Your browser is old and dusty. Try Google Chrome!

Details for slr1255

ORF slr1255
Accession NP_441168.1
Symbol pys, crtB
Category Carotenoid
Definition phytoene synthase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -118 -132 15.4376 0.104
NP_441061.1_2 Reverse -119 -133 2.45787 0.176
NP_441061.1_2 Forward -126 -112 0.88457 0.197
NP_441061.1_2 Forward -132 -118 0.196253 0.215
NP_440557.1_1 Reverse -119 -138 -2.16383 0.284
NP_440795.1_7 Forward -126 -119 14.6904 0.0123
NP_440795.1_7 Reverse -119 -126 14.6904 0.0123
NP_441418.1_6 Forward -127 -108 -3.04881 0.0218
NP_441418.1_6 Reverse -90 -109 -19.6667 0.093
NP_441418.1_6 Reverse -118 -137 -20.5517 0.117
NP_441418.1_6 Reverse -73 -92 -21.3384 0.147
NP_441418.1_6 Reverse -352 -371 -22.42 0.177
NP_441418.1_6 Reverse -355 -374 -29.6965 0.234
NP_441418.1_6 Forward -373 -354 -30.0898 0.256
NP_441418.1_6 Reverse -106 -125 -30.1882 0.262
NP_442291.1_7 Forward -137 -123 12.3893 0.211
NP_440897.1_6 Forward -400 -381 -2.95123 0.227
NP_440897.1_6 Forward -376 -357 -4.52452 0.28
NP_441453.1_4 Reverse -118 -126 16.539 0.00633
NP_441453.1_4 Forward -127 -119 16.539 0.00633
NP_441453.1_7 Reverse -80 -87 11.9372 0.298
NP_441453.1_7 Forward -49 -42 11.9372 0.298
NP_441623.1_1 Reverse -66 -84 -3.42244 0.258
NP_442151.1_6 Forward -127 -113 10.226 0.127
NP_442151.1_6 Reverse -118 -132 7.17775 0.206
NP_440226.1_1 Reverse -118 -137 9.83255 0.0687
NP_440226.1_1 Forward -127 -108 3.73603 0.215
NP_442169.1_1 Forward -172 -153 2.65439 0.261
NP_440931.1_7 Forward -112 -94 10.8348 0.287
NP_440150.1_6 Reverse -115 -134 3.73603 0.245
NP_440637.1_7 Reverse -70 -89 9.63589 0.259
NP_442655.1_2 Reverse -93 -112 5.11266 0.228
NP_441721.1_5 Forward -216 -197 26.6471 0.00127
NP_442173.1_1 Forward -126 -118 15.4574 0.00633
NP_442173.1_1 Reverse -119 -127 15.4574 0.00633
NP_442173.1_3 Reverse -81 -91 16.2046 0.196
NP_442752.1_4 Forward -127 -120 13.8055 0.0199
NP_442752.1_4 Reverse -118 -125 13.8055 0.0199
NP_442752.1_4 Reverse -90 -97 5.84064 0.166
NP_443027.1_4 Reverse -116 -126 13.943 0.0452
NP_443027.1_4 Forward -129 -119 13.2547 0.0521
NP_442975.1_10 Reverse -114 -128 20.9434 0.00133
NP_440784.1_7 Forward -126 -119 15.9687 0.0123
NP_440784.1_7 Reverse -119 -126 15.9687 0.0123
NP_440061.1_9 Forward -129 -115 13.372 0.0819
NP_441054.1_1 Forward -134 -120 13.2743 0.275
NP_441054.1_2 Forward -393 -374 11.8975 0.254
NP_441145.1_1 Forward -234 -215 7.07928 0.254
NP_441476.1_5 Forward -132 -113 0.786102 0.19
NP_441476.1_5 Reverse -113 -132 -1.47551 0.205
NP_442062.1_8 Forward -127 -117 19.4496 0.000558
NP_442062.1_8 Reverse -118 -128 10.3048 0.0493
NP_440761.1_4 Reverse -113 -132 -13.6686 0.257
NP_441859.1_3 Forward -128 -109 7.17681 0.164
NP_441802.1_1 Reverse -337 -356 8.16093 0.224
NP_440304.1_4 Forward -129 -119 10.8948 0.051
NP_440304.1_4 Reverse -116 -126 9.91146 0.051
NP_442242.1_4 Forward -126 -119 14.3954 0.0124
NP_442242.1_4 Reverse -119 -126 14.3954 0.0124
NP_440853.1_5 Forward -330 -311 12.4875 0.292
NP_439918.1_2 Reverse -97 -116 2.94938 0.195
NP_439918.1_2 Reverse -91 -110 -3.04881 0.251
NP_439918.1_3 Reverse -87 -106 5.40766 0.264
NP_439918.1_3 Reverse -115 -134 3.14605 0.269
NP_441200.1_6 Reverse -358 -375 10.9536 0.285
NP_441208.1_9 Reverse -115 -129 8.25939 0.219
NP_441208.1_9 Forward -130 -116 8.16106 0.219
NP_441594.1_6 Forward -160 -141 1.27776 0.269
NP_440370.1_10 Reverse -109 -128 19.5673 0.0433
NP_440132.1_1 Reverse -116 -134 11.5239 0.207
NP_442110.1_7 Reverse -118 -132 12.0943 0.0586
NP_442110.1_7 Forward -376 -362 1.27789 0.233
NP_442110.1_7 Forward -127 -113 1.08123 0.239
NP_440856.1_4 Forward -134 -115 7.37428 0.0705
NP_440856.1_4 Forward -106 -87 -0.197208 0.174
NP_440856.1_7 Reverse -352 -371 8.16093 0.116
NP_440856.1_7 Forward -379 -360 -2.0655 0.191
NP_441083.1_5 Forward -127 -117 11.3864 0.0159
NP_441083.1_5 Reverse -118 -128 11.2881 0.0159
NP_442827.1_4 Reverse -144 -163 7.76679 0.252
NP_442827.1_8 Reverse -110 -129 12.4867 0.0458
NP_441434.1_7 Forward -235 -221 7.9644 0.225
NP_441738.1_2 Forward -125 -118 15.28 0.0102
NP_441738.1_2 Reverse -120 -127 15.28 0.0102
NP_441738.1_2 Forward -97 -90 8.20023 0.181
NP_441558.1_5 Forward -129 -110 25.2705 0.00104
NP_440209.1_1 Reverse -118 -126 18.1123 0.00295
NP_440209.1_1 Forward -127 -119 18.1123 0.00295
NP_440447.1_1 Forward -132 -114 5.62401 0.194
NP_441713.1_1 Reverse -112 -131 -7.08038 0.126
NP_441713.1_1 Reverse -84 -103 -12.4886 0.245
NP_441713.1_1 Forward -133 -114 -16.6185 0.285
NP_440178.1_7 Forward -128 -109 -19.6667 0.178
NP_440178.1_7 Reverse -369 -388 -22.2233 0.258
NP_441716.1_1 Forward -127 -113 13.4709 0.0689
NP_440644.1_3 Forward -393 -374 0.884433 0.278
NP_441598.1_3 Forward -284 -265 12.8694 0.245
NP_442111.1_4 Forward -128 -114 16.5192 0.0145
NP_442111.1_4 Reverse -117 -131 13.4709 0.0383
NP_442111.1_4 Forward -238 -224 5.50613 0.162
NP_440906.1_5 Forward -126 -119 15.8704 0.0124
NP_440906.1_5 Reverse -119 -126 15.8704 0.0124
NP_440747.1_10 Forward -130 -118 17.1486 0.000663
NP_440747.1_10 Reverse -115 -127 -2.02597 0.0196
NP_440747.1_10 Reverse -364 -376 -11.5641 0.125
NP_441130.1_10 Reverse -116 -130 10.0294 0.117
NP_441130.1_10 Forward -129 -115 9.5377 0.124
NP_441130.1_10 Reverse -185 -199 4.91614 0.258
NP_441854.1_10 Reverse -116 -135 11.5042 0.139
NP_441486.1_1 Reverse -115 -129 -3.44199 0.178
NP_441880.2_10 Forward -126 -108 14.1788 0.111
NP_442634.1_4 Reverse -116 -130 6.58777 0.0489
NP_442634.1_4 Forward -129 -115 5.80112 0.051
NP_442634.1_4 Reverse -88 -102 -4.32697 0.195
NP_440403.1_4 Reverse -109 -128 -7.08038 0.237
