Your browser is old and dusty. Try Google Chrome!

Details for slr1253

ORF slr1253
Accession NP_441166.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -212 -198 1.67122 0.183
NP_440557.1_1 Forward -59 -40 1.47442 0.256
NP_440897.1_6 Forward -207 -188 -4.1312 0.267
NP_442151.1_4 Reverse -257 -276 20.649 0.206
NP_442151.1_6 Forward -249 -235 6.09611 0.248
NP_442182.1_3 Forward -293 -274 3.53937 0.264
NP_440259.1_4 Reverse -380 -394 9.79275 0.278
NP_440996.1_2 Reverse -122 -131 14.8477 0.248
NP_443002.1_5 Forward -293 -275 8.47483 0.297
NP_442752.1_4 Forward -261 -254 9.47889 0.109
NP_441934.1_9 Reverse -202 -221 12.2908 0.268
NP_441054.1_2 Forward -237 -218 16.2241 0.136
NP_442062.1_8 Forward -334 -324 3.12662 0.285
NP_441802.1_1 Reverse -30 -49 12.9791 0.175
NP_441802.1_1 Forward -387 -368 4.32602 0.296
NP_440304.1_4 Reverse -323 -333 7.15819 0.129
NP_441035.1_3 Reverse -124 -143 4.12936 0.227
NP_441581.1_6 Forward -299 -280 12.1042 0.283
NP_439918.1_2 Reverse -273 -292 -4.72043 0.283
NP_441200.1_4 Reverse -28 -47 6.58763 0.272
NP_441619.1_8 Forward -267 -253 8.94708 0.237
NP_441208.1_9 Forward -222 -208 8.84938 0.219
NP_441594.1_6 Forward -297 -278 -0.197208 0.298
NP_441083.1_5 Forward -234 -224 1.94665 0.197
NP_442827.1_8 Forward -242 -223 -2.75457 0.288
NP_442889.1_8 Forward -111 -97 5.40719 0.227
NP_440178.1_7 Reverse -324 -343 -21.7317 0.237
NP_441327.1_5 Reverse -120 -129 16.6177 0.111
NP_441163.1_1 Reverse -203 -220 14.6894 0.174
NP_441163.1_1 Reverse -317 -334 11.6411 0.183
NP_440747.1_10 Forward -33 -21 -12.0557 0.199
NP_441695.1_8 Reverse -217 -231 13.7659 0.22
NP_441012.1_4 Forward -96 -83 9.75405 0.272
NP_441012.1_4 Reverse -85 -98 6.31247 0.282
NP_440376.1_1 Forward -334 -325 3.63797 0.2
NP_443065.1_7 Forward -41 -22 16.1249 0.276
NP_441077.1_6 Forward -173 -157 8.00784 0.216
NP_441422.1_7 Forward -305 -288 -4.38605 0.243
NP_442658.1_1 Reverse -323 -333 9.02601 0.169
NP_441855.2_4 Reverse -15 -34 13.0901 0.173
NP_442782.1_2 Reverse -268 -282 7.47274 0.202
NP_439968.1_8 Forward -328 -312 15.4965 0.184
NP_443061.1_10 Forward -296 -277 14.3558 0.275
NP_441256.1_1 Forward -101 -82 -7.86702 0.239
NP_442937.1_5 Forward -191 -172 7.27595 0.258
NP_442937.1_5 Forward -225 -206 6.19431 0.286
NP_440318.1_1 Forward -300 -281 5.60432 0.218
NP_440203.1_5 Forward -331 -321 10.206 0.235
NP_440203.1_5 Reverse -249 -259 9.12434 0.271
NP_441162.1_3 Forward -27 -8 10.5209 0.211
NP_442376.1_2 Reverse -18 -37 -3.54046 0.202
NP_442690.1_1 Forward -132 -113 -17.3068 0.299
NP_442536.1_4 Reverse -31 -49 8.18062 0.299
NP_442536.1_7 Reverse -273 -292 12.3892 0.273
NP_440827.1_3 Reverse -314 -333 12.2908 0.259
NP_442002.1_1 Forward -269 -251 -9.22396 0.274
NP_442002.1_9 Reverse -324 -331 12.4288 0.185
NP_442438.1_10 Forward -318 -304 2.85119 0.168
