -163 -173 15.9091 0.00953
NP_440554.1_4 Forward -171 -161 8.92815 0.0646
NP_441885.1_5 Forward -172 -162 11.0914 0.00874
NP_441885.1_5 Reverse -163 -173 2.24165 0.0822
NP_440478.1_10 Forward -174 -160 6.6861 0.288
NP_442703.1_6 Forward -154 -135 17.2359 0.222
NP_442341.1_7 Reverse -336 -350 3.53951 0.22
NP_441756.1_5 Forward -350 -331 0.392778 0.234
NP_442395.2_4 Reverse -228 -247 4.91521 0.174
NP_440191.1_4 Forward -219 -209 14.9903 0.254
NP_443000.1_7 Reverse -161 -171 19.9412 0.00223
NP_441561.1_7 Forward -25 -6 6.39016 0.274
NP_440275.1_3 Reverse -161 -171 15.123 0.0182
NP_440275.1_3 Forward -174 -164 10.8948 0.0398
NP_440091.1_1 Forward -176 -164 1.51394 0.197
NP_441307.1_4 Reverse -172 -191 -0.295539 0.259
NP_441902.1_3 Forward -209 -199 15.1196 0.205
NP_442451.1_2 Reverse -155 -174 -6.49039 0.232
NP_439962.1_4 Reverse -227 -246 -3.3438 0.251
NP_440149.1_8 Forward -172 -153 -4.03212 0.201
NP_440216.1_1 Forward -346 -332 -2.75368 0.0574
NP_440216.1_1 Reverse -163 -177 -3.04867 0.0682
NP_440216.1_1 Forward -172 -158 -10.7185 0.146
NP_440216.1_9 Forward -121 -112 6.39124 0.289
NP_440172.1_1 Reverse -163 -173 17.2863 0.00544
NP_440172.1_1 Forward -172 -162 5.19158 0.149
NP_440172.1_1 Forward -244 -234 2.04498 0.286
NP_440167.1_3 Reverse -225 -244 16.5191 0.144
NP_441226.1_7 Forward -171 -164 14.4934 0.0123
NP_441226.1_7 Reverse -164 -171 14.4934 0.0123
NP_440198.1_3 Reverse -328 -347 16.6165 0.231
NP_441111.1_7 Forward -171 -163 18.7023 0.00294
NP_441111.1_7 Reverse -164 -172 8.96754 0.0463
NP_441766.1_2 Forward -172 -163 18.2893 0.00297
NP_441766.1_2 Reverse -163 -172 9.14451 0.0337
NP_440416.1_9 Reverse -330 -349 -10.7186 0.145
NP_443052.1_8 Forward -182 -163 -8.06369 0.168
NP_443052.1_9 Reverse -335 -354 -2.55715 0.239
NP_440261.1_5 Reverse -164 -177 4.8375 0.0516
NP_440261.1_5 Forward -171 -158 -2.53732 0.0924
NP_440261.1_5 Reverse -236 -249 -4.7006 0.165
NP_440261.1_5 Forward -103 -90 -6.47056 0.201
NP_440261.1_5 Reverse -338 -351 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCTTTTTTGGTCAATCAAACCCATGTGTTGACGGGGGATGCTCTGCTCATCCGGGGCTGTGGCCGGACGGATTTCCAAAGTGGAGATGCCGGTACGTTGTATGACGCTATCCACGGTAAATTATTCACCCTGCCGGAGGATGTTTTTGTCTATCCGGGCCATGACTACCGGGGCCACACCGTTTCCACTATTGGGGAAGAAAAACGTTTTAACCCCCGCTTATTAGGGCGCGATCGCCAGAACTTTATCGAATTTATGGATAGTTTAAATCTGCCTGATCCAAAGAAAATTATGGAAGCGGTGCCCGCCAATCAACTCTGTGGTCAAAGGACTGTTGCGGTTTAAAGACTTGCTCCAAGACTAATCAAGATCCATTTCCCGGAAAAATCCGTTCACAATT

CDS

ATGGTCAGTTGGTGTCAGTCCCTTTTCCTTCGCTGGGGTAAGGTTTTAACCCTAACAGTGCTTAGCTTTGGGCTTTGCTGTGCCTGTTTAACTCTTTGGCCGGTGGCAACTCCAGCCCTAGTACGGGAGACTACGGAACAGCCGGGGCAAACCCTGATCCAGTCTCGTCAATCCCTACGGGACCAGGAAGGGAATACCTGGCAAGTGGTGTTATTTAAAAGGACGAAAGCCAACGGTGATAGAGAAACCAATTTACGTTTAGTTGGTTTTCCTGGAGTCACATCCTTTCGCCATCCAGCCCCTTTGGTGGTTCGGGACAATGGTGGTAATACCGTTAACCTAACCGATCTTTTAGCAGAGAAAAGCCCCGGTGAAAATGTTGGTCAATTTTTGGTTACAACGGATTTTACCAATTTACAAATTAATGGCATTTGGGAATTGAATTTACCGTTGGCAGGGGGAGAACAACAAATCAAAGTTCCCTATTTTGTCCTCCAAGAATGGCAAAGTTTGTTGGCCAAGGCATCGGATTAA

Protein

MVSWCQSLFLRWGKVLTLTVLSFGLCCACLTLWPVATPALVRETTEQPGQTLIQSRQSLRDQEGNTWQVVLFKRTKANGDRETNLRLVGFPGVTSFRHPAPLVVRDNGGNTVNLTDLLAEKSPGENVGQFLVTTDFTNLQINGIWELNLPLAGGEQQIKVPYFVLQEWQSLLAKASD