Your browser is old and dusty. Try Google Chrome!

Details for slr1256

ORF slr1256
Accession NP_441170.1
Symbol ureA
Category Other
Definition urease gamma subunit
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -283 -269 16.3225 0.104
NP_441061.1_2 Forward -276 -262 0.294584 0.213
NP_440795.1_7 Reverse -358 -365 8.8889 0.188
NP_441418.1_6 Forward -292 -273 -29.5982 0.23
NP_441480.1_5 Reverse -231 -250 10.8159 0.237
NP_442272.1_2 Reverse -34 -53 13.0342 0.216
NP_441453.1_4 Forward -366 -358 11.6225 0.0403
NP_441818.1_9 Reverse -226 -245 -3.44213 0.226
NP_441818.1_9 Reverse -202 -221 -10.227 0.292
NP_441818.1_9 Forward -295 -276 -10.3253 0.292
NP_440259.1_4 Forward -16 -2 9.50354 0.278
NP_442752.1_4 Reverse -262 -269 7.6106 0.151
NP_441675.1_4 Reverse -39 -58 6.98095 0.236
NP_441169.1_5 Reverse -106 -125 20.6481 0.0589
NP_441934.1_7 Reverse -184 -203 15.8307 0.296
NP_442000.2_10 Reverse -260 -278 4.05072 0.298
NP_440061.1_9 Reverse -266 -280 11.012 0.117
NP_441859.1_3 Reverse -283 -302 5.40686 0.201
NP_442972.1_1 Forward -129 -111 8.25073 0.287
NP_440304.1_4 Reverse -355 -365 6.76487 0.146
NP_440916.1_1 Forward -259 -245 9.43936 0.236
NP_439918.1_3 Reverse -187 -206 3.6377 0.266
NP_441935.1_1 Forward -286 -267 8.25926 0.234
NP_441208.1_9 Reverse -331 -345 7.86607 0.219
NP_441594.1_6 Reverse -265 -284 6.29264 0.193
NP_441594.1_6 Forward -186 -167 0.196116 0.291
NP_441925.1_4 Forward -251 -232 -8.85106 0.212
NP_441083.1_3 Reverse -350 -360 12.4676 0.253
NP_441434.1_1 Reverse -132 -146 11.1842 0.233
NP_441434.1_1 Forward -146 -132 7.17351 0.288
NP_441713.1_1 Reverse -199 -218 -15.7335 0.27
NP_441713.1_1 Reverse -351 -370 -17.0118 0.292
NP_441025.1_5 Reverse -268 -282 14.0609 0.282
NP_440644.1_3 Forward -204 -185 6.4893 0.17
NP_442111.1_4 Forward -367 -353 8.94771 0.0661
NP_440343.1_9 Reverse -210 -229 14.1591 0.152
NP_441130.1_10 Reverse -54 -68 4.62115 0.275
NP_441486.1_1 Forward -369 -355 0.88457 0.124
NP_442634.1_4 Reverse -260 -274 -0.492064 0.149
NP_441014.1_10 Forward -294 -275 0.392004 0.243
NP_442848.1_5 Reverse -267 -285 3.16574 0.276
NP_442848.1_5 Forward -316 -298 -0.865831 0.276
NP_442848.1_9 Reverse -268 -287 -0.787193 0.28
NP_441012.1_4 Forward -203 -190 9.95071 0.272
NP_441012.1_4 Forward -364 -351 7.19745 0.272
NP_443018.1_3 Forward -365 -358 4.56234 0.241
NP_443018.1_3 Reverse -358 -365 4.46401 0.244
NP_441634.1_8 Forward -288 -274 -4.4253 0.295
NP_442687.1_7 Reverse -47 -57 4.79825 0.234
NP_442485.1_3 Forward -282 -263 0.0977854 0.247
NP_442485.1_3 Reverse -272 -291 -1.08219 0.255
NP_441422.1_7 Reverse -269 -286 -5.95935 0.248
NP_440667.1_2 Reverse -101 -120 5.01433 0.189
NP_442658.1_1 Reverse -355 -365 7.45273 0.214
NP_442658.1_1 Forward -399 -389 5.58445 0.262
NP_442937.1_5 Forward -291 -272 6.39097 0.28
NP_442937.1_5 Forward -282 -263 5.89931 0.295