NP_442438.1_10 Reverse -32 -46 2.85119 0.168
NP_442431.1_10 Reverse -279 -297 3.26407 0.22
NP_440147.1_4 Forward -48 -35 4.8375 0.146
NP_441550.1_8 Forward -236 -226 8.82935 0.112
NP_441550.1_8 Reverse -223 -233 7.35439 0.164
NP_441041.1_7 Forward -306 -294 5.08534 0.278
NP_442004.1_6 Forward -32 -18 5.80112 0.181
NP_442004.1_6 Forward -334 -320 1.37622 0.29
NP_441725.1_5 Forward -333 -323 9.7148 0.0503
NP_439966.1_7 Reverse -250 -260 5.87944 0.204
NP_439966.1_7 Forward -34 -24 4.10949 0.289
NP_439966.1_9 Forward -336 -327 4.52295 0.253
NP_439966.1_9 Forward -186 -177 3.7363 0.253
NP_442941.1_3 Forward -333 -323 -0.708283 0.267
NP_440674.1_3 Reverse -279 -298 2.65439 0.26
NP_440289.1_2 Forward -337 -324 -4.79893 0.294
NP_442281.1_8 Forward -399 -380 17.9764 0.275
NP_442500.1_8 Forward -389 -375 9.88916 0.272
NP_442500.1_9 Reverse -43 -62 13.6675 0.275
NP_441644.1_6 Forward -207 -197 5.38779 0.194
NP_441644.1_6 Forward -98 -88 4.40448 0.239
NP_442215.1_2 Forward -315 -299 4.0901 0.0879
NP_442215.1_2 Forward -215 -199 -4.85801 0.24
NP_442215.1_2 Forward -290 -274 -6.7263 0.278
NP_442029.1_1 Reverse -87 -106 -12.4886 0.247
NP_440253.1_2 Reverse -325 -343 1.69077 0.155
NP_440566.1_2 Forward -275 -256 6.68596 0.265
NP_441346.1_4 Reverse -224 -243 12.2908 0.268
NP_441751.2_8 Forward -212 -198 -4.03198 0.158
NP_441751.2_8 Forward -333 -319 -4.62196 0.176
NP_442554.1_8 Forward -97 -87 5.09324 0.161
NP_442075.1_5 Reverse -14 -33 21.4122 0.0457
NP_441762.1_7 Reverse -324 -336 -6.05754 0.268
NP_442142.1_4 Reverse -86 -99 4.64028 0.214
NP_443009.1_5 Reverse -324 -335 9.59626 0.0939
NP_443009.1_5 Reverse -174 -185 3.49977 0.292
NP_442301.1_2 Forward -320 -301 3.24359 0.299
NP_441448.1_1 Reverse -286 -305 8.06259 0.21
NP_441198.1_8 Reverse -323 -333 13.2713 0.108
NP_441758.1_10 Reverse -102 -121 -0.984623 0.265
NP_441468.1_9 Forward -96 -82 16.3225 0.282
NP_441015.1_10 Reverse -277 -296 -8.94866 0.278
NP_441876.1_9 Reverse -133 -143 12.2709 0.267
NP_441330.1_1 Reverse -193 -212 -5.80207 0.131
NP_442868.1_6 Reverse -323 -333 3.02829 0.205
NP_441251.1_7 Forward -52 -39 13.7856 0.266
NP_442808.1_1 Forward -335 -325 6.96107 0.0921
NP_442808.1_1 Forward -33 -23 2.73286 0.256
NP_441101.1_4 Forward -132 -113 11.7992 0.153
NP_440031.1_10 Forward -359 -340 0.786102 0.274
NP_441906.1_5 Reverse -246 -265 10.4217 0.246
NP_442050.1_5 Reverse -323 -333 10.4026 0.15
NP_442789.1_4 Reverse -277 -296 -5.01543 0.265
NP_442789.1_4 Reverse -289 -308 -5.31042 0.269
NP_442066.2_4 Forward -300 -281 -2.85214 0.215
NP_442830.1_5 Forward -335 -321 5.60385 0.232
NP_442397.1_9 Forward -340 -321 3.73603 0.264
NP_442594.1_8 Reverse -87 -106 5.60432 0.244
NP_440136.1_2 Forward -333 -326 11.1505 0.0519
NP_442590.1_9 Reverse -16 -35 5.80098 0.267