NP_441014.1_8 Forward -240 -221 5.80098 0.19
NP_442848.1_1 Reverse -112 -126 7.57108 0.0791
NP_441012.1_4 Reverse -363 -376 7.6891 0.272
NP_443018.1_3 Forward -126 -119 14.8871 0.0123
NP_443018.1_3 Reverse -119 -126 14.8871 0.0123
NP_441316.1_7 Reverse -116 -131 4.20813 0.135
NP_441634.1_8 Forward -129 -115 15.8309 0.0248
NP_440376.1_1 Forward -127 -118 19.4693 0.000692
NP_440376.1_1 Reverse -118 -127 19.4693 0.000692
NP_440376.1_1 Reverse -237 -246 1.86802 0.238
NP_441857.1_5 Reverse -111 -129 5.82068 0.2
NP_442687.1_7 Reverse -117 -127 15.8113 0.0125
NP_442687.1_7 Forward -128 -118 9.02648 0.0994
NP_442687.1_7 Forward -83 -73 4.99491 0.225
NP_442687.1_7 Reverse -89 -99 3.71661 0.292
NP_442191.1_4 Reverse -119 -133 17.2953 0.0224
NP_442191.1_4 Forward -126 -112 15.841 0.0488
NP_442191.1_4 Reverse -109 -123 11.0901 0.271
NP_440066.1_6 Forward -373 -354 19.9606 0.153
NP_442485.1_3 Reverse -113 -132 -0.688862 0.253
NP_442485.1_3 Forward -375 -356 -3.44213 0.274
NP_440228.1_1 Reverse -346 -365 7.7676 0.0901
NP_441422.1_7 Forward -119 -102 12.5269 0.0565
NP_441422.1_7 Forward -129 -112 5.54538 0.0992
NP_441422.1_7 Reverse -116 -133 -1.73112 0.194
NP_440533.1_9 Reverse -118 -137 6.39097 0.19
NP_441763.1_10 Reverse -107 -126 9.7334 0.18
NP_440360.1_5 Forward -292 -273 -4.32711 0.297
NP_440360.1_10 Forward -98 -84 4.03116 0.227
NP_440360.1_10 Reverse -150 -164 2.16287 0.27
NP_442658.1_1 Reverse -116 -126 18.7607 0.00222
NP_442658.1_1 Forward -129 -119 14.2375 0.0237
NP_442198.1_7 Reverse -19 -38 9.34008 0.273
NP_442782.1_2 Reverse -91 -105 11.996 0.173
NP_442782.1_2 Reverse -118 -132 11.111 0.173
NP_442782.1_2 Reverse -90 -104 5.50613 0.242
NP_442782.1_2 Reverse -204 -218 -0.000409212 0.297
NP_442205.1_9 Reverse -112 -128 -1.61309 0.264
NP_441414.1_9 Forward -127 -108 -4.13045 0.148
NP_441256.1_1 Reverse -151 -170 3.73603 0.124
NP_442937.1_5 Reverse -113 -132 6.09597 0.288
NP_442321.1_1 Reverse -71 -90 -8.16202 0.284
NP_441958.1_5 Forward -128 -118 21.2195 0.000805
NP_441958.1_5 Reverse -117 -127 12.2714 0.00183
NP_441958.1_5 Reverse -89 -99 -2.18325 0.267
NP_441127.1_1 Reverse -361 -375 9.63603 0.271
NP_441127.1_1 Reverse -55 -69 8.55439 0.29
NP_442836.1_5 Reverse -112 -131 1.0811 0.288
NP_439905.1_1 Forward -126 -113 9.95071 0.216
NP_440984.1_7 Reverse -251 -265 5.80112 0.24
NP_439990.1_5 Forward -132 -119 10.7374 0.128
NP_442376.1_2 Reverse -113 -132 -4.52377 0.253
NP_442376.1_2 Forward -60 -41 -7.08038 0.286
NP_442376.1_2 Forward -132 -113 -13.5702 0.297
NP_442911.1_2 Reverse -108 -127 6.09597 0.03
NP_442911.1_2 Forward -137 -118 -2.65548 0.1
NP_442911.1_2 Reverse -98 -117 -4.91709 0.145
NP_442911.1_2 Forward -386 -367 -8.06369 0.226
NP_440153.1_5 Forward -126 -112 12.8809 0.0645
NP_442536.1_7 Forward -133 -114 7.57094 0.273
NP_443055.1_3 Reverse -109 -128 10.2632 0.299
NP_441891.1_6 Reverse -53 -66 21.4554 0.0663
NP_440993.1_2 Forward -132 -116 5.95839 0.234
NP_440993.1_2 Forward -104 -88 4.3851 0.256
NP_440993.1_3 Forward -137 -118 -1.96793 0.292
NP_440850.1_6 Reverse -115 -134 12.4875 0.168
NP_442002.1_1 Reverse -81 -99 -7.15901 0.249
NP_442002.1_9 Reverse -117 -124 10.7572 0.185
NP_441654.1_7 Forward -103 -84 19.2133 0.145
NP_440809.1_9 Reverse -109 -127 -6.1757 0.225
NP_441294.1_7 Reverse -114 -128 12.9942 0.0767
NP_440411.1_10 Reverse -9 -28 9.18818 0.293
NP_441646.1_1 Forward -134 -115 7.17762 0.164
NP_441646.1_1 Reverse -101 -120 -0.688862 0.271
NP_441646.1_1 Reverse -111 -130 -0.983855 0.276
NP_442438.1_10 Reverse -113 -127 11.406 0.0463
NP_442438.1_10 Forward -132 -118 2.75286 0.168
NP_442438.1_10 Reverse -103 -117 2.75286 0.168
NP_442438.1_10 Forward -228 -214 2.45787 0.176
NP_441456.1_10 Forward -390 -371 12.7825 0.281
NP_441000.1_6 Forward -238 -224 1.57289 0.167
NP_441000.1_6 Forward -128 -114 -4.03198 0.225
NP_441000.1_6 Reverse -117 -131 -4.03198 0.225
NP_442771.1_1 Reverse -116 -134 5.62401 0.063
NP_440484.1_6 Reverse -256 -275 10.2259 0.225
NP_440147.1_4 Forward -129 -116 18.4072 0.00407
NP_440147.1_4 Reverse -116 -129 10.4424 0.0355
NP_441550.1_8 Forward -129 -119 15.8108 0.0132
NP_441550.1_8 Reverse -116 -126 10.501 0.066
NP_441916.1_7 Reverse -118 -128 18.9579 0.00144
NP_441916.1_7 Forward -127 -117 18.4663 0.00144
NP_441041.1_4 Forward -127 -108 5.99764 0.0466
NP_441041.1_4 Reverse -218 -237 1.37609 0.0808
NP_441041.1_4 Forward -376 -357 -9.63698 0.219
NP_441041.1_4 Reverse -112 -131 -13.4719 0.288
NP_441041.1_7 Forward -130 -118 13.3454 0.0485
NP_441041.1_7 Reverse -115 -127 10.2357 0.1
NP_442004.1_6 Reverse -118 -132 7.27608 0.161
NP_441725.1_4 Forward -132 -118 22.025 0.00544
NP_441725.1_5 Forward -126 -116 9.02648 0.0553
NP_441725.1_5 Reverse -119 -129 1.94665 0.115
NP_439966.1_7 Reverse -116 -126 17.4824 0.00636
NP_439966.1_7 Forward -129 -119 14.3359 0.0203
NP_439966.1_9 Reverse -116 -125 10.7178 0.0863
NP_442941.1_3 Reverse -119 -129 19.2529 0.00262
NP_442941.1_3 Forward -126 -116 2.53664 0.14
NP_440289.1_2 Reverse -115 -128 3.46087 0.078
NP_440289.1_2 Forward -130 -117 -3.52063 0.267
NP_440983.1_5 Reverse -355 -374 -4.72043 0.261
NP_440983.1_5 Forward -376 -357 -6.58872 0.278
NP_442281.1_1 Forward -132 -118 15.2402 0.0132
NP_442281.1_1 Forward -104 -90 2.8506 0.253
NP_441334.1_7 Reverse -116 -135 -0.983855 0.0581
NP_440437.1_1 Forward -133 -114 4.32602 0.106
NP_442012.1_1 Forward -133 -114 11.3075 0.0743
NP_441457.1_7 Forward -129 -110 0.294447 0.288
NP_441457.1_9 Reverse -354 -373 12.8808 0.221
NP_441556.1_10 Reverse -113 -127 14.31 0.178
NP_442982.1_5 Forward -137 -118 8.25926 0.12
NP_441644.1_6 Reverse -118 -128 19.0557 0.000803
