Your browser is old and dusty. Try Google Chrome!

Details for slr1245

ORF slr1245
Accession NP_441150.1
Symbol
Category transcriptional regulator
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -223 -237 10.521 0.0605
NP_441061.1_2 Forward -230 -216 -1.27871 0.255
NP_440795.1_7 Forward -230 -223 14.6904 0.0123
NP_440795.1_7 Reverse -223 -230 14.6904 0.0123
NP_441418.1_6 Forward -231 -212 -19.7651 0.0955
NP_441418.1_6 Reverse -354 -373 -28.4182 0.205
NP_442291.1_5 Forward -232 -216 5.36841 0.0773
NP_442291.1_5 Reverse -221 -237 -1.21977 0.192
NP_440897.1_6 Forward -334 -315 -3.83621 0.257
NP_441453.1_4 Reverse -222 -230 16.539 0.00633
NP_441453.1_4 Forward -231 -223 16.539 0.00633
NP_441623.1_1 Forward -181 -163 -3.71743 0.269
NP_442838.1_7 Forward -236 -217 -0.688862 0.121
NP_440561.1_4 Reverse -163 -182 15.9339 0.177
NP_441818.1_6 Reverse -304 -318 8.75105 0.274
NP_440226.1_1 Reverse -222 -241 13.7658 0.0348
NP_440226.1_1 Forward -231 -212 9.43923 0.0726
NP_442173.1_1 Forward -230 -222 15.4574 0.00633
NP_442173.1_1 Reverse -223 -231 15.4574 0.00633
NP_442173.1_1 Forward -355 -347 5.0343 0.24
NP_442752.1_4 Forward -231 -224 13.8055 0.0199
NP_442752.1_4 Reverse -222 -229 13.8055 0.0199
NP_442752.1_4 Forward -238 -231 12.4288 0.0388
NP_443027.1_4 Reverse -220 -230 14.828 0.0437
NP_443027.1_4 Forward -233 -223 13.943 0.0452
NP_442975.1_10 Forward -235 -221 4.42388 0.245
NP_442975.1_10 Reverse -218 -232 4.42388 0.245
NP_440074.1_6 Reverse -84 -103 11.0117 0.268
NP_441225.1_1 Reverse -224 -243 -3.83545 0.191
NP_440784.1_7 Forward -230 -223 15.9687 0.0123
NP_440784.1_7 Reverse -223 -230 15.9687 0.0123
NP_440061.1_9 Forward -369 -355 6.29216 0.251
NP_441476.1_5 Forward -236 -217 -1.47551 0.205
NP_442062.1_8 Forward -231 -221 19.4496 0.000558
NP_442062.1_8 Reverse -222 -232 19.4496 0.000558
NP_440304.1_4 Reverse -220 -230 10.8948 0.051
NP_440304.1_4 Forward -233 -223 9.91146 0.051
NP_440304.1_4 Reverse -309 -319 4.99491 0.239
NP_440304.1_4 Forward -191 -181 4.69992 0.252
NP_440304.1_4 Reverse -356 -366 3.61828 0.295
NP_442242.1_4 Forward -230 -223 14.3954 0.0124
NP_442242.1_4 Reverse -223 -230 14.3954 0.0124
NP_441619.1_8 Forward -237 -223 6.58715 0.295
NP_441594.1_6 Forward -240 -221 11.7008 0.116
NP_441594.1_6 Reverse -289 -308 3.04771 0.238
NP_442742.1_9 Reverse -196 -215 -12.4886 0.269
NP_442110.1_7 Reverse -222 -236 0.0979218 0.267
NP_441083.1_5 Forward -231 -221 11.3864 0.0159
NP_441083.1_5 Reverse -222 -232 11.3864 0.0159
NP_441083.1_5 Reverse -229 -239 6.27322 0.0876
NP_441149.1_3 Reverse -35 -54 32.0554 0.0000909
NP_441434.1_7 Reverse -224 -238 14.3559 0.0961
NP_441738.1_2 Forward -229 -222 15.28 0.0102
NP_441738.1_2 Reverse -224 -231 15.28 0.0102
NP_441738.1_2 Forward -318 -311 11.8385 0.0469
NP_441558.1_5 Reverse -220 -239 4.42435 0.281