NP_441958.1_5 Reverse -356 -366 -0.314959 0.198
NP_440153.1_8 Forward -366 -353 3.06754 0.21
NP_440153.1_8 Reverse -271 -284 -3.71729 0.299
NP_441129.1_6 Reverse -266 -285 12.5858 0.148
NP_441129.1_10 Forward -212 -198 15.5359 0.285
NP_442885.1_4 Forward -39 -26 17.7699 0.217
NP_442771.1_1 Reverse -260 -278 -0.964162 0.124
NP_440147.1_4 Reverse -272 -285 1.49425 0.226
NP_441916.1_7 Forward -366 -356 4.69992 0.163
NP_440569.1_10 Forward -58 -39 3.29405 0.278
NP_440703.1_9 Reverse -268 -281 5.0336 0.293
NP_441725.1_5 Forward -365 -355 6.96153 0.108
NP_440289.1_2 Forward -252 -239 -0.964025 0.218
NP_440983.1_5 Forward -211 -192 1.67108 0.209
NP_440983.1_5 Reverse -262 -281 -6.39206 0.276
NP_440260.1_8 Reverse -180 -198 -6.86402 0.295
NP_442281.1_1 Reverse -149 -163 5.99717 0.139
NP_442281.1_1 Forward -371 -357 5.60385 0.152
NP_441566.1_3 Reverse -92 -111 13.8641 0.229
NP_440437.1_1 Forward -241 -222 -1.27885 0.198
NP_439983.1_7 Reverse -303 -321 10.4422 0.277
NP_441556.1_4 Forward -208 -189 21.3811 0.0267
NP_440498.1_1 Forward -352 -334 -0.0791831 0.218
NP_442982.1_5 Forward -376 -357 -3.24547 0.297
NP_441644.1_6 Forward -276 -266 11.9759 0.0408
NP_441644.1_6 Reverse -154 -164 7.35439 0.129
NP_442215.1_2 Forward -165 -149 4.77842 0.0823
NP_442029.1_1 Forward -288 -269 -10.0303 0.218
NP_442933.1_10 Reverse -357 -366 4.42462 0.246
NP_440382.1_2 Reverse -11 -30 6.48849 0.259
NP_440382.1_2 Reverse -6 -25 1.57197 0.286
NP_442926.1_5 Reverse -352 -371 10.2702 0.263
NP_442554.1_8 Forward -365 -355 6.76487 0.107
NP_442142.1_4 Forward -232 -219 11.7201 0.0535
NP_442142.1_4 Reverse -271 -284 3.06699 0.268
NP_442142.1_4 Reverse -144 -157 2.96866 0.269
NP_442142.1_4 Reverse -277 -290 2.18201 0.299
NP_440919.1_1 Reverse -328 -347 -1.18052 0.221
NP_440895.1_6 Reverse -214 -227 14.8673 0.198
NP_441198.1_8 Reverse -355 -365 11.0251 0.228
NP_441198.1_8 Forward -273 -263 10.8298 0.239
NP_440379.1_5 Reverse -348 -367 -3.83545 0.206
NP_441468.1_1 Reverse -358 -365 3.97235 0.277
NP_440920.1_1 Forward -284 -265 13.7658 0.124
NP_441015.1_10 Forward -282 -263 -7.4737 0.267
NP_441015.1_10 Forward -288 -269 -10.1286 0.283
NP_441826.1_2 Forward -372 -358 -3.147 0.283
NP_441826.1_2 Reverse -268 -282 -4.7203 0.299
NP_441612.1_2 Reverse -29 -39 11.4537 0.21
NP_440869.1_6 Reverse -331 -350 3.04771 0.245
NP_442542.1_2 Reverse -355 -368 17.0305 0.0513
NP_440038.1_4 Reverse -266 -285 0.982764 0.275
NP_442342.1_9 Reverse -260 -276 11.5633 0.119
NP_440558.1_2 Forward -256 -237 -0.4922 0.203
NP_441518.1_3 Forward -206 -187 -8.45701 0.186
NP_441878.1_6 Reverse -356 -366 2.14332 0.0501
NP_441878.1_6 Forward -277 -267 -7.19813 0.21
NP_441878.1_6 Forward -284 -274 -7.29646 0.217
NP_441878.1_6 Reverse -243 -253 -7.98478 0.285
NP_442503.1_9 Reverse -195 -214 11.3075 0.18
NP_441557.1_5 Reverse -357 -366 -0.885252 0.26