NP_441644.1_6 Forward -127 -117 10.1076 0.0628
NP_442215.1_2 Reverse -116 -132 -3.38305 0.214
NP_442215.1_2 Forward -378 -362 -4.46469 0.233
NP_442029.1_6 Reverse -97 -116 15.0441 0.0999
NP_442247.1_6 Forward -400 -381 11.7008 0.219
NP_442247.1_8 Forward -129 -115 11.996 0.247
NP_440253.1_2 Forward -127 -109 1.59244 0.157
NP_440929.1_8 Forward -127 -118 19.2726 0.000701
NP_440929.1_8 Reverse -118 -127 19.2726 0.000701
NP_442933.1_10 Forward -127 -118 17.601 0.00325
NP_442933.1_10 Reverse -118 -127 17.601 0.00325
NP_441751.2_8 Reverse -119 -133 5.21113 0.0448
NP_442554.1_8 Reverse -119 -129 17.2863 0.00543
NP_442554.1_8 Forward -126 -116 16.008 0.0065
NP_441762.1_7 Forward -128 -116 12.527 0.0142
NP_441762.1_7 Reverse -117 -129 2.30059 0.0676
NP_441762.1_7 Reverse -227 -239 -5.76255 0.238
NP_442142.1_4 Forward -130 -117 15.4566 0.0264
NP_442142.1_4 Forward -373 -360 6.80355 0.154
NP_442142.1_4 Reverse -115 -128 6.60689 0.16
NP_442142.1_4 Reverse -358 -371 4.64028 0.214
NP_442142.1_4 Forward -240 -227 3.7553 0.246
NP_442142.1_4 Forward -91 -78 2.28034 0.295
NP_442292.1_1 Reverse -119 -128 17.5026 0.00435
NP_442292.1_1 Forward -126 -117 9.63616 0.0183
NP_442292.1_5 Reverse -104 -123 -1.57384 0.265
NP_440919.1_1 Forward -56 -37 -8.94866 0.296
NP_442476.1_6 Forward -126 -112 4.91614 0.141
NP_442381.1_8 Reverse -115 -134 6.4893 0.0616
NP_441523.1_6 Forward -131 -112 6.58763 0.212
NP_443009.1_5 Forward -128 -117 19.626 0.00102
NP_443009.1_5 Reverse -117 -128 7.82632 0.118
NP_443009.1_5 Reverse -317 -328 3.69644 0.282
NP_442408.2_1 Reverse -118 -137 -4.91709 0.267
NP_441715.1_4 Reverse -119 -129 16.7946 0.0106
NP_441715.1_4 Forward -126 -116 9.32148 0.097
NP_441448.1_1 Forward -381 -362 15.2408 0.16
NP_441448.1_1 Reverse -333 -352 5.60432 0.261
NP_440158.1_8 Reverse -88 -107 13.8641 0.206
NP_440183.1_9 Forward -131 -112 -21.1417 0.296
NP_440379.1_5 Forward -379 -360 0.196116 0.172
NP_441468.1_1 Forward -126 -119 15.8704 0.0124
NP_441468.1_1 Reverse -119 -126 15.8704 0.0124
NP_441020.2_6 Reverse -116 -133 20.0984 0.00619
NP_441020.2_6 Reverse -88 -105 7.70866 0.222
NP_441015.1_10 Forward -132 -113 0.884433 0.164
NP_441015.1_10 Reverse -113 -132 -10.227 0.283
NP_441673.1_1 Forward -127 -118 20.8459 0.000698
NP_441673.1_1 Reverse -118 -127 20.8459 0.000698
NP_441673.1_1 Forward -376 -367 -7.86675 0.187
NP_441673.1_1 Reverse -367 -376 -7.96508 0.206
NP_441731.1_3 Forward -135 -116 -5.11376 0.284
NP_441956.1_9 Reverse -111 -130 10.5209 0.215
NP_441876.1_9 Reverse -320 -330 10.501 0.292
NP_441826.1_2 Reverse -112 -126 10.226 0.0498
NP_441330.1_1 Forward -132 -113 -12.2919 0.183
NP_441764.1_8 Reverse -203 -213 10.9279 0.291
NP_442868.1_6 Forward -129 -119 10.4031 0.038
NP_442868.1_6 Reverse -116 -126 8.53483 0.0555
NP_442227.1_2 Forward -98 -79 0.0977854 0.253
NP_442361.1_3 Forward -133 -120 9.06573 0.283
NP_442808.1_1 Reverse -117 -127 18.4657 0.00201
NP_442808.1_1 Forward -128 -118 8.73102 0.0481
NP_442808.1_1 Forward -106 -96 1.74956 0.281
NP_441101.1_10 Forward -131 -112 2.75272 0.173
NP_441849.1_3 Forward -29 -10 13.3716 0.269
NP_440145.1_3 Forward -137 -118 3.04771 0.11
NP_440145.1_3 Reverse -108 -127 0.687771 0.134
NP_442542.1_2 Reverse -116 -129 10.344 0.126
NP_442113.1_10 Forward -62 -43 -9.34199 0.295
NP_442050.1_5 Forward -129 -119 15.9091 0.0091
NP_442050.1_5 Reverse -116 -126 8.23937 0.234
NP_442050.1_5 Forward -101 -91 8.04271 0.243
NP_442342.1_9 Reverse -116 -132 11.0716 0.12
NP_440558.1_2 Forward -136 -117 -3.3438 0.234
NP_440558.1_2 Reverse -358 -377 -5.80207 0.264
NP_440558.1_2 Forward -35 -16 -6.49039 0.275
NP_440558.1_2 Reverse -145 -164 -7.67036 0.298
NP_442789.1_4 Forward -378 -359 7.96426 0.105
NP_442789.1_4 Reverse -116 -135 -6.1954 0.285
NP_441878.1_6 Forward -128 -118 10.5014 0.0176
NP_441878.1_6 Reverse -117 -127 10.4031 0.0176
NP_441036.1_8 Reverse -117 -127 17.7779 0.000554
NP_441036.1_8 Forward -128 -118 15.713 0.00724
NP_441557.1_5 Forward -127 -118 19.9609 0.000699
NP_441557.1_5 Reverse -118 -127 19.9609 0.000699
NP_441445.1_1 Forward -255 -236 6.68596 0.144
NP_441445.1_1 Reverse -109 -128 1.86774 0.247
NP_441590.1_4 Forward -104 -85 3.53858 0.29
NP_442066.2_4 Forward -127 -108 -8.06369 0.293
NP_442066.2_9 Forward -380 -367 13.7856 0.154
NP_442419.1_2 Forward -132 -113 -1.37718 0.246
NP_441308.1_8 Reverse -116 -126 9.22315 0.226
NP_440101.1_3 Reverse -113 -132 10.4225 0.121
NP_440101.1_5 Forward -134 -115 6.4893 0.183
NP_441458.1_10 Forward -136 -117 4.71934 0.227
NP_442183.1_1 Forward -127 -113 9.34103 0.0986
NP_442183.1_1 Reverse -118 -132 7.17775 0.147
NP_442166.1_7 Reverse -119 -133 22.1241 0.0164
NP_441574.1_1 Forward -382 -363 -3.24547 0.238
NP_442444.1_6 Forward -162 -144 16.8865 0.165
NP_441549.1_9 Reverse -114 -132 -5.09406 0.198
NP_441549.1_9 Reverse -233 -251 -10.3056 0.274
NP_441467.1_9 Reverse -95 -109 18.4858 0.142
NP_442347.1_2 Forward -126 -117 11.1111 0.056
NP_442347.1_2 Reverse -353 -362 6.68623 0.156
NP_442347.1_2 Reverse -119 -128 3.34298 0.284
NP_442645.1_2 Forward -135 -116 -22.125 0.29
NP_441037.1_4 Reverse -116 -126 16.2838 0.0168
NP_441037.1_4 Forward -129 -119 7.22024 0.237
NP_442594.1_8 Forward -173 -154 7.37428 0.213
NP_440932.1_5 Reverse -350 -369 3.34271 0.274
NP_441633.1_3 Forward -129 -116 13.3923 0.018
NP_441633.1_3 Reverse -143 -156 0.805932 0.115
NP_441633.1_3 Reverse -116 -129 -3.81562 0.177
NP_440136.1_2 Forward -126 -119 15.9687 0.0123
NP_440136.1_2 Reverse -119 -126 15.9687 0.0123
NP_442590.1_10 Reverse -112 -131 7.47261 0.226
NP_442998.1_10 Forward -125 -118 15.5754 0.0102