NP_441558.1_5 Forward -369 -350 3.93269 0.294
NP_440209.1_1 Reverse -222 -230 18.1123 0.00295
NP_440209.1_1 Forward -231 -223 18.1123 0.00295
NP_442136.1_4 Reverse -304 -323 7.76679 0.295
NP_442136.1_4 Forward -318 -299 5.01354 0.295
NP_442889.1_1 Forward -257 -238 -14.4552 0.273
NP_442889.1_8 Forward -234 -220 11.2087 0.0735
NP_442889.1_8 Reverse -219 -233 2.8506 0.299
NP_441713.1_1 Forward -237 -218 -7.37537 0.13
NP_441770.1_1 Reverse -230 -249 11.2084 0.277
NP_440178.1_7 Reverse -221 -240 -21.83 0.241
NP_440178.1_7 Forward -232 -213 -22.0267 0.249
NP_442059.1_4 Forward -231 -212 3.73603 0.201
NP_442570.1_3 Forward -253 -234 -4.13045 0.227
NP_441716.1_1 Forward -231 -217 3.8345 0.259
NP_441716.1_2 Forward -92 -73 -0.855322 0.277
NP_442111.1_4 Forward -232 -218 7.76774 0.0867
NP_442111.1_4 Reverse -221 -235 1.67122 0.296
NP_441163.1_1 Reverse -221 -238 9.08455 0.226
NP_440343.1_3 Forward -371 -353 8.76983 0.195
NP_440343.1_3 Reverse -223 -241 2.67334 0.291
NP_440906.1_5 Forward -230 -223 15.8704 0.0124
NP_440906.1_5 Reverse -223 -230 15.8704 0.0124
NP_440747.1_10 Forward -234 -222 -2.02597 0.0196
NP_440747.1_10 Reverse -219 -231 -2.1243 0.0225
NP_441130.1_10 Reverse -220 -234 20.3541 0.00768
NP_441486.1_1 Forward -234 -220 10.4227 0.0207
NP_441486.1_1 Reverse -219 -233 3.14618 0.0662
NP_441880.2_10 Reverse -223 -241 13.0972 0.111
NP_442634.1_4 Forward -233 -219 -3.54032 0.161
NP_442634.1_4 Reverse -309 -323 -5.40861 0.253
NP_440403.1_10 Forward -240 -221 2.3594 0.279
NP_441014.1_10 Forward -232 -213 2.16195 0.216
NP_442848.1_1 Reverse -216 -230 6.19444 0.0799
NP_442848.1_1 Forward -237 -223 3.34284 0.136
NP_443018.1_3 Forward -230 -223 14.8871 0.0123
NP_443018.1_3 Reverse -223 -230 14.8871 0.0123
NP_443018.1_3 Reverse -51 -58 8.20058 0.153
NP_441316.1_7 Reverse -220 -235 -3.36336 0.273
NP_441634.1_8 Reverse -220 -234 12.1926 0.0529
NP_440376.1_1 Forward -231 -222 19.4693 0.000692
NP_440376.1_1 Reverse -222 -231 19.4693 0.000692
NP_440376.1_1 Forward -238 -229 3.93297 0.188
NP_440376.1_1 Forward -149 -140 3.44131 0.203
NP_441588.1_4 Reverse -224 -234 6.96153 0.178
NP_442687.1_7 Forward -232 -222 15.8113 0.0125
NP_442687.1_7 Reverse -221 -231 15.8113 0.0125
NP_442485.1_3 Forward -242 -223 -5.80207 0.296
NP_441846.1_10 Reverse -342 -361 -15.0452 0.243
NP_441846.1_10 Reverse -346 -365 -21.24 0.256
NP_440781.1_1 Reverse -344 -358 12.3893 0.266
NP_441422.1_7 Reverse -220 -237 4.95539 0.106
NP_442296.1_9 Forward -237 -218 -4.91709 0.282
NP_442658.1_1 Forward -233 -223 18.7607 0.00222
NP_442658.1_1 Reverse -220 -230 15.9091 0.00966
NP_442658.1_1 Reverse -356 -366 4.7978 0.297
NP_442198.1_3 Forward -129 -110 2.26107 0.299
NP_442205.1_9 Forward -237 -221 -0.924775 0.264
NP_442544.1_2 Reverse -235 -249 -0.197071 0.217
NP_441414.1_9 Forward -231 -212 5.211 0.048
NP_440607.1_4 Forward -222 -203 4.22769 0.217