NP_441445.1_1 Reverse -211 -230 3.44104 0.213
NP_442962.1_1 Reverse -346 -365 6.88262 0.24
NP_440084.1_8 Reverse -33 -47 13.094 0.232
NP_440101.1_3 Forward -288 -269 2.65439 0.25
NP_440547.1_5 Forward -282 -263 9.24257 0.225
NP_441037.1_4 Reverse -355 -365 13.3601 0.0659
NP_442594.1_8 Forward -288 -269 8.65258 0.202
NP_442764.1_3 Reverse -261 -271 19.9412 0.236
NP_442590.1_10 Forward -289 -270 9.43923 0.196
NP_442590.1_10 Forward -283 -264 5.50599 0.258
NP_440299.1_1 Reverse -176 -189 3.46031 0.243
NP_441007.1_10 Reverse -352 -365 0.60927 0.221
NP_442961.1_7 Forward -195 -176 12.7825 0.245
NP_441559.1_4 Forward -165 -146 11.7992 0.102
NP_441559.1_8 Forward -288 -274 0.88457 0.16
NP_441270.1_5 Reverse -345 -364 11.5304 0.289
NP_441866.1_3 Forward -200 -187 11.4257 0.243
NP_441464.1_8 Forward -246 -232 5.50613 0.253
NP_441464.1_8 Forward -273 -259 4.12949 0.283
NP_440702.1_2 Forward -288 -269 -3.63879 0.257
NP_441417.1_2 Forward -279 -260 1.67108 0.227
NP_442993.1_1 Reverse -357 -373 1.82849 0.0502
NP_442993.1_1 Reverse -202 -218 -8.88958 0.176
NP_441340.1_5 Forward -365 -358 11.0522 0.0749
NP_440137.1_2 Reverse -372 -391 22.8114 0.0735
NP_440027.1_3 Reverse -277 -295 4.83661 0.25
NP_440027.1_3 Reverse -268 -286 2.87 0.284
NP_439937.1_9 Forward -252 -235 -7.72996 0.165
NP_442239.1_8 Reverse -327 -346 4.52268 0.296
NP_440316.1_10 Reverse -356 -366 7.84651 0.245
NP_442384.1_10 Forward -283 -270 0.510939 0.289
NP_442114.1_8 Reverse -4 -18 3.93223 0.281
NP_441018.1_7 Reverse -347 -366 12.3892 0.161
NP_442262.1_10 Forward -365 -358 7.90559 0.266
NP_440344.1_10 Reverse -350 -367 -12.6459 0.261
NP_441335.1_7 Reverse -193 -212 14.7491 0.294
NP_440297.1_9 Forward -365 -355 1.06167 0.282
NP_441896.1_3 Forward -388 -369 -1.86883 0.268
NP_441565.1_4 Forward -34 -15 13.8641 0.197
NP_443036.1_1 Reverse -349 -368 8.65176 0.291
NP_442129.1_9 Forward -53 -34 17.436 0.225
NP_440999.1_9 Reverse -270 -284 0.392915 0.187
NP_440999.1_9 Reverse -273 -287 0.294584 0.189
NP_442892.1_9 Forward -23 -9 13.9619 0.293
NP_441123.1_6 Forward -374 -356 12.4089 0.14
NP_440575.1_1 Reverse -132 -151 0.195343 0.29
NP_441543.1_2 Forward -365 -356 4.0313 0.293
NP_442845.1_2 Forward -372 -358 5.1128 0.243
NP_442845.1_4 Reverse -355 -374 10.6192 0.178
NP_442710.1_7 Reverse -31 -50 -7.89551 0.299
NP_442337.1_8 Reverse -173 -192 -1.27885 0.28
NP_441306.1_10 Forward -285 -271 11.602 0.263
NP_440710.1_1 Forward -65 -47 -9.22396 0.296
NP_443062.1_6 Forward -291 -272 15.0441 0.0794
NP_440516.1_2 Forward -289 -271 2.0841 0.18
NP_442428.1_5 Reverse -263 -270 7.90559 0.0969
NP_442428.1_5 Reverse -358 -365 4.36568 0.271
NP_442120.1_10 Forward -372 -353 -12.0953 0.269
NP_440673.1_2 Reverse -347 -366 10.5847 0.203
NP_440673.1_3 Reverse -390 -397 10.5605 0.123
NP_440673.1_3 Forward -291 -284 6.72562 0.277