NP_442998.1_2 Forward -293 -274 8.65176 0.216
NP_440899.1_3 Forward -278 -259 18.3873 0.0788
NP_440899.1_8 Forward -53 -34 -9.44032 0.262
NP_440299.1_1 Forward -217 -204 7.00021 0.124
NP_441799.1_1 Reverse -321 -335 3.93223 0.274
NP_442333.2_5 Reverse -314 -333 -15.3402 0.291
NP_440256.1_1 Reverse -86 -105 -4.22878 0.15
NP_440256.1_1 Reverse -214 -233 -8.752 0.266
NP_441957.1_1 Reverse -317 -336 6.19431 0.247
NP_441559.1_8 Forward -338 -324 3.04785 0.143
NP_441559.1_8 Reverse -320 -334 -6.19526 0.275
NP_441559.1_8 Forward -188 -174 -6.39192 0.277
NP_441270.1_4 Forward -285 -266 14.5516 0.251
NP_441179.1_9 Forward -100 -90 17.7774 0.212
NP_442866.1_9 Reverse -169 -188 12.4875 0.128
NP_442993.1_1 Forward -226 -210 -11.2495 0.24
NP_442386.1_3 Forward -155 -136 11.7992 0.279
NP_442386.1_9 Forward -335 -326 6.58748 0.219
NP_441947.1_10 Forward -336 -318 1.69077 0.276
NP_440161.1_3 Forward -336 -317 8.06259 0.278
NP_441027.1_1 Forward -135 -121 12.192 0.27
NP_440586.1_8 Reverse -90 -97 5.8403 0.283
NP_440586.1_9 Forward -37 -18 5.211 0.288
NP_440586.1_9 Reverse -287 -306 5.211 0.288
NP_442959.1_5 Reverse -371 -390 7.37428 0.235
NP_443051.1_5 Forward -392 -373 10.8159 0.228
NP_439937.1_9 Forward -335 -318 -12.1548 0.27
NP_441595.1_2 Forward -200 -187 16.0089 0.277
NP_440836.1_6 Forward -46 -32 11.2093 0.227
NP_441740.2_10 Forward -334 -315 11.5042 0.286
NP_440439.1_1 Forward -337 -324 1.10092 0.162
NP_440271.1_2 Reverse -316 -335 5.89931 0.23
NP_440271.1_2 Reverse -80 -99 0.884433 0.284
NP_440819.1_5 Reverse -120 -128 7.68924 0.266
NP_441293.1_6 Reverse -180 -199 14.4666 0.159
NP_441803.1_2 Reverse -316 -335 -1.08219 0.294
NP_440267.1_2 Reverse -247 -261 7.17714 0.207
NP_442887.1_5 Forward -106 -87 -11.2103 0.264
NP_442114.1_8 Forward -392 -378 3.73557 0.281
NP_441018.1_7 Forward -224 -205 8.55425 0.242
NP_440163.1_10 Reverse -86 -96 8.82982 0.26
NP_442165.1_1 Forward -187 -168 14.0599 0.292
NP_440075.1_2 Reverse -275 -294 3.93269 0.292
NP_440531.1_6 Forward -34 -15 -5.01543 0.291
NP_442693.1_7 Reverse -277 -296 7.37428 0.282
NP_440297.1_9 Forward -333 -323 6.76487 0.17
NP_440297.1_9 Forward -97 -87 -0.511621 0.289
NP_440937.1_5 Forward -190 -171 9.14423 0.275
NP_440999.1_9 Forward -292 -278 2.45787 0.149
NP_440491.1_1 Forward -316 -297 8.86616 0.226
NP_442225.1_10 Forward -42 -23 12.88 0.197
NP_442033.1_10 Forward -293 -274 -7.67036 0.186
NP_440982.1_1 Reverse -252 -271 4.32522 0.294
NP_441469.1_4 Reverse -18 -37 11.3075 0.249
NP_441469.1_8 Reverse -324 -333 10.6195 0.206
NP_443064.1_3 Reverse -255 -274 11.0125 0.159
NP_440071.1_1 Forward -295 -278 8.88789 0.274
NP_441621.1_7 Reverse -280 -294 -5.01529 0.248
NP_440936.1_10 Reverse -364 -383 -3.29489 0.241
NP_442204.1_1 Reverse -85 -96 0.648657 0.281