NP_441958.1_5 Forward -232 -222 12.2714 0.00183
NP_441958.1_5 Reverse -221 -231 12.2714 0.00183
NP_441958.1_5 Forward -239 -229 -0.904945 0.222
NP_441127.1_1 Reverse -292 -306 15.5359 0.114
NP_441137.1_2 Forward -63 -49 20.3499 0.0485
NP_442836.1_5 Forward -307 -288 2.0644 0.269
NP_440984.1_7 Reverse -224 -238 4.81781 0.287
NP_442911.1_2 Forward -241 -222 5.99764 0.0305
NP_442911.1_2 Reverse -212 -231 -2.26216 0.096
NP_440153.1_5 Forward -230 -216 7.17775 0.171
NP_440153.1_5 Reverse -223 -237 2.85119 0.219
NP_442119.1_6 Forward -233 -214 6.09597 0.25
NP_443055.1_6 Forward -239 -221 2.08335 0.22
NP_443055.1_6 Forward -189 -171 0.706727 0.24
NP_442236.1_2 Reverse -357 -376 14.7491 0.216
NP_440993.1_2 Reverse -217 -233 9.39998 0.12
NP_440993.1_2 Forward -325 -309 6.9417 0.195
NP_440471.1_5 Reverse -365 -384 22.6156 0.0163
NP_439975.1_2 Forward -214 -196 10.7372 0.195
NP_441099.1_5 Reverse -212 -231 -10.817 0.262
NP_442002.1_9 Forward -232 -225 10.7572 0.185
NP_442002.1_9 Reverse -221 -228 10.7572 0.185
NP_441294.1_7 Forward -235 -221 10.6905 0.177
NP_441294.1_7 Reverse -46 -60 8.57871 0.294
NP_441646.1_1 Reverse -215 -234 0.982764 0.24
NP_442438.1_10 Forward -236 -222 21.7307 0.01
NP_442438.1_10 Reverse -217 -231 4.91614 0.142
NP_442431.1_7 Reverse -303 -322 5.70265 0.273
NP_441000.1_6 Reverse -221 -235 13.5693 0.0396
NP_441000.1_6 Forward -232 -218 4.71948 0.0933
NP_442771.1_1 Reverse -220 -238 10.9339 0.0195
NP_442771.1_1 Forward -233 -215 -7.45401 0.171
NP_440147.1_4 Reverse -220 -233 11.524 0.0326
NP_440147.1_4 Forward -233 -220 2.08423 0.21
NP_440147.1_4 Reverse -371 -384 1.49425 0.226
NP_441550.1_8 Forward -233 -223 10.501 0.066
NP_441550.1_8 Reverse -220 -230 6.0761 0.214
NP_441916.1_7 Forward -231 -221 18.4663 0.00144
NP_441916.1_7 Reverse -222 -232 18.4663 0.00144
NP_441041.1_4 Forward -231 -212 -11.2103 0.242
NP_441041.1_7 Forward -234 -222 19.5648 0.00277
NP_441041.1_7 Reverse -177 -189 6.34865 0.211
NP_442396.1_5 Reverse -218 -231 15.3589 0.0669
NP_441725.1_5 Forward -230 -220 11.2881 0.0247
NP_441725.1_5 Reverse -223 -233 9.02648 0.0553
NP_441725.1_5 Forward -355 -345 -1.10161 0.288
NP_439966.1_7 Reverse -220 -230 18.4657 0.00473
NP_439966.1_7 Forward -233 -223 17.4824 0.00636
NP_439966.1_9 Forward -233 -224 10.7178 0.0863
NP_439966.1_9 Reverse -220 -229 0.983037 0.253
NP_440736.1_3 Reverse -220 -239 0.982764 0.282
NP_440202.1_8 Reverse -214 -233 12.2379 0.272
NP_442941.1_3 Forward -230 -220 11.4848 0.0116
NP_442941.1_3 Reverse -223 -233 2.53664 0.14
NP_440674.1_3 Reverse -358 -377 9.43923 0.199
NP_440289.1_2 Forward -234 -221 12.999 0.0132
NP_440289.1_2 Reverse -219 -232 5.13249 0.0636
NP_442281.1_1 Forward -236 -222 8.45543 0.0808
NP_442281.1_1 Reverse -217 -231 3.73557 0.221
NP_441079.1_7 Reverse -120 -139 -7.08111 0.286