NP_440673.1_3 Forward -209 -202 6.62729 0.281
NP_440865.1_9 Forward -372 -353 -7.96535 0.254
NP_441052.1_2 Reverse -357 -367 3.71661 0.175
NP_442219.1_1 Forward -281 -262 18.584 0.219
NP_440436.1_4 Reverse -389 -398 7.47246 0.129
NP_441884.1_9 Forward -346 -327 -22.8133 0.284
NP_440314.1_9 Forward -320 -301 -10.4236 0.298
NP_441733.1_10 Forward -392 -379 6.60746 0.179
NP_441004.1_1 Forward -168 -149 -14.2585 0.265
NP_442813.1_4 Forward -288 -269 -5.11376 0.299
NP_442366.1_3 Reverse -356 -374 -4.8974 0.278
NP_442873.1_2 Reverse -270 -289 9.53674 0.279
NP_440328.1_4 Reverse -268 -287 0.786102 0.239
NP_443054.1_2 Forward -285 -271 -0.590395 0.299
NP_441851.1_9 Forward -280 -261 14.8474 0.166
NP_441851.1_10 Reverse -356 -366 7.35486 0.142
NP_441851.1_10 Reverse -261 -271 4.60159 0.259
NP_442208.1_5 Reverse -235 -254 -9.83364 0.295
NP_442856.1_7 Reverse -178 -197 -3.83545 0.251
NP_440593.1_3 Forward -371 -352 -0.000545616 0.198
NP_440593.1_3 Reverse -149 -168 -5.70374 0.264
NP_440432.1_9 Forward -270 -255 -5.82163 0.267
NP_440474.1_8 Forward -275 -261 8.75042 0.179
NP_442450.1_5 Forward -253 -243 6.76487 0.155
NP_442006.1_2 Forward -205 -188 -17.6607 0.279
NP_441003.1_9 Reverse -187 -206 11.6025 0.213
NP_440078.1_10 Forward -283 -264 3.04771 0.269
NP_441078.1_4 Reverse -357 -366 5.99792 0.0932
NP_441078.1_4 Forward -283 -274 -1.86856 0.272
NP_441078.1_4 Forward -366 -357 -1.96689 0.282
NP_440707.1_7 Forward -287 -268 4.32602 0.284
NP_440526.1_3 Forward -365 -354 8.71129 0.116
NP_441432.1_8 Reverse -356 -365 4.32629 0.223
NP_441432.1_9 Forward -53 -40 12.3797 0.212
NP_441333.1_1 Forward -43 -33 16.6423 0.157
NP_440760.1_1 Reverse -154 -173 -18.3884 0.213
NP_442797.1_7 Forward -252 -234 -0.570838 0.284
NP_441057.1_4 Forward -287 -269 -1.45582 0.272
NP_442353.1_4 Reverse -268 -287 7.57013 0.165
NP_440913.1_3 Reverse -277 -290 15.7522 0.215
NP_442727.1_1 Forward -293 -279 11.406 0.294
NP_441072.1_2 Forward -287 -268 9.3409 0.219
NP_441072.1_2 Reverse -222 -241 8.75091 0.238
NP_442400.1_10 Forward -129 -116 10.3749 0.261
NP_442489.1_7 Forward -283 -274 -1.37691 0.195
NP_442489.1_7 Reverse -357 -366 -1.77023 0.247
NP_442763.1_10 Forward -276 -257 4.32602 0.26
NP_441659.2_8 Forward -366 -356 5.28991 0.112
NP_441040.1_2 Forward -288 -269 -15.2418 0.286
NP_440779.1_5 Forward -366 -349 -14.3175 0.244
NP_442346.1_5 Reverse -356 -366 12.9597 0.0318
NP_442346.1_5 Forward -367 -357 4.3066 0.291
NP_442346.1_10 Reverse -185 -204 -0.295539 0.265
NP_440545.1_3 Reverse -258 -275 -4.38605 0.224
NP_440545.1_3 Forward -280 -263 -6.35267 0.276
NP_440459.1_2 Forward -285 -268 8.00365 0.272
NP_442551.1_4 Forward -279 -264 4.20813 0.245
NP_441948.1_4 Forward -290 -272 -2.73412 0.175
NP_443040.1_1 Reverse -4 -18 13.7594 0.276
NP_443040.1_1 Forward -351 -337 9.89403 0.291
NP_441329.1_6 Reverse -20 -39 -1.86252 0.293