NP_440504.1_5 Reverse -41 -59 9.36059 0.162
NP_440255.1_8 Reverse -37 -56 12.8799 0.298
NP_440454.1_1 Reverse -371 -390 8.15482 0.291
NP_440516.1_8 Reverse -325 -334 -0.590259 0.283
NP_441052.1_2 Reverse -240 -250 2.14332 0.216
NP_441884.1_8 Forward -47 -28 -10.1286 0.268
NP_441719.1_2 Forward -127 -113 14.5017 0.278
NP_441733.1_10 Reverse -20 -33 12.5073 0.106
NP_442813.1_2 Forward -140 -121 5.50599 0.191
NP_442873.1_3 Reverse -251 -270 3.24359 0.29
NP_441115.1_4 Reverse -88 -106 13.293 0.0827
NP_442694.1_4 Forward -256 -247 12.8811 0.239
NP_442694.1_4 Forward -165 -156 11.9961 0.275
NP_442694.1_9 Reverse -167 -186 7.66927 0.296
NP_442854.1_6 Reverse -268 -287 1.37609 0.279
NP_443054.1_2 Reverse -216 -230 0.687908 0.256
NP_441966.1_7 Reverse -315 -334 2.26028 0.197
NP_442939.1_3 Forward -380 -366 15.1948 0.287
NP_442622.1_1 Reverse -252 -271 -5.60541 0.257
NP_441982.1_6 Reverse -152 -161 14.9681 0.274
NP_440940.1_7 Reverse -315 -333 9.16315 0.166
NP_441349.1_10 Forward -40 -21 -5.31042 0.198
NP_441349.1_10 Reverse -268 -287 -9.93197 0.3
NP_440389.1_3 Forward -325 -306 11.7992 0.294
NP_442843.1_1 Reverse -289 -308 -8.16202 0.254
NP_439960.1_2 Forward -365 -346 13.7658 0.215
NP_439960.1_10 Forward -37 -19 -4.20908 0.292
NP_440431.1_4 Forward -392 -373 2.53011 0.121
NP_440431.1_4 Forward -387 -368 -3.77235 0.224
NP_440431.1_4 Forward -390 -371 -5.87318 0.248
NP_440431.1_7 Reverse -371 -390 -0.39387 0.258
NP_442450.1_5 Reverse -323 -333 7.84651 0.13
NP_441078.1_4 Reverse -325 -334 -1.86856 0.272
NP_442729.1_7 Forward -48 -30 14.7688 0.183
NP_442348.1_2 Forward -166 -157 7.17789 0.285
NP_442348.1_2 Forward -256 -247 6.78456 0.299
NP_440497.1_6 Reverse -84 -103 -2.55715 0.264
NP_442797.1_6 Forward -217 -198 18.7934 0.17
NP_442797.1_6 Forward -224 -205 8.61286 0.265
NP_440131.1_4 Reverse -261 -280 3.24438 0.298
NP_442353.1_4 Forward -293 -274 3.34192 0.219
NP_442353.1_7 Reverse -14 -33 10.5209 0.176
NP_440713.1_4 Reverse -315 -334 1.37609 0.287
NP_440713.1_4 Forward -328 -309 0.884433 0.3
NP_442489.1_7 Forward -334 -325 -1.96689 0.28
NP_440565.1_7 Reverse -17 -36 1.47442 0.246
NP_441659.2_8 Forward -277 -267 1.35667 0.242
NP_441040.1_2 Forward -251 -232 -14.3569 0.285
NP_441800.1_3 Reverse -274 -292 5.82068 0.286
NP_442346.1_5 Reverse -88 -98 12.4681 0.0421
NP_440352.1_5 Forward -148 -129 10.3196 0.278
NP_441629.1_3 Forward -284 -265 17.7965 0.0434
NP_441629.1_3 Forward -220 -201 2.45694 0.218
NP_441585.1_5 Reverse -237 -256 -0.00131823 0.291
NP_441948.1_4 Reverse -318 -336 7.88563 0.0623
NP_441948.1_4 Forward -39 -21 -3.71743 0.203
NP_441329.1_6 Reverse -109 -128 1.09773 0.244
NP_441329.1_6 Forward -392 -373 -1.09858 0.289
NP_441609.1_5 Forward -54 -35 7.86593 0.299
NP_441671.1_10 Reverse -318 -337 1.27776 0.273
NP_442497.1_10 Forward -333 -324 0.29472 0.199