NP_442901.1_6 Forward -66 -47 22.1524 0.0448
NP_442575.1_8 Reverse -351 -370 -0.39387 0.232
NP_440437.1_1 Reverse -216 -235 -3.63879 0.242
NP_441087.1_3 Reverse -371 -386 13.3529 0.298
NP_441457.1_7 Reverse -220 -239 0.884433 0.276
NP_441556.1_10 Reverse -135 -149 12.8499 0.192
NP_440498.1_1 Forward -240 -222 -3.6191 0.267
NP_440375.1_8 Reverse -348 -367 -0.0988766 0.266
NP_443030.1_3 Forward -237 -219 2.96908 0.298
NP_441644.1_6 Forward -231 -221 10.1076 0.0628
NP_441644.1_6 Reverse -222 -232 10.1076 0.0628
NP_441644.1_6 Forward -356 -346 3.71617 0.267
NP_440867.1_10 Reverse -228 -247 0.982764 0.299
NP_442215.1_2 Reverse -227 -243 1.63183 0.13
NP_442215.1_2 Forward -233 -217 -7.11963 0.286
NP_442215.1_2 Reverse -41 -57 -7.21796 0.289
NP_440253.1_2 Forward -231 -213 4.05072 0.107
NP_440253.1_2 Reverse -222 -240 -0.570838 0.216
NP_440929.1_8 Forward -231 -222 19.2726 0.000701
NP_440929.1_8 Reverse -222 -231 19.2726 0.000701
NP_440929.1_8 Reverse -229 -238 5.40793 0.138
NP_442933.1_10 Forward -231 -222 17.601 0.00325
NP_442933.1_10 Reverse -222 -231 17.601 0.00325
NP_441310.1_9 Forward -211 -192 5.11266 0.128
NP_441751.2_8 Reverse -223 -237 13.9626 0.0133
NP_441751.2_8 Forward -230 -216 -0.295402 0.125
NP_441751.2_8 Reverse -181 -195 -6.49025 0.269
NP_442554.1_8 Reverse -223 -233 16.008 0.0065
NP_442554.1_8 Forward -230 -220 13.8447 0.0145
NP_442554.1_8 Forward -186 -176 2.83163 0.253
NP_441762.1_7 Reverse -221 -233 21.5735 0.00342
NP_441762.1_7 Forward -232 -220 12.0354 0.0142
NP_442142.1_4 Forward -234 -221 16.4399 0.0264
NP_442142.1_4 Reverse -219 -232 10.4418 0.0724
NP_442292.1_1 Forward -230 -221 9.63616 0.0183
NP_442292.1_1 Reverse -223 -232 9.63616 0.0183
NP_442292.1_1 Forward -186 -177 2.65466 0.219
NP_442476.1_6 Forward -230 -216 7.17775 0.116
NP_442476.1_6 Reverse -223 -237 3.73617 0.154
NP_440895.1_7 Forward -243 -225 12.3105 0.108
NP_442381.1_8 Forward -234 -215 -6.39206 0.16
NP_443009.1_5 Reverse -221 -232 11.6612 0.0602
NP_443009.1_5 Forward -232 -221 11.6612 0.0602
NP_442408.2_1 Reverse -229 -248 4.62101 0.143
NP_441715.1_4 Forward -230 -220 16.303 0.0117
NP_441715.1_4 Reverse -223 -233 9.32148 0.097
NP_441715.1_4 Forward -333 -323 5.19158 0.224
NP_440015.1_9 Reverse -222 -240 10.5406 0.099
NP_440015.1_9 Reverse -180 -198 -1.75081 0.292
NP_440777.1_5 Reverse -278 -297 9.14423 0.287
NP_441468.1_1 Forward -230 -223 15.8704 0.0124
NP_441468.1_1 Reverse -223 -230 15.8704 0.0124
NP_441020.2_6 Forward -233 -216 19.9017 0.00668
NP_441020.2_6 Reverse -356 -373 9.08529 0.18
NP_441020.2_6 Reverse -220 -237 8.98696 0.182
NP_441015.1_10 Forward -250 -231 -10.522 0.284
NP_441673.1_1 Forward -231 -222 20.8459 0.000698
NP_441673.1_1 Reverse -222 -231 20.8459 0.000698
NP_441673.1_1 Forward -238 -229 -8.06341 0.254
NP_441826.1_2 Forward -237 -223 12.291 0.0289