NP_441329.1_6 Reverse -6 -25 -2.62645 0.294
NP_442073.1_6 Reverse -348 -367 -0.590531 0.269
NP_442140.1_3 Forward -365 -355 7.45319 0.14
NP_442140.1_3 Forward -285 -275 5.28991 0.216
NP_442021.1_3 Reverse -184 -203 -6.98204 0.261
NP_441813.1_7 Reverse -274 -288 11.5037 0.216
NP_442028.1_1 Reverse -132 -145 7.51014 0.292
NP_440590.1_4 Reverse -278 -291 -1.45568 0.22
NP_440567.1_1 Forward -365 -351 -0.492064 0.287
NP_442497.1_10 Forward -365 -356 0.29472 0.199
NP_440821.1_4 Reverse -355 -365 -0.0199663 0.217
NP_441239.1_9 Forward -273 -261 5.05386 0.231
NP_441727.1_3 Reverse -350 -369 8.75091 0.202
NP_442044.1_1 Forward -276 -257 4.22769 0.131
NP_440833.1_6 Reverse -128 -142 6.78381 0.296
NP_440546.1_4 Forward -366 -356 9.17338 0.151
NP_440546.1_4 Reverse -357 -367 7.91294 0.214
NP_440546.1_7 Forward -286 -276 14.533 0.279
NP_441230.1_5 Forward -282 -263 -0.688862 0.292
NP_441537.1_6 Forward -133 -115 9.26226 0.245
NP_441204.1_1 Forward -193 -174 6.39097 0.263
NP_441879.1_6 Reverse -235 -254 17.7974 0.202
NP_441474.1_1 Forward -245 -226 4.42355 0.221
NP_441848.1_4 Reverse -77 -93 9.556 0.277
NP_441084.1_6 Reverse -242 -256 10.3137 0.248
NP_440696.1_6 Forward -288 -269 3.24438 0.288
NP_441811.1_8 Reverse -256 -270 7.9644 0.241
NP_441926.1_3 Reverse -357 -373 3.50012 0.219
NP_440914.1_1 Reverse -154 -164 9.10306 0.186
NP_442533.1_1 Reverse -223 -242 -6.1954 0.163
NP_442533.1_1 Reverse -233 -252 -8.06369 0.201
NP_442533.1_1 Reverse -232 -251 -16.2252 0.263
NP_442533.1_6 Reverse -274 -283 5.60459 0.137
NP_442533.1_6 Reverse -357 -366 5.50626 0.14
NP_442533.1_6 Forward -283 -274 3.7363 0.204
NP_442541.1_10 Reverse -174 -188 7.86545 0.225
NP_442541.1_10 Forward -253 -239 4.22722 0.252
NP_442232.1_3 Forward -279 -260 -10.4236 0.27
NP_442322.1_4 Forward -255 -238 0.234807 0.21
NP_441482.1_7 Reverse -351 -365 -9.14519 0.194
NP_439944.1_9 Reverse -358 -368 12.1731 0.0887
NP_440816.1_8 Forward -306 -292 18.4851 0.272
NP_442202.1_2 Forward -265 -246 17.9932 0.244
NP_440116.1_8 Reverse -243 -262 -9.73531 0.287
NP_441527.1_4 Reverse -6 -25 5.39487 0.106
NP_439965.1_7 Reverse -58 -77 12.8504 0.287
NP_441680.1_4 Reverse -269 -288 7.7676 0.165
NP_441680.1_4 Forward -314 -295 -0.885524 0.256
NP_439903.1_7 Forward -285 -266 2.75272 0.281
NP_441286.1_1 Forward -367 -355 -4.48425 0.161
NP_440886.1_7 Reverse -273 -283 15.9091 0.0203
NP_442072.1_9 Forward -284 -266 -23.0886 0.277
NP_442213.1_5 Forward -294 -275 3.34271 0.231
NP_442800.1_7 Forward -288 -269 6.58763 0.219
NP_440028.1_6 Reverse -346 -364 13.7855 0.218
NP_441808.1_8 Forward -295 -276 6.58763 0.285
NP_440907.2_8 Reverse -381 -391 3.8145 0.297
NP_441463.1_3 Forward -303 -284 8.55425 0.0487
NP_441463.1_6 Forward -368 -354 11.2476 0.224
NP_442365.1_5 Reverse -268 -287 13.1758 0.121
NP_441589.1_5 Reverse -350 -369 15.7877 0.262