NP_440821.1_4 Forward -336 -326 3.71661 0.131
NP_440821.1_4 Reverse -323 -333 0.275027 0.19
NP_441239.1_9 Forward -336 -324 3.67722 0.279
NP_441239.1_9 Reverse -35 -47 3.08724 0.296
NP_441951.1_9 Forward -25 -6 0.687771 0.258
NP_442568.1_8 Forward -390 -376 12.3893 0.257
NP_441892.1_1 Reverse -18 -35 -3.79607 0.249
NP_441892.1_1 Forward -107 -90 -4.28772 0.258
NP_440665.1_1 Reverse -253 -272 -14.6519 0.262
NP_442193.1_1 Reverse -267 -285 8.37728 0.272
NP_440740.1_8 Reverse -236 -255 13.2677 0.261
NP_440833.1_6 Reverse -35 -49 7.3738 0.278
NP_442138.1_5 Reverse -209 -228 11.1109 0.276
NP_442138.1_10 Reverse -342 -361 -7.4737 0.29
NP_440546.1_4 Reverse -89 -99 9.27034 0.146
NP_440462.1_6 Forward -336 -326 2.83163 0.272
NP_442340.1_3 Forward -44 -25 -7.27704 0.23
NP_440868.1_4 Forward -338 -326 -0.256015 0.255
NP_442479.1_9 Forward -195 -176 -11.6036 0.275
NP_441084.1_6 Reverse -87 -101 9.34412 0.287
NP_442460.1_2 Reverse -294 -313 6.19431 0.297
NP_440696.1_6 Reverse -193 -212 23.5006 0.0205
NP_442679.1_1 Forward -398 -379 0.294447 0.204
NP_442679.1_1 Forward -152 -133 -4.81876 0.286
NP_441926.1_3 Forward -226 -210 3.00846 0.247
NP_442837.1_3 Forward -31 -24 5.84064 0.272
NP_440160.1_2 Forward -283 -264 -5.11376 0.269
NP_442532.1_1 Forward -391 -377 13.9035 0.215
NP_440914.1_2 Reverse -205 -224 15.7324 0.297
NP_442533.1_6 Reverse -89 -98 4.62128 0.179
NP_442533.1_6 Reverse -268 -277 2.26134 0.266
NP_441482.1_7 Reverse -319 -333 -9.73518 0.209
NP_441028.1_6 Reverse -132 -142 6.27276 0.23
NP_441028.1_6 Reverse -133 -143 3.71617 0.281
NP_440116.1_8 Forward -312 -293 -10.0303 0.297
NP_441527.1_4 Forward -390 -371 -1.00309 0.146
NP_441527.1_4 Forward -391 -372 -9.88384 0.262
NP_441527.1_4 Forward -392 -373 -9.97933 0.263
NP_441527.1_4 Reverse -111 -130 -13.0351 0.298
NP_441527.1_4 Reverse -110 -129 -13.1306 0.298
NP_440115.1_6 Reverse -322 -332 6.07655 0.204
NP_441106.1_1 Forward -262 -253 2.85133 0.255
NP_442588.1_6 Reverse -214 -233 -1.67217 0.275
NP_442306.1_3 Forward -320 -301 12.1925 0.267
NP_440670.1_6 Reverse -250 -269 12.5858 0.292
NP_440886.1_4 Reverse -25 -44 15.1424 0.225
NP_440886.1_7 Reverse -258 -268 8.82935 0.0805
NP_440886.1_7 Forward -208 -198 3.22451 0.291
NP_441403.1_4 Reverse -265 -283 6.50899 0.288
NP_442459.1_7 Reverse -371 -390 12.8808 0.187
NP_442459.1_9 Reverse -13 -32 21.9273 0.038
NP_441463.1_3 Reverse -242 -261 5.80098 0.0697
NP_441988.1_2 Forward -294 -275 13.0775 0.239
NP_440855.1_1 Forward -104 -85 0.196116 0.244
NP_441993.1_1 Reverse -291 -310 3.70092 0.23
NP_441993.1_1 Reverse -268 -287 1.94669 0.267
NP_440082.1_5 Reverse -376 -395 15.8016 0.256
NP_440814.1_8 Reverse -32 -51 -1.27885 0.297
NP_440766.1_4 Forward -272 -258 0.982901 0.259
NP_440766.1_5 Reverse -31 -43 15.2951 0.193