NP_441826.1_2 Reverse -216 -230 8.06273 0.0806
NP_441826.1_5 Reverse -352 -371 0.786102 0.3
NP_442868.1_6 Forward -233 -223 8.53483 0.0555
NP_442868.1_6 Reverse -220 -230 0.963343 0.205
NP_442227.1_2 Reverse -224 -243 -3.44213 0.293
NP_441911.1_10 Reverse -54 -73 13.1865 0.21
NP_442808.1_1 Forward -232 -222 18.4657 0.00201
NP_442808.1_1 Reverse -221 -231 18.4657 0.00201
NP_442808.1_1 Reverse -228 -238 6.96107 0.0921
NP_440918.1_2 Reverse -155 -174 17.5024 0.233
NP_440145.1_3 Forward -241 -222 0.196116 0.137
NP_442542.1_2 Forward -233 -220 12.409 0.114
NP_442113.1_10 Forward -371 -352 -9.44032 0.295
NP_442050.1_5 Reverse -220 -230 9.12434 0.193
NP_442050.1_5 Forward -233 -223 8.23937 0.234
NP_442342.1_9 Forward -189 -173 11.1699 0.12
NP_441518.1_3 Forward -241 -222 -13.8652 0.264
NP_441878.1_6 Forward -232 -222 10.4031 0.0176
NP_441878.1_6 Reverse -221 -231 10.4031 0.0176
NP_441878.1_6 Reverse -357 -367 1.06167 0.116
NP_441036.1_8 Forward -232 -222 17.7779 0.000554
NP_441036.1_8 Reverse -221 -231 17.7779 0.000554
NP_441036.1_8 Reverse -353 -363 9.91146 0.174
NP_441557.1_5 Forward -231 -222 19.9609 0.000699
NP_441557.1_5 Reverse -222 -231 19.9609 0.000699
NP_441445.1_1 Forward -240 -221 0.884433 0.266
NP_442066.2_9 Forward -235 -222 8.47575 0.185
NP_442066.2_9 Reverse -307 -320 7.78743 0.208
NP_441308.1_8 Reverse -220 -230 10.1081 0.22
NP_441308.1_8 Forward -233 -223 9.22315 0.226
NP_441458.1_8 Reverse -85 -104 2.58046 0.295
NP_442183.1_1 Forward -231 -217 14.1593 0.036
NP_442183.1_1 Reverse -222 -236 10.816 0.0784
NP_442183.1_1 Reverse -255 -269 4.32615 0.266
NP_440190.1_1 Reverse -163 -182 29.7937 0.000572
NP_441549.1_9 Forward -87 -69 -8.73231 0.237
NP_441638.1_10 Forward -288 -274 15.1426 0.289
NP_440540.1_2 Forward -243 -224 6.98095 0.271
NP_442170.1_5 Reverse -358 -377 -0.590531 0.234
NP_442347.1_2 Forward -230 -221 11.1111 0.056
NP_442347.1_2 Reverse -223 -232 11.1111 0.056
NP_442645.1_2 Forward -239 -220 -3.3438 0.0487
NP_442645.1_2 Reverse -214 -233 -4.52377 0.0586
NP_441037.1_4 Forward -233 -223 16.2838 0.0168
NP_441037.1_4 Reverse -220 -230 7.02532 0.237
NP_441633.1_3 Reverse -220 -233 13.3923 0.018
NP_441633.1_3 Forward -233 -220 3.5592 0.0699
NP_441633.1_3 Reverse -138 -151 -5.97891 0.236
NP_440136.1_2 Forward -230 -223 15.9687 0.0123
NP_440136.1_2 Reverse -223 -230 15.9687 0.0123
NP_442998.1_5 Forward -385 -375 8.73149 0.261
NP_442998.1_10 Forward -229 -222 15.5754 0.0102
NP_442998.1_10 Reverse -224 -231 15.5754 0.0102
NP_440731.1_2 Forward -243 -224 5.30933 0.293
NP_440899.1_1 Reverse -160 -179 6.84597 0.267
NP_440299.1_1 Reverse -218 -231 16.8333 0.00835
NP_440299.1_1 Forward -235 -222 7.68852 0.107
NP_441799.1_1 Forward -235 -221 12.8803 0.0385
NP_441799.1_1 Reverse -218 -232 12.5853 0.0421
NP_441799.1_1 Reverse -183 -197 7.17714 0.149
NP_441799.1_4 Forward -174 -155 1.67108 0.172