NP_442998.1_10 Reverse -120 -127 15.5754 0.0102
NP_440899.1_1 Reverse -85 -104 7.52912 0.254
NP_440299.1_1 Reverse -114 -127 17.3249 0.0065
NP_440299.1_1 Forward -131 -118 11.1301 0.0518
NP_441799.1_1 Forward -131 -117 10.3237 0.0756
NP_441799.1_1 Reverse -114 -128 7.17714 0.149
NP_442802.1_6 Forward -128 -109 2.0644 0.204
NP_441007.1_10 Forward -132 -119 3.26421 0.182
NP_442333.2_5 Forward -110 -91 -7.57203 0.232
NP_440256.1_1 Forward -130 -111 5.01433 0.0395
NP_441229.1_10 Reverse -7 -26 -2.26216 0.288
NP_441559.1_8 Reverse -113 -127 11.996 0.0574
NP_441559.1_8 Forward -132 -118 11.0127 0.0574
NP_441559.1_8 Forward -49 -35 -5.80194 0.27
NP_441559.1_8 Forward -122 -108 -5.9986 0.271
NP_440915.1_6 Reverse -114 -128 16.5192 0.0183
NP_440915.1_6 Forward -131 -117 10.6193 0.0301
NP_440915.1_6 Reverse -86 -100 -0.393733 0.193
NP_441179.1_9 Forward -372 -362 9.71433 0.28
NP_442785.1_7 Forward -129 -115 11.3077 0.228
NP_442866.1_1 Reverse -85 -104 -8.26035 0.279
NP_440748.1_5 Forward -29 -10 -1.08219 0.267
NP_442031.1_5 Forward -375 -356 4.12936 0.3
NP_441464.1_1 Forward -131 -112 11.7992 0.24
NP_440695.1_5 Forward -127 -108 4.42435 0.202
NP_440695.1_5 Forward -385 -366 -1.08219 0.284
NP_441939.1_3 Reverse -119 -138 12.1925 0.103
NP_441199.1_6 Reverse -114 -133 11.1109 0.0685
NP_441199.1_6 Reverse -372 -391 -0.197208 0.262
NP_441494.1_6 Forward -132 -119 8.77074 0.227
NP_441494.1_6 Reverse -143 -156 7.19745 0.267
NP_442993.1_1 Reverse -118 -134 -10.4629 0.22
NP_442993.1_1 Reverse -276 -292 -10.6595 0.224
NP_442993.1_1 Forward -220 -204 -11.2495 0.24
NP_442386.1_9 Reverse -117 -126 15.7322 0.0144
NP_442386.1_9 Forward -258 -249 8.16077 0.209
NP_442386.1_9 Forward -128 -119 6.39082 0.219
NP_442386.1_9 Forward -371 -362 4.52254 0.297
NP_441750.1_1 Forward -391 -372 -12.6852 0.3
NP_441340.1_5 Forward -126 -119 15.6737 0.0124
NP_441340.1_5 Reverse -119 -126 15.6737 0.0124
NP_442791.1_9 Reverse -368 -387 13.9616 0.209
NP_440327.1_6 Reverse -11 -30 6.19431 0.246
NP_442240.1_2 Reverse -215 -234 -16.1268 0.239
NP_442240.1_2 Forward -126 -107 -16.6185 0.247
NP_442240.1_2 Reverse -119 -138 -20.3551 0.295
NP_440586.1_1 Forward -380 -361 5.60432 0.182
NP_440586.1_1 Reverse -114 -133 -3.24547 0.265
NP_440586.1_8 Forward -126 -119 13.2151 0.026
NP_440586.1_8 Reverse -119 -126 13.2151 0.026
NP_440586.1_8 Forward -236 -229 8.88855 0.205
NP_440586.1_8 Reverse -362 -369 5.8403 0.283
NP_442251.1_6 Forward -126 -119 15.2804 0.0124
NP_442251.1_6 Reverse -119 -126 15.2804 0.0124
NP_442959.1_4 Reverse -209 -228 8.35759 0.216
NP_440684.1_9 Forward -382 -368 8.65272 0.225
NP_440684.1_9 Reverse -109 -123 6.58777 0.298
NP_441262.1_3 Reverse -118 -125 14.7888 0.0223
NP_441262.1_3 Forward -127 -120 14.7888 0.0223
NP_440027.1_3 Forward -233 -215 4.93494 0.249
NP_443051.1_1 Forward -128 -119 19.5676 0.00335
NP_443051.1_1 Reverse -117 -126 10.4228 0.00754
NP_439937.1_8 Forward -375 -356 -3.73712 0.271
NP_439937.1_9 Forward -128 -111 1.41477 0.0948
NP_439937.1_9 Forward -228 -211 -10.1882 0.224
NP_439937.1_9 Forward -118 -101 -11.4665 0.256
NP_439937.1_9 Forward -250 -233 -13.2365 0.283
NP_440408.1_7 Reverse -90 -109 11.8975 0.212
NP_440439.1_1 Reverse -115 -128 18.8005 0.0105
NP_440439.1_1 Forward -130 -117 18.1122 0.0105
NP_439943.1_7 Reverse -113 -132 4.52268 0.278
NP_440372.1_2 Forward -126 -119 16.3621 0.0124
NP_440372.1_2 Reverse -119 -126 16.3621 0.0124
NP_442285.1_10 Reverse -368 -387 20.649 0.0685
NP_441803.1_2 Forward -132 -113 17.699 0.0309
NP_439977.1_5 Forward -133 -114 13.0775 0.0531
NP_439977.1_5 Reverse -112 -131 1.57275 0.191
NP_442384.1_10 Reverse -118 -131 18.8988 0.00338
NP_442384.1_10 Forward -127 -114 11.229 0.0372
NP_442114.1_4 Forward -127 -116 12.1534 0.107
NP_441018.1_7 Reverse -114 -133 7.66927 0.268
NP_441018.1_7 Forward -380 -361 6.4893 0.286
NP_441018.1_7 Reverse -301 -320 6.09597 0.299
NP_442790.1_4 Reverse -228 -247 -13.1769 0.259
NP_442790.1_4 Forward -136 -117 -14.3569 0.274
NP_442790.1_4 Reverse -109 -128 -14.8485 0.282
NP_442262.1_10 Forward -126 -119 14.1988 0.0123
NP_442262.1_10 Reverse -119 -126 14.1988 0.0123
NP_441689.1_5 Forward -129 -119 8.3377 0.132
NP_441689.1_5 Forward -101 -91 5.78111 0.197
NP_442244.1_6 Reverse -67 -86 0.392778 0.291
NP_440344.1_10 Reverse -111 -128 -7.13932 0.115
NP_440344.1_10 Forward -134 -117 -9.00761 0.137
NP_440344.1_10 Forward -334 -317 -10.8759 0.194
NP_440282.1_10 Reverse -183 -202 -8.45701 0.263
NP_440531.1_8 Reverse -130 -149 2.16274 0.298
NP_440189.1_2 Forward -135 -116 1.86774 0.268
NP_440487.1_1 Reverse -115 -134 -1.67217 0.214
NP_441965.1_10 Reverse -115 -131 11.4649 0.107
NP_441640.1_8 Reverse -219 -238 -5.60541 0.289
NP_441898.1_8 Forward -369 -350 14.0608 0.118
NP_440297.1_9 Forward -126 -116 -0.216628 0.282
NP_440297.1_9 Reverse -119 -129 -0.216628 0.282
NP_441896.1_3 Reverse -109 -128 11.7992 0.0816
NP_441896.1_3 Forward -136 -117 -0.787193 0.247
NP_441896.1_9 Reverse -326 -339 18.8812 0.293
NP_441103.1_6 Forward -103 -84 18.7798 0.157
NP_440894.1_10 Reverse -113 -132 13.5691 0.116
NP_440894.1_10 Reverse -359 -378 3.93269 0.261
NP_440999.1_9 Reverse -114 -128 19.1741 0.0136
NP_440999.1_9 Forward -131 -117 1.17956 0.169
NP_440888.1_2 Forward -127 -113 18.9768 0.00173
NP_440888.1_2 Reverse -118 -132 14.1586 0.02
NP_440792.1_1 Forward -393 -374 7.07928 0.215
NP_440179.1_6 Forward -126 -107 4.32602 0.246
NP_442147.1_2 Forward -168 -149 9.14423 0.293
NP_440491.1_1 Reverse -115 -134 14.3238 0.111
NP_439969.1_3 Reverse -113 -132 2.85105 0.24
NP_442033.1_10 Reverse -116 -135 2.26107 0.0882