NP_442743.1_4 Forward -149 -130 -8.26035 0.289
NP_442930.1_1 Reverse -126 -136 11.091 0.26
NP_439910.1_2 Forward -342 -325 -13.9242 0.171
NP_442867.1_3 Forward -138 -119 7.07928 0.193
NP_442867.1_8 Reverse -254 -273 13.4708 0.171
NP_440457.1_1 Reverse -321 -333 1.12062 0.245
NP_442680.1_5 Forward -397 -378 11.0136 0.129
NP_442680.1_5 Reverse -32 -51 0.169919 0.268
NP_442680.1_5 Reverse -205 -224 -0.611604 0.288
NP_440142.1_2 Forward -49 -35 18.4858 0.274
NP_442297.1_4 Forward -265 -246 13.016 0.255
NP_441984.1_4 Reverse -282 -296 19.9608 0.118
NP_441436.1_8 Reverse -267 -286 13.9625 0.215
NP_442509.1_9 Reverse -325 -335 10.9926 0.15
NP_442509.1_9 Reverse -246 -256 7.25606 0.229
NP_442509.1_9 Reverse -225 -235 6.27276 0.279
NP_442439.1_8 Reverse -197 -216 8.65258 0.253
NP_442936.1_10 Reverse -122 -136 7.92401 0.27
NP_441761.1_1 Forward -333 -314 2.55606 0.285
NP_440478.1_9 Forward -330 -311 9.0459 0.259
NP_442703.1_8 Reverse -378 -396 12.1131 0.265
NP_441756.1_5 Forward -38 -19 1.27776 0.217
NP_441756.1_5 Reverse -17 -36 -1.67217 0.262
NP_441756.1_5 Reverse -287 -306 -3.04881 0.287
NP_443059.1_8 Forward -33 -14 15.2408 0.233
NP_441307.1_4 Forward -270 -251 -0.197208 0.257
NP_443010.1_10 Forward -337 -320 3.54386 0.253
NP_442451.1_2 Reverse -29 -48 -6.68705 0.232
NP_442373.1_2 Reverse -276 -295 -10.1286 0.272
NP_440216.1_1 Forward -30 -16 -12.3901 0.264
NP_442015.1_10 Reverse -137 -150 5.82081 0.132
NP_441177.1_7 Reverse -242 -261 11.2084 0.217
NP_442417.1_5 Forward -363 -349 5.21113 0.271
NP_440416.1_9 Forward -37 -18 -18.4868 0.259
NP_440416.1_9 Reverse -277 -296 -18.6834 0.262
NP_443052.1_8 Forward -323 -304 0.786102 0.0636
NP_443052.1_9 Forward -308 -289 -3.24547 0.247
NP_443052.1_9 Forward -34 -15 -5.9004 0.274
NP_442116.1_6 Reverse -187 -204 7.02305 0.266
NP_440591.1_9 Reverse -324 -342 8.08229 0.187
NP_440261.1_5 Forward -333 -320 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCATGGCGACAAAAAAGAGAATAAAATTACCGATTAAAGCGACCCAAAAGGTGGTCATGAATAGACCGGGATTGCCCTGCATGACGCTGAGACCACCAAAGGTTCCCGCCGCTGTCAGCACCAAGCCTCCGCCAAGATAGGGGAGGGCGTTTTTGATCACGTTTGGCCCGATCAGACTTTGGCCTTTTGCCTCCGCCATGATCTGACGAAAATTGCTGGTATTGCTCATAAAAAGTGGATTTTTGACTAGGATAATCACAGGGGGGAAATTATTTTTCCCTTACCTTTAATATACTATCGACAACCATGGCCTTGCTTTAAGTGCTGGTAAGTCCTTATAAGCCCTTATTTGTGGGCTATTTCTGCCCCTGGATCCCGCCGGCTGAGCTAAGCATGAACT

CDS

GTGTATTGTTCCATTGTCAGACCAGGAGGCCTTAGTCCTATGAATTATCGTGTTATTGTCTTGAGTGGGGTGATGACTGCCCTCCTCGGCACCGTGTTTGGTTGGGGCATGGGGCAGATTGCCCTGCGTCAACGGCCTAGCCAAGTACAGGTCACCATGAGTCAGCCCTATCGTACTTTCTATGGGCGGCGCTTAATCTGGTTCGGGGCGATCGCCGGCTTTGTGTTGGGGGCAGGACAGGCCTGTGTACTGGCGGAGAGGAAAAAGGAAAAAGAAGCCATGGAGAAAGCGGAAACTGAAGAAGACTATTCCTGA

Protein

MYCSIVRPGGLSPMNYRVIVLSGVMTALLGTVFGWGMGQIALRQRPSQVQVTMSQPYRTFYGRRLIWFGAIAGFVLGAGQACVLAERKKEKEAMEKAETEEDYS