NP_441007.1_10 Forward -236 -223 5.52582 0.18
NP_442201.1_2 Reverse -152 -171 19.769 0.135
NP_442201.1_10 Reverse -343 -362 -12.4886 0.268
NP_442201.1_10 Reverse -232 -251 -14.3569 0.281
NP_441449.1_8 Forward -164 -145 12.8237 0.298
NP_440256.1_1 Forward -234 -215 0.196116 0.0858
NP_440087.1_1 Reverse -178 -197 -5.01543 0.249
NP_442007.1_8 Reverse -221 -239 8.57317 0.297
NP_441512.1_4 Reverse -218 -237 7.86593 0.269
NP_440915.1_6 Forward -235 -221 13.1759 0.0194
NP_440915.1_6 Reverse -218 -232 2.65453 0.113
NP_441179.1_9 Forward -173 -163 13.2542 0.26
NP_440717.1_3 Reverse -232 -246 15.3386 0.196
NP_442452.1_3 Forward -167 -148 9.3409 0.212
NP_441464.1_8 Reverse -222 -236 8.55439 0.194
NP_441939.1_3 Reverse -223 -242 5.50599 0.273
NP_439985.1_7 Forward -193 -174 2.55606 0.289
NP_442993.1_1 Reverse -222 -238 10.3833 0.0169
NP_442386.1_9 Reverse -221 -230 15.7322 0.0144
NP_442386.1_9 Forward -232 -223 15.7322 0.0144
NP_442386.1_9 Reverse -241 -250 5.89917 0.233
NP_441340.1_5 Forward -230 -223 15.6737 0.0124
NP_441340.1_5 Reverse -223 -230 15.6737 0.0124
NP_441947.1_10 Reverse -220 -238 -0.570838 0.276
NP_442791.1_5 Forward -239 -220 -9.047 0.279
NP_442240.1_2 Forward -230 -211 -14.5535 0.182
NP_440161.1_3 Forward -233 -214 14.2574 0.121
NP_440586.1_8 Forward -230 -223 13.2151 0.026
NP_440586.1_8 Reverse -223 -230 13.2151 0.026
NP_440586.1_8 Reverse -51 -58 9.08521 0.178
NP_442251.1_6 Forward -230 -223 15.2804 0.0124
NP_442251.1_6 Reverse -223 -230 15.2804 0.0124
NP_442251.1_6 Forward -333 -326 8.20058 0.23
NP_440684.1_9 Reverse -181 -195 14.4542 0.128
NP_440684.1_9 Forward -237 -223 7.37441 0.266
NP_441262.1_3 Reverse -222 -229 14.7888 0.0223
NP_441262.1_3 Forward -231 -224 14.7888 0.0223
NP_440027.1_3 Reverse -212 -230 6.50823 0.225
NP_443051.1_1 Reverse -221 -230 10.4228 0.00754
NP_443051.1_1 Forward -232 -223 10.4228 0.00754
NP_439937.1_9 Reverse -221 -238 -8.61494 0.176
NP_439937.1_9 Forward -357 -340 -11.5649 0.257
NP_439937.1_9 Reverse -43 -60 -12.7448 0.276
NP_440398.1_2 Reverse -286 -305 4.42435 0.231
NP_440439.1_1 Forward -234 -221 9.65572 0.0447
NP_440439.1_1 Reverse -219 -232 8.27909 0.0547
NP_440439.1_1 Reverse -351 -364 1.78924 0.143
NP_440439.1_1 Forward -241 -228 -1.75067 0.281
NP_442239.1_8 Reverse -174 -193 9.63589 0.249
NP_440372.1_2 Forward -230 -223 16.3621 0.0124
NP_440372.1_2 Reverse -223 -230 16.3621 0.0124
NP_440316.1_10 Reverse -291 -301 5.97822 0.275
NP_441803.1_2 Reverse -217 -236 -1.18052 0.294
NP_439977.1_5 Forward -237 -218 -0.4922 0.227
NP_439977.1_7 Reverse -211 -230 9.83173 0.299
NP_440139.1_1 Forward -237 -218 12.4867 0.0755
NP_440139.1_1 Reverse -216 -235 11.405 0.0797
NP_440139.1_1 Forward -244 -225 1.37531 0.263
NP_441572.1_7 Forward -237 -218 5.211 0.0892
NP_441572.1_7 Forward -362 -343 -4.13045 0.227