NP_442033.1_10 Forward -129 -110 -5.01543 0.179
NP_441543.1_2 Forward -126 -117 18.486 0.00236
NP_441543.1_2 Reverse -119 -128 15.9293 0.00518
NP_441551.1_5 Reverse -114 -130 13.7258 0.119
NP_441551.1_5 Reverse -214 -230 5.85938 0.293
NP_441319.1_8 Forward -133 -115 5.32902 0.28
NP_441469.1_8 Reverse -117 -126 16.126 0.00797
NP_441469.1_8 Reverse -188 -197 7.37455 0.227
NP_441469.1_8 Forward -128 -119 6.5879 0.227
NP_441548.1_1 Reverse -334 -353 13.8641 0.195
NP_443064.1_6 Reverse -118 -128 10.8217 0.13
NP_442578.1_7 Forward -126 -119 14.5921 0.026
NP_442578.1_7 Reverse -119 -126 14.5921 0.026
NP_440710.1_1 Forward -135 -117 -9.0273 0.292
NP_441462.1_2 Reverse -118 -128 20.2362 0.000805
NP_441462.1_2 Forward -127 -117 11.5831 0.00406
NP_441462.1_2 Reverse -90 -100 -1.29827 0.299
NP_441621.1_7 Reverse -116 -130 14.0609 0.0266
NP_441621.1_7 Forward -375 -361 4.81781 0.0934
NP_441621.1_7 Forward -372 -358 -3.147 0.188
NP_441621.1_7 Forward -129 -115 -3.34366 0.188
NP_443062.1_1 Forward -127 -109 5.81572 0.218
NP_443062.1_6 Reverse -110 -129 3.53937 0.235
NP_440349.1_3 Reverse -362 -381 13.6666 0.23
NP_440349.1_3 Forward -384 -365 9.53674 0.299
NP_441410.1_3 Forward -136 -117 4.52268 0.272
NP_440519.1_8 Reverse -91 -107 4.0901 0.237
NP_442204.1_1 Forward -131 -120 21.1015 0.0035
NP_442204.1_1 Reverse -114 -125 0.648657 0.281
NP_442204.1_2 Forward -137 -118 5.89931 0.292
NP_441560.1_8 Forward -132 -113 14.9213 0.129
NP_442487.1_5 Forward -128 -109 2.06362 0.3
NP_440516.1_2 Reverse -112 -130 5.82068 0.122
NP_440516.1_8 Forward -127 -118 16.9127 0.00442
NP_440516.1_8 Reverse -118 -127 16.9127 0.00442
NP_440516.1_8 Reverse -228 -237 -0.393597 0.255
NP_442428.1_5 Forward -126 -119 15.8704 0.0124
NP_442428.1_5 Reverse -119 -126 15.8704 0.0124
NP_440783.1_2 Forward -381 -362 -1.7705 0.168
NP_441443.1_1 Reverse -339 -358 -1.18052 0.241
NP_442120.1_10 Reverse -67 -86 -9.63698 0.244
NP_442120.1_10 Reverse -112 -131 -14.7502 0.289
NP_442823.1_8 Forward -144 -125 11.4058 0.286
NP_440673.1_2 Reverse -108 -127 12.9259 0.131
NP_440673.1_3 Forward -125 -118 12.4288 0.0426
NP_440673.1_3 Reverse -120 -127 12.4288 0.0426
NP_440865.1_9 Forward -133 -114 -2.26216 0.182
NP_440865.1_9 Forward -391 -372 -9.047 0.273
NP_441052.1_2 Forward -127 -117 10.5014 0.0285
NP_441052.1_2 Reverse -118 -128 10.4031 0.0285
NP_442219.1_9 Forward -126 -117 8.35786 0.0681
NP_442219.1_9 Reverse -119 -128 8.25953 0.0681
NP_440436.1_4 Forward -126 -117 18.1905 0.00233
NP_440436.1_4 Reverse -119 -128 9.24241 0.0871
NP_441884.1_9 Forward -100 -81 -21.83 0.266
NP_441884.1_9 Reverse -115 -134 -22.3217 0.277
NP_441884.1_9 Forward -202 -183 -23.1083 0.284
NP_441884.1_9 Forward -85 -66 -25.3699 0.29
NP_441884.1_9 Reverse -349 -368 -25.9599 0.29
NP_440314.1_9 Reverse -368 -387 -9.73531 0.276
NP_440041.1_6 Forward -223 -204 8.84842 0.285
NP_441719.1_4 Forward -126 -119 16.3621 0.0124
NP_441719.1_4 Reverse -119 -126 16.3621 0.0124
NP_441733.1_10 Forward -130 -117 5.82081 0.203
NP_441004.1_1 Reverse -85 -104 0.196116 0.117
NP_441004.1_1 Reverse -97 -116 -16.4218 0.284
NP_441004.1_1 Forward -376 -357 -17.0118 0.288
NP_441004.1_2 Reverse -80 -99 -1.67217 0.263
NP_442366.1_3 Reverse -117 -135 12.6055 0.0275
NP_442366.1_5 Reverse -211 -221 10.8943 0.228
NP_442139.1_7 Reverse -300 -319 6.98095 0.295
NP_442873.1_2 Forward -131 -112 9.14342 0.28
NP_442873.1_5 Reverse -372 -391 7.27514 0.278
NP_440296.1_10 Reverse -115 -134 -15.2418 0.29
NP_441115.1_4 Forward -128 -110 18.0129 0.0158
NP_441115.1_4 Reverse -117 -135 7.29487 0.291
NP_442206.1_10 Reverse -118 -133 4.30646 0.178
NP_443054.1_2 Forward -129 -115 10.226 0.0761
NP_441966.1_6 Reverse -54 -73 4.81767 0.289
NP_442586.1_6 Reverse -80 -99 17.2074 0.137
NP_441851.1_10 Reverse -117 -127 16.008 0.00552
NP_441851.1_10 Forward -128 -118 8.53483 0.114
NP_441851.1_10 Reverse -89 -99 5.19158 0.221
NP_442208.1_5 Forward -378 -359 -4.72043 0.258
NP_442856.1_7 Forward -136 -117 -2.75381 0.237
NP_442856.1_7 Reverse -358 -377 -6.39206 0.297
NP_441668.1_4 Forward -386 -367 -2.85214 0.297
NP_442515.1_1 Reverse -366 -380 3.24451 0.122
NP_442515.1_1 Forward -128 -114 -3.93365 0.298
NP_442515.1_1 Reverse -369 -383 -4.91696 0.298
NP_441396.1_5 Reverse -83 -92 8.55452 0.21
NP_441396.1_5 Reverse -229 -238 8.35786 0.224
NP_440593.1_3 Reverse -113 -132 -5.99873 0.268
NP_440165.1_5 Reverse -117 -136 1.86774 0.116
NP_442709.1_3 Reverse -111 -130 2.16274 0.296
NP_440940.1_7 Reverse -108 -126 6.21323 0.225
NP_441409.1_6 Reverse -112 -131 -8.45701 0.168
NP_439960.1_10 Reverse -360 -378 11.3272 0.0912
NP_439960.1_10 Forward -134 -116 3.75572 0.163
NP_440726.1_2 Reverse -357 -376 4.62101 0.224
NP_441477.1_10 Reverse -111 -129 2.87075 0.23
NP_440588.1_2 Forward -136 -117 8.45592 0.0455
NP_440588.1_2 Reverse -352 -371 3.04771 0.108
NP_440195.1_4 Reverse -106 -125 5.70265 0.284
NP_442006.1_2 Forward -370 -353 -9.49926 0.197
NP_441570.1_1 Forward -376 -358 -10.5023 0.171
NP_441570.1_1 Reverse -118 -136 -10.5023 0.171
NP_441570.1_1 Forward -127 -109 -16.7954 0.254
NP_440078.1_10 Forward -127 -108 17.109 0.121
NP_441078.1_4 Forward -127 -118 19.6659 0.0007
NP_441078.1_4 Reverse -118 -127 19.6659 0.0007
NP_442729.1_5 Reverse -360 -370 8.33817 0.248
NP_442729.1_8 Reverse -114 -127 8.47575 0.125
NP_442729.1_8 Forward -380 -367 7.6891 0.14
NP_440707.1_6 Forward -135 -116 10.52 0.283
NP_440707.1_7 Reverse -101 -120 7.37428 0.22
NP_440526.1_3 Forward -126 -115 2.41814 0.267
NP_441432.1_8 Forward -128 -119 16.8143 0.00595
NP_441432.1_8 Reverse -117 -126 8.25953 0.0755
NP_442320.1_8 Reverse -112 -126 -0.885388 0.0817