NP_441962.1_4 Forward -365 -346 -9.047 0.211
NP_440387.1_1 Forward -276 -260 -4.26803 0.181
NP_441836.1_1 Reverse -346 -365 14.4213 0.193
NP_441836.1_2 Forward -289 -270 -3.04881 0.233
NP_440634.1_10 Forward -238 -219 7.96345 0.239
NP_440634.1_10 Forward -241 -222 4.12856 0.3
NP_441993.1_1 Reverse -232 -251 0.874656 0.29
NP_440935.1_6 Forward -46 -29 5.59067 0.296
NP_442437.1_3 Forward -236 -217 9.83173 0.264
NP_440287.1_5 Forward -319 -300 8.25844 0.286
NP_440293.1_3 Forward -279 -260 -6.29373 0.288
NP_440457.1_1 Reverse -353 -365 4.07055 0.175
NP_440457.1_1 Reverse -238 -250 0.333971 0.25
NP_440801.1_8 Reverse -153 -172 2.94938 0.229
NP_441984.1_3 Forward -287 -269 5.03403 0.295
NP_442439.1_8 Reverse -146 -165 8.16093 0.26
NP_442936.1_10 Forward -143 -129 10.4123 0.242
NP_441885.1_5 Reverse -357 -367 8.63316 0.0324
NP_442703.1_1 Reverse -3 -22 7.49569 0.266
NP_442341.1_7 Forward -367 -353 3.34284 0.227
NP_441756.1_5 Reverse -353 -372 -3.93378 0.29
NP_440507.2_3 Forward -280 -261 11.11 0.195
NP_440275.1_3 Reverse -265 -275 5.38824 0.153
NP_440091.1_1 Forward -200 -188 -0.157684 0.273
NP_440091.1_1 Forward -370 -358 -0.846001 0.293
NP_440312.1_8 Reverse -88 -107 7.30571 0.271
NP_441359.1_5 Forward -286 -267 4.12936 0.229
NP_441207.1_7 Reverse -30 -44 12.4502 0.241
NP_440175.1_4 Forward -295 -276 -14.4552 0.277
NP_442495.1_5 Forward -282 -263 15.1424 0.17
NP_441105.1_3 Forward -371 -352 1.17943 0.117
NP_440216.1_1 Forward -283 -269 -10.9151 0.153
NP_440172.1_1 Reverse -357 -367 4.89658 0.162
NP_442371.1_1 Reverse -28 -38 12.9592 0.222
NP_442015.1_10 Forward -275 -262 0.412608 0.227
NP_441766.1_9 Forward -285 -266 0.0977854 0.254
NP_440416.1_1 Reverse -363 -382 -13.2752 0.281
NP_440416.1_9 Reverse -267 -286 -8.55534 0.117
NP_440416.1_9 Forward -294 -275 -19.5684 0.276
NP_440261.1_5 Forward -365 -352 -10.5021 0.201
NP_440261.1_5 Reverse -72 -85 -11.1904 0.246
NP_440988.1_10 Reverse -266 -280 7.90002 0.212
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCAGCAATGGTTGGATCTCGGTAAATGGCAAATAGCCATAGCCCCGGCAGAAAAAAGGCTAACTGCTCCAGGGTGTTGTACTGTACCCTCAGCACCCGCTCAAAGTCTTCATTGCCGGTGGTGGCCGGTGGCATCACCCCATATTTAGCCCGAGCCCGCCCCACATTAATCACCAGCACCAGGTAAAGCATCGTCGCCAAAGCAGTGATCAAAGCTGGCCAGAGTAACTCGGTTTTTGTCATCGGTCATGGTGAAAGAAAGTATATTTTCAGACTAGCCCAAAAAGTTACTCTGCCTCCAAATCATTAATATTGCTCGGACTAATCGCTATACTTACGGTCAGGGTATTACCCAACTTTTTATTTTTCTCAGTCAAGTTCCTTTTGTATTTTTTATCCC

CDS

ATGCAGCTAAGCCCCCAGGAAAAAGATAAATTGTTGATTTTTACCGCCAGCCTAGTGGCAGAACGCCGTAAGGCCCGAGGGCTCAAACTCAACTATCCCGAAGCCGTGGCCTATATTTCCGCCGCTATCCTGGAAGGGGCCAGGGATGGTCGTACCGTAGCCGAGTTGATGAACTATGGCGCTACCCTATTGAGTCGGGACGAAGTCATGGAAGGGGTGCCGGAAATGTTACCGGAGGTACAGGTGGAAGCAACTTTTCCCGATGGCACTAAACTGGTGACGGTCCACGAACCCATTCGCTAG

Protein

MQLSPQEKDKLLIFTASLVAERRKARGLKLNYPEAVAYISAAILEGARDGRTVAELMNYGATLLSRDEVMEGVPEMLPEVQVEATFPDGTKLVTVHEPIR