NP_440267.1_2 Forward -372 -358 7.66879 0.194
NP_442384.1_10 Forward -231 -218 15.0639 0.0117
NP_442384.1_10 Reverse -222 -235 1.29759 0.263
NP_442114.1_4 Reverse -222 -233 12.1534 0.107
NP_441018.1_7 Reverse -155 -174 8.94757 0.239
NP_442790.1_4 Forward -240 -221 -15.0452 0.284
NP_442262.1_10 Forward -230 -223 14.1988 0.0123
NP_442262.1_10 Reverse -223 -230 14.1988 0.0123
NP_442262.1_10 Reverse -51 -58 9.38056 0.202
NP_442262.1_10 Reverse -256 -263 8.39725 0.234
NP_441689.1_5 Reverse -220 -230 8.53436 0.132
NP_441689.1_5 Forward -322 -312 5.48612 0.251
NP_440163.1_10 Reverse -219 -229 14.238 0.102
NP_440344.1_10 Forward -238 -221 0.333834 0.0363
NP_440344.1_10 Reverse -215 -232 -9.10594 0.139
NP_440562.1_3 Forward -188 -171 22.1633 0.0204
NP_440562.1_10 Forward -376 -358 5.91901 0.284
NP_442065.1_2 Reverse -136 -149 17.5216 0.194
NP_442556.1_10 Reverse -39 -58 9.69023 0.277
NP_442556.1_10 Forward -74 -55 7.68492 0.299
NP_440297.1_9 Forward -230 -220 9.32148 0.0917
NP_440297.1_9 Reverse -223 -233 -0.216628 0.282
NP_442280.1_10 Forward -314 -296 4.96742 0.291
NP_441896.1_3 Forward -240 -221 9.24257 0.0872
NP_440937.1_8 Reverse -150 -169 3.83436 0.264
NP_440999.1_9 Forward -235 -221 5.1128 0.113
NP_440888.1_2 Reverse -222 -236 18.3868 0.00256
NP_440888.1_2 Forward -231 -217 16.8135 0.00536
NP_440888.1_2 Reverse -230 -244 5.89884 0.258
NP_441543.1_2 Forward -230 -221 18.486 0.00236
NP_441543.1_2 Reverse -223 -232 18.486 0.00236
NP_442845.1_2 Forward -237 -223 8.16106 0.195
NP_442845.1_2 Forward -108 -94 6.78443 0.202
NP_441469.1_8 Reverse -221 -230 16.126 0.00797
NP_441469.1_8 Forward -232 -223 16.126 0.00797
NP_443064.1_3 Reverse -146 -165 11.1109 0.159
NP_443064.1_6 Reverse -229 -239 11.8882 0.113
NP_442337.1_6 Reverse -171 -190 15.4966 0.198
NP_442337.1_8 Reverse -152 -171 5.99764 0.21
NP_442578.1_7 Forward -230 -223 14.5921 0.026
NP_442578.1_7 Reverse -223 -230 14.5921 0.026
NP_440710.1_1 Reverse -214 -232 6.31233 0.113
NP_441462.1_2 Forward -231 -221 11.5831 0.00406
NP_441462.1_2 Reverse -222 -232 11.5831 0.00406
NP_441621.1_7 Forward -233 -219 6.09611 0.068
NP_441621.1_7 Reverse -220 -234 6.09611 0.068
NP_443062.1_1 Forward -231 -213 7.57085 0.172
NP_443062.1_6 Reverse -214 -233 3.6377 0.231
NP_441601.1_4 Reverse -346 -365 -3.54046 0.293
NP_440519.1_8 Reverse -342 -358 3.69678 0.244
NP_442204.1_1 Reverse -174 -185 6.54852 0.162
NP_442204.1_5 Forward -241 -222 -0.000545616 0.274
NP_441560.1_8 Reverse -361 -380 11.5127 0.294
NP_440255.1_8 Forward -37 -18 13.4617 0.28
NP_440516.1_8 Forward -231 -222 16.9127 0.00442
NP_440516.1_8 Reverse -222 -231 16.9127 0.00442
NP_442428.1_5 Forward -230 -223 15.8704 0.0124
NP_442428.1_5 Reverse -223 -230 15.8704 0.0124
NP_442859.1_2 Reverse -223 -242 4.42435 0.217
NP_440673.1_2 Reverse -212 -231 9.60917 0.24
NP_440673.1_3 Forward -229 -222 12.4288 0.0426