NP_441732.1_2 Forward -131 -115 13.0382 0.00384
NP_441732.1_2 Forward -86 -70 1.43517 0.0402
NP_441732.1_2 Reverse -114 -130 -15.9694 0.164
NP_441732.1_2 Reverse -363 -379 -16.0677 0.164
NP_440497.1_6 Forward -132 -113 -6.29373 0.264
NP_440629.1_6 Forward -133 -114 17.1898 0.0792
NP_442003.1_4 Reverse -219 -238 9.14423 0.3
NP_440760.1_1 Reverse -118 -137 -12.3902 0.0929
NP_440760.1_1 Reverse -367 -386 -15.1435 0.142
NP_440760.1_1 Forward -127 -108 -21.9284 0.246
NP_442797.1_6 Reverse -69 -88 10.3581 0.238
NP_442797.1_6 Reverse -351 -370 8.12808 0.266
NP_442797.1_7 Reverse -360 -378 13.5888 0.119
NP_442797.1_7 Forward -134 -116 0.510803 0.274
NP_440199.1_10 Forward -230 -220 15.418 0.0861
NP_440461.1_3 Forward -365 -346 15.5357 0.212
NP_441945.1_10 Reverse -323 -342 10.0292 0.258
NP_441945.1_10 Forward -377 -358 6.68596 0.297
NP_442353.1_1 Reverse -327 -346 11.1109 0.229
NP_440713.1_4 Reverse -108 -127 4.03102 0.231
NP_442489.1_7 Forward -127 -118 20.1576 0.000695
NP_442489.1_7 Reverse -118 -127 20.1576 0.000695
NP_440565.1_7 Reverse -84 -103 0.0977854 0.249
NP_440559.1_1 Forward -126 -117 8.75118 0.0586
NP_440559.1_1 Reverse -119 -128 8.65285 0.0586
NP_442763.1_8 Reverse -241 -260 7.86593 0.159
NP_441659.2_8 Reverse -118 -128 20.9245 0.000805
NP_441659.2_8 Forward -127 -117 11.9764 0.0147
NP_442913.1_10 Reverse -109 -128 -1.47551 0.171
NP_442913.1_10 Forward -388 -369 -3.3438 0.207
NP_441040.1_2 Forward -149 -130 -14.0619 0.284
NP_439956.1_7 Reverse -112 -131 14.9458 0.14
NP_442008.1_2 Reverse -115 -134 2.75272 0.277
NP_441800.1_7 Forward -297 -279 -2.63579 0.264
NP_442776.1_1 Forward -111 -92 3.24438 0.29
NP_442346.1_5 Forward -128 -118 16.303 0.00248
NP_442346.1_5 Reverse -117 -127 9.02648 0.118
NP_440545.1_3 Reverse -114 -131 17.3451 0.0111
NP_440545.1_3 Forward -131 -114 17.0501 0.0111
NP_441923.1_6 Forward -369 -355 7.9644 0.292
NP_441126.1_6 Reverse -336 -350 13.6618 0.295
NP_440459.1_2 Forward -142 -125 8.00365 0.272
NP_440459.1_7 Reverse -116 -130 17.3641 0.0994
NP_441653.1_2 Reverse -107 -126 5.07576 0.248
NP_440010.1_4 Reverse -357 -376 -1.27961 0.267
NP_440010.1_4 Forward -131 -112 -2.26292 0.279
NP_440010.1_4 Forward -380 -361 -2.36125 0.281
NP_442551.1_4 Reverse -280 -295 -1.88839 0.25
NP_442551.1_4 Reverse -55 -70 -3.06836 0.285
NP_442311.1_8 Forward -91 -72 9.24257 0.278
NP_440847.1_6 Forward -364 -345 17.7974 0.229
NP_441168.1_1 Forward -171 -152 35.3003 0.00000126
NP_441168.1_2 Forward -276 -257 31.6611 0.0000406
NP_441168.1_3 Forward -200 -181 26.9421 0.00285
NP_441168.1_4 Forward -222 -203 21.7297 0.0939
NP_441168.1_5 Forward -297 -278 30.3837 0.0000343
NP_441168.1_6 Forward -255 -236 25.8605 0.0104
NP_441168.1_7 Forward -150 -131 22.2223 0.057
NP_441168.1_8 Forward -360 -341 23.4013 0.0319
NP_441168.1_9 Forward -320 -301 23.4997 0.0127
NP_441168.1_10 Forward -387 -368 31.1704 0.000186
NP_442603.1_7 Forward -127 -113 11.897 0.109
NP_441585.1_5 Forward -89 -70 2.9486 0.256
NP_441585.1_5 Forward -298 -279 0.588665 0.291
NP_441888.1_7 Reverse -113 -127 4.12949 0.225
NP_441888.1_7 Forward -132 -118 3.93283 0.225
NP_441050.1_5 Forward -161 -143 17.7187 0.0358
NP_441050.1_5 Reverse -87 -105 16.7354 0.0486
NP_440449.1_6 Reverse -110 -128 9.03394 0.188
NP_441833.1_4 Forward -126 -119 15.9687 0.0124
NP_441833.1_4 Reverse -119 -126 15.9687 0.0124
NP_442162.1_9 Forward -126 -119 16.2637 0.0124
NP_442162.1_9 Reverse -119 -126 16.2637 0.0124
NP_440671.1_4 Forward -320 -306 10.521 0.155
NP_442199.1_5 Forward -135 -116 1.67108 0.162
NP_442140.1_3 Forward -126 -116 17.4829 0.0159
NP_442140.1_3 Reverse -362 -372 12.9597 0.0632
NP_442140.1_3 Reverse -119 -129 4.69992 0.238
NP_442140.1_3 Forward -369 -359 3.71661 0.283
NP_440875.1_9 Reverse -120 -130 16.5483 0.0145
NP_440875.1_9 Forward -125 -115 15.2829 0.0295
NP_441813.1_5 Forward -129 -119 18.1713 0.00743
NP_441813.1_5 Reverse -116 -126 10.0098 0.0208
NP_440590.1_4 Forward -126 -113 24.012 0.00216
NP_440590.1_4 Reverse -109 -122 4.64084 0.0601
NP_440590.1_4 Reverse -119 -132 4.44418 0.0601
NP_440567.1_1 Reverse -119 -133 7.86607 0.0642
NP_440567.1_1 Forward -126 -112 3.44117 0.143
NP_442497.1_10 Reverse -119 -128 17.601 0.00813
NP_442497.1_10 Forward -126 -117 10.4228 0.0087
NP_440821.1_4 Reverse -116 -126 18.7612 0.00422
NP_440821.1_4 Forward -129 -119 2.24165 0.131
NP_441239.1_9 Reverse -116 -128 16.0669 0.0175
NP_441239.1_9 Forward -129 -117 15.5753 0.0186
NP_441239.1_9 Reverse -216 -228 5.44718 0.221
NP_442691.1_2 Forward -287 -268 6.78429 0.21
NP_440400.1_1 Forward -298 -279 -1.18128 0.285
NP_441892.1_1 Forward -136 -119 -3.69774 0.247
NP_441892.1_1 Reverse -109 -126 -5.07437 0.273
NP_440665.1_1 Reverse -355 -374 6.29264 0.107
NP_440665.1_1 Reverse -73 -92 -16.0285 0.277
NP_440665.1_1 Forward -376 -357 -16.1268 0.28
NP_440665.1_2 Forward -74 -55 -4.72043 0.246
NP_442044.1_1 Forward -132 -113 -2.0655 0.176
NP_442044.1_9 Forward -127 -108 1.76941 0.287
NP_442643.1_1 Reverse -84 -103 -13.0786 0.293
NP_442138.1_10 Reverse -118 -137 -2.95047 0.223
NP_440551.1_5 Reverse -58 -77 8.25926 0.255
NP_440546.1_4 Reverse -118 -128 13.5365 0.0459
NP_440546.1_4 Forward -127 -117 11.8882 0.0679
NP_440546.1_6 Reverse -108 -127 10.6192 0.245
NP_440546.1_6 Reverse -334 -353 6.58763 0.297
NP_441230.1_2 Reverse -100 -119 17.994 0.151
NP_441230.1_5 Reverse -113 -132 5.40766 0.182
NP_440675.1_3 Reverse -352 -371 6.78429 0.261
NP_440462.1_6 Forward -129 -119 18.7612 0.00454
NP_440462.1_6 Reverse -116 -126 17.9746 0.00578
NP_442899.1_4 Forward -361 -345 7.43266 0.232
NP_442611.1_1 Forward -132 -113 13.6675 0.069
NP_442611.1_1 Reverse -118 -137 13.2741 0.07
NP_440705.1_4 Reverse -87 -106 6.78429 0.296
NP_440868.1_4 Reverse -114 -126 12.527 0.0235
NP_440868.1_4 Forward -131 -119 8.00379 0.0602
NP_440401.1_9 Forward -108 -101 12.6251 0.287
NP_442499.1_1 Forward -132 -113 5.40766 0.225
NP_442499.1_3 Reverse -366 -384 6.70565 0.282
NP_441249.1_8 Reverse -90 -109 13.7658 0.146
NP_441868.1_4 Reverse -83 -97 14.7492 0.282
NP_441474.1_1 Forward -109 -90 6.68515 0.212
NP_441474.1_1 Reverse -153 -172 1.27698 0.247
NP_442402.1_2 Forward -351 -337 11.1104 0.288
NP_442402.1_4 Forward -356 -337 -2.55791 0.2
NP_441084.1_6 Forward -129 -115 11.768 0.188
NP_440696.1_3 Reverse -214 -232 8.67227 0.15
NP_440696.1_3 Forward -127 -109 0.314141 0.233
NP_440696.1_3 Reverse -114 -132 -2.73412 0.279
NP_440843.1_8 Reverse -85 -104 13.9625 0.297
NP_442039.1_4 Forward -126 -119 15.1821 0.0124
NP_442039.1_4 Reverse -119 -126 15.1821 0.0124
NP_442039.1_7 Forward -29 -19 10.3048 0.257
NP_441811.1_8 Reverse -112 -126 8.25939 0.238
NP_442837.1_3 Forward -126 -119 15.7721 0.0124
NP_442837.1_3 Reverse -119 -126 15.7721 0.0124
NP_442053.1_1 Forward -127 -118 18.3876 0.0007
NP_442053.1_1 Reverse -118 -127 18.3876 0.0007
NP_440505.1_3 Forward -129 -119 17.188 0.00332
NP_440505.1_3 Reverse -116 -126 14.1397 0.0235
NP_440505.1_3 Reverse -254 -264 10.5998 0.102
NP_440505.1_7 Forward -71 -52 -0.39387 0.271
NP_441701.1_3 Reverse -81 -98 7.41366 0.261
NP_441252.1_6 Reverse -337 -344 11.6422 0.288
NP_441203.1_1 Reverse -119 -138 -3.54046 0.0699
NP_441203.1_1 Reverse -306 -325 -20.5517 0.297
NP_441584.1_8 Reverse -336 -355 14.5524 0.243
NP_442532.1_7 Forward -127 -113 7.86607 0.171
NP_440914.1_1 Reverse -118 -128 16.3248 0.00196
NP_440914.1_1 Forward -127 -117 8.6151 0.186
NP_441011.1_8 Forward -126 -117 16.9127 0.00602
NP_441011.1_8 Reverse -119 -128 16.6177 0.00602
NP_442533.1_1 Reverse -87 -106 -14.7502 0.247
NP_442533.1_1 Reverse -85 -104 -15.1435 0.252
NP_442533.1_6 Forward -127 -118 17.2076 0.00137
NP_442533.1_6 Reverse -118 -127 17.2076 0.00137
NP_442533.1_6 Forward -376 -367 2.65466 0.246
NP_442232.1_3 Reverse -100 -119 -3.83545 0.163
NP_442232.1_3 Reverse -127 -146 -6.78538 0.191
NP_442232.1_3 Reverse -86 -105 -14.4552 0.288
NP_442232.1_3 Forward -135 -116 -15.8318 0.296
NP_442322.1_4 Forward -107 -90 -1.33848 0.226
NP_442322.1_4 Forward -108 -91 -7.72996 0.286
NP_441482.1_7 Forward -133 -119 16.3225 0.00702
NP_441482.1_7 Reverse -112 -126 -8.26021 0.193
NP_441482.1_7 Forward -320 -306 -11.2101 0.245
NP_441482.1_7 Forward -252 -238 -11.4068 0.262
NP_441482.1_9 Forward -215 -202 15.6533 0.278
NP_439944.1_9 Forward -126 -116 10.4031 0.0887
NP_439944.1_9 Reverse -119 -129 9.12481 0.1
NP_441028.1_6 Reverse -319 -329 3.51951 0.292
NP_440115.1_6 Forward -130 -120 14.0414 0.0615
NP_440115.1_6 Reverse -115 -125 9.61647 0.115
NP_440007.1_9 Forward -131 -117 2.06454 0.281
NP_439965.1_1 Forward -246 -227 -9.047 0.284
NP_441680.1_4 Forward -98 -79 2.26107 0.246
NP_441602.1_3 Reverse -113 -132 5.30933 0.142
NP_441602.1_3 Forward -132 -113 2.16274 0.202
NP_441106.1_1 Forward -128 -119 18.486 0.0028
NP_441106.1_1 Reverse -117 -126 18.191 0.0028
NP_440429.1_2 Forward -132 -113 7.96426 0.277
NP_442928.1_3 Forward -134 -115 12.9997 0.256
NP_442306.1_10 Forward -132 -113 -19.0768 0.197
NP_442306.1_10 Reverse -140 -159 -20.945 0.237
NP_441286.1_1 Forward -128 -116 5.34885 0.0259
NP_441286.1_1 Reverse -117 -129 -3.59927 0.145
NP_440670.1_8 Forward -127 -118 18.3876 0.000699
NP_440670.1_8 Reverse -118 -127 18.3876 0.000699
NP_440670.1_8 Forward -117 -108 7.27622 0.0797
NP_440886.1_7 Reverse -117 -127 17.7774 0.0011
NP_440886.1_7 Forward -374 -364 10.6976 0.0805
NP_440886.1_7 Forward -128 -118 8.04271 0.0805
NP_440886.1_7 Forward -238 -228 6.27276 0.134
NP_440886.1_7 Forward -92 -82 3.71617 0.267
NP_442614.1_2 Reverse -237 -251 8.94771 0.242
NP_442382.1_7 Forward -240 -221 7.17762 0.229
NP_442072.1_9 Forward -128 -110 4.05072 0.0248
NP_441753.1_10 Reverse -209 -228 1.86774 0.252
NP_441808.1_8 Reverse -106 -125 11.2092 0.222
NP_440907.2_8 Forward -126 -116 17.4824 0.00685
NP_440907.2_8 Reverse -119 -129 9.616 0.103
NP_440907.2_8 Forward -98 -88 7.15773 0.127
NP_442264.1_2 Forward -380 -363 8.39697 0.216
NP_442264.1_2 Reverse -108 -125 7.11867 0.247
NP_441021.1_1 Reverse -119 -138 -5.99873 0.177
NP_441021.1_4 Reverse -373 -392 10.3242 0.269
NP_441463.1_3 Reverse -108 -127 -8.06369 0.264
NP_441463.1_3 Reverse -12 -31 -9.047 0.276
NP_441626.1_2 Forward -126 -119 15.7721 0.0124
NP_441626.1_2 Reverse -119 -126 15.7721 0.0124
NP_442365.1_7 Forward -121 -102 -1.7705 0.196
NP_442365.1_7 Forward -131 -112 -4.72043 0.25
NP_440107.1_5 Reverse -354 -373 -7.4737 0.295
NP_442794.1_1 Forward -131 -119 10.5604 0.0721
NP_442794.1_5 Reverse -115 -129 12.1926 0.275
NP_442615.1_1 Forward -136 -118 1.88744 0.0783
NP_442615.1_1 Reverse -109 -127 -2.73412 0.148
NP_441962.1_4 Reverse -362 -381 0.196116 0.117
NP_441962.1_4 Forward -132 -113 -7.86702 0.195
NP_441962.1_4 Forward -375 -356 -9.14533 0.213
NP_440387.1_1 Reverse -118 -134 15.5948 0.00527
NP_440387.1_1 Forward -127 -111 14.5132 0.00649
NP_440387.1_1 Reverse -367 -383 1.63183 0.0994
NP_440855.1_1 Forward -376 -357 2.16274 0.212
NP_441431.1_2 Forward -130 -116 13.1753 0.0952
NP_441431.1_2 Reverse -115 -129 11.1104 0.146
NP_441431.1_2 Forward -373 -359 5.89884 0.284
NP_441488.1_7 Forward -133 -114 15.6341 0.0543
NP_441488.1_8 Forward -132 -118 9.04542 0.169
NP_441836.1_2 Reverse -112 -131 -0.787193 0.214
NP_441836.1_6 Reverse -111 -130 15.2408 0.298
NP_441193.1_1 Forward -355 -336 11.405 0.229
NP_441993.1_1 Reverse -118 -137 1.65431 0.273
NP_441174.1_2 Forward -130 -116 19.8624 0.00567
NP_442352.1_1 Forward -376 -363 14.6825 0.251
NP_442323.1_7 Forward -132 -113 5.30853 0.207
NP_440287.1_6 Reverse -109 -128 7.07928 0.16
NP_440293.1_3 Reverse -95 -114 -2.36049 0.241
NP_440766.1_4 Forward -231 -217 10.521 0.0871
NP_440766.1_4 Reverse -114 -128 8.06273 0.0871
NP_440766.1_4 Forward -131 -117 7.76774 0.0871
NP_440766.1_4 Reverse -104 -118 0.88457 0.263
NP_439988.1_4 Forward -134 -115 17.2074 0.126
NP_442743.1_1 Forward -351 -332 8.16011 0.264
NP_441311.1_2 Forward -133 -119 12.192 0.236
NP_441531.1_6 Reverse -358 -371 10.344 0.254
NP_439910.1_2 Reverse -110 -127 -3.79607 0.0691
NP_440457.1_1 Reverse -86 -98 8.00379 0.101
NP_440457.1_1 Forward -131 -119 7.70879 0.101
NP_440457.1_1 Reverse -114 -126 7.21714 0.105
NP_440798.1_6 Forward -126 -113 3.65753 0.15
NP_440142.1_9 Forward -218 -204 13.2736 0.284
NP_442509.1_9 Forward -127 -117 16.2041 0.00739
NP_442509.1_9 Reverse -118 -128 8.04271 0.192
NP_441253.1_1 Forward -391 -372 4.916 0.271
NP_440554.1_4 Reverse -119 -129 17.9746 0.0131
NP_440554.1_4 Forward -126 -116 13.943 0.0218
NP_441885.1_5 Forward -127 -117 11.4848 0.00668
NP_441885.1_5 Reverse -118 -128 11.3864 0.00668
NP_440478.1_10 Reverse -116 -130 14.5526 0.107
NP_442341.1_7 Forward -128 -114 13.1759 0.0376
NP_442341.1_7 Reverse -117 -131 1.67122 0.282
NP_441756.1_5 Reverse -114 -133 13.4708 0.0932
NP_441173.1_9 Forward -345 -337 12.507 0.206
NP_441173.1_9 Forward -95 -87 10.1471 0.261
NP_442395.2_4 Reverse -117 -136 13.0766 0.0711
NP_442395.2_4 Forward -145 -126 4.52188 0.182
NP_443000.1_7 Forward -129 -119 20.3345 0.00223
NP_443000.1_7 Reverse -116 -126 2.04498 0.226
NP_440507.2_1 Reverse -182 -201 18.3873 0.151
NP_440507.2_1 Forward -71 -52 17.5024 0.151
NP_441842.1_1 Forward -115 -102 11.1301 0.267
NP_441842.1_7 Forward -354 -335 14.1583 0.195
NP_440275.1_3 Reverse -116 -126 17.9746 0.0082
NP_440275.1_3 Forward -129 -119 16.1063 0.0155
NP_440091.1_1 Reverse -114 -126 10.1671 0.0498
NP_442354.1_7 Reverse -364 -383 18.9773 0.0465
NP_441902.1_3 Reverse -337 -347 11.524 0.298
NP_441122.1_1 Reverse -18 -33 4.20813 0.28
NP_439962.1_4 Forward -135 -116 8.84924 0.134
NP_439962.1_4 Forward -378 -359 -5.50708 0.28
NP_439962.1_4 Forward -393 -374 -8.85033 0.298
NP_440175.1_7 Reverse -114 -132 12.0957 0.228
NP_442495.1_4 Reverse -122 -132 14.4347 0.16
NP_441105.1_3 Forward -138 -119 11.7008 0.0363
NP_442373.1_1 Forward -75 -56 -2.26216 0.185
NP_442373.1_2 Reverse -112 -131 -7.08038 0.233
NP_440216.1_1 Reverse -118 -132 7.27608 0.00942
NP_440216.1_1 Forward -127 -113 -1.18038 0.0301
NP_440216.1_9 Forward -188 -179 6.09625 0.289
NP_440172.1_1 Reverse -118 -128 17.5813 0.00421
NP_440172.1_1 Forward -127 -117 8.73149 0.0586
NP_442015.1_10 Forward -131 -118 13.4906 0.0354
NP_442015.1_10 Reverse -114 -127 12.9006 0.0365
NP_441226.1_7 Forward -126 -119 14.4934 0.0123
NP_441226.1_7 Reverse -119 -126 14.4934 0.0123
NP_441111.1_7 Forward -126 -118 18.7023 0.00294
NP_441111.1_7 Reverse -119 -127 18.7023 0.00294
NP_442379.1_9 Reverse -90 -104 17.8958 0.221
NP_441766.1_2 Forward -127 -118 17.5026 0.00297
NP_441766.1_2 Reverse -118 -127 17.5026 0.00297
NP_442417.1_5 Reverse -118 -132 6.98109 0.197
NP_442252.1_4 Reverse -85 -104 16.0274 0.225
NP_440416.1_9 Forward -134 -115 4.32602 0.0355
NP_440416.1_9 Reverse -101 -120 -17.1101 0.231
NP_443052.1_8 Reverse -108 -127 4.71934 0.0418
NP_443052.1_9 Forward -98 -79 -5.50708 0.271
NP_442154.1_1 Reverse -80 -98 -15.6155 0.222
NP_440261.1_5 Forward -126 -113 4.93583 0.0478
NP_440261.1_5 Reverse -119 -132 -2.73398 0.0924
NP_440988.1_10 Forward -381 -367 4.80201 0.25
NP_440988.1_10 Reverse -365 -379 3.64026 0.285
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGGCAAATCCGACGAAGAGATTGTGGCGGCCACCATGGCGGAGATCAAGCAACTCTTTCCCCAACACTTCAACGGGGATAATCCAGCCCGACTGCTTAAATCCCACGTGGTCAAAACCCCCCGCTCAGTCTACAAAGCTACCCCCGGAAGGCAGGCTTGTCGCCCCGATCAACGGACATCGGTGCCCAACTTTTACCTAGCAGGGGACTTCACCATGCAAAAATACTTGGGCAGTATGGAAGGGGCGGTGCTTTCCGGCAAACAATGCGCCCAGGCGATCGCCGCCGATTTCAACCCCCAAACCGTTCCCCCCACCAGGGAAATAGTCACCGTGGGTTAAGCCGCCTGGACTCCCTGGTAATCTTCCTGACAAATGGCAACCCTAATGCGACAATGCTAA

CDS

ATGGCTAACGGTCAAATTTCTCCCCAGCGTGCAGTTACCAAACCCCAATCCTGGTGGCTGACTTCCGAACCCCGTCCGTCCTTAATGTTACAACTGCCCAAACCGTCTCCATCTGCAAAGCCCTGTGCTTCTGTTGAGGAAGCTTACGAAATTTGTCGTCAAGTAACGGCCCAGTACGCAAAAACTTTTTACCTGGGAACTTTGCTGATGCCCCCTGCCAAAAGGAGGGCCATTTGGGCGATCTATCTTTGGTGTCGTAGGACTGATGAACTAGTGGATGGGCCCCAGGCGGCCACCACCACCCCGGAAACTTTGGACCATTGGGAGCGGCGTTTAGAAGGGATTTTTGCTGGCCAACCCCAGGACGATGCCGATGTGGCCCTGGTGGATACCTTGGAAACATTTCCGCTCGATATTCAGCCCTTTCGGGACATGATAGCCGGTCAGCGGATGGACCTTTACCGTTCCCGTTACCAAACCTTTGAAGAACTAGACTTGTACTGTTATCGAGTGGCGGGCACCGTCGGTCTGATGTCCAGTGCTGTGTTGGGAGTCGATACGGGCAATGGCCAGGCCCCTTGGCAACCCGATGCCGTGTACATTCCCCAGGAAGAGGCGATCGCCTTGGGGGTGGCGAACCAATTGACCAATATTCTGCGGGACGTTGGGGAAGACGTGGAGCGGGGTCGAATTTATTTACCCCTGGAAGATTTAGAACGATTTAATTACAGCGAACAGGATTTACTCAATGGGGTAAACGATGATCGTTGGCGCAGTTTAATGAAGTTTGAAATTGACCGGGCCCGCCATTATTTTGAAGATGCGGAACGGGGTATTCGGGCTTTAAATCGGGATGCCCGTTGGCCGGTGTGGACAGCGTTGATGTTGTACAAAGGCATTTTGGATGTGATTGAGGCCAATAATTACAATGTGTTTAATCGTCGTGCCTATGTACCCACTCCGAAGAAATTACTATATTTACCCGTGGCCTGGTTGCGGGCCCAGGTGCTTTAA

Protein

MANGQISPQRAVTKPQSWWLTSEPRPSLMLQLPKPSPSAKPCASVEEAYEICRQVTAQYAKTFYLGTLLMPPAKRRAIWAIYLWCRRTDELVDGPQAATTTPETLDHWERRLEGIFAGQPQDDADVALVDTLETFPLDIQPFRDMIAGQRMDLYRSRYQTFEELDLYCYRVAGTVGLMSSAVLGVDTGNGQAPWQPDAVYIPQEEAIALGVANQLTNILRDVGEDVERGRIYLPLEDLERFNYSEQDLLNGVNDDRWRSLMKFEIDRARHYFEDAERGIRALNRDARWPVWTALMLYKGILDVIEANNYNVFNRRAYVPTPKKLLYLPVAWLRAQVL