NP_440673.1_3 Reverse -224 -231 12.4288 0.0426
NP_440673.1_3 Forward -76 -69 6.72562 0.277
NP_441052.1_2 Forward -231 -221 10.5014 0.0285
NP_441052.1_2 Reverse -222 -232 10.5014 0.0285
NP_442219.1_9 Forward -230 -221 8.35786 0.0681
NP_442219.1_9 Reverse -223 -232 8.35786 0.0681
NP_440436.1_4 Forward -230 -221 18.1905 0.00233
NP_440436.1_4 Reverse -223 -232 18.1905 0.00233
NP_441884.1_9 Forward -234 -215 -23.9933 0.284
NP_441719.1_4 Forward -230 -223 16.3621 0.0124
NP_441719.1_4 Reverse -223 -230 16.3621 0.0124
NP_441719.1_6 Forward -303 -284 8.55343 0.269
NP_441733.1_10 Forward -234 -221 19.9805 0.0151
NP_441733.1_10 Reverse -219 -232 7.49244 0.153
NP_441004.1_1 Forward -254 -235 -13.4719 0.257
NP_441004.1_1 Forward -249 -230 -17.8968 0.295
NP_441004.1_6 Forward -315 -296 15.5357 0.268
NP_442366.1_3 Reverse -221 -239 -1.84914 0.219
NP_441115.1_4 Forward -368 -350 7.98318 0.266
NP_443054.1_2 Reverse -220 -234 22.0257 0.00482
NP_443054.1_2 Forward -240 -226 8.65272 0.114
NP_441851.1_10 Forward -232 -222 16.008 0.00552
NP_441851.1_10 Reverse -221 -231 16.008 0.00552
NP_442515.1_1 Forward -277 -263 -3.04867 0.285
NP_442515.1_1 Forward -190 -176 -3.147 0.287
NP_442515.1_1 Forward -232 -218 -4.4253 0.298
NP_440463.1_8 Reverse -227 -246 5.66045 0.277
NP_441349.1_10 Reverse -212 -231 -6.49039 0.23
NP_442314.1_1 Reverse -240 -258 -5.78238 0.288
NP_440432.1_9 Forward -77 -62 -3.26502 0.179
NP_440432.1_9 Forward -230 -215 -3.46169 0.181
NP_440432.1_9 Forward -319 -304 -6.41162 0.299
NP_439960.1_3 Reverse -292 -311 2.75272 0.263
NP_439960.1_10 Reverse -146 -164 -4.20908 0.292
NP_440474.1_8 Reverse -223 -237 21.9267 0.0376
NP_440474.1_8 Forward -230 -216 7.27547 0.207
NP_441150.1_4 Forward -273 -254 20.5498 0.092
NP_441150.1_5 Forward -215 -197 21.947 0.0451
NP_441150.1_6 Forward -190 -171 18.6815 0.0874
NP_442450.1_5 Reverse -220 -230 9.32148 0.115
NP_442168.1_6 Forward -308 -289 7.07928 0.245
NP_440588.1_2 Forward -240 -221 -5.60541 0.256
NP_442006.1_2 Reverse -349 -366 -5.95935 0.149
NP_442006.1_2 Reverse -283 -300 -16.5791 0.256
NP_441570.1_1 Forward -231 -213 -4.50408 0.0745
NP_441078.1_4 Forward -231 -222 19.6659 0.0007
NP_441078.1_4 Reverse -222 -231 19.6659 0.0007
NP_442729.1_8 Reverse -218 -231 9.85238 0.125
NP_442729.1_8 Forward -367 -354 5.52582 0.242
NP_442348.1_2 Reverse -311 -320 7.17789 0.285
NP_442443.1_1 Reverse -170 -189 -4.22878 0.268
NP_441094.1_6 Forward -238 -221 9.67453 0.257
NP_440526.1_3 Reverse -223 -234 11.7595 0.0646
NP_440526.1_3 Reverse -141 -152 2.22148 0.267
NP_441432.1_8 Reverse -221 -230 8.25953 0.0755
NP_441432.1_8 Forward -232 -223 8.25953 0.0755
NP_441432.1_9 Reverse -307 -320 8.59837 0.287
NP_441333.1_1 Forward -68 -58 12.7339 0.229
NP_442320.1_8 Forward -237 -223 8.06273 0.0184
NP_442320.1_8 Reverse -216 -230 4.52282 0.0482
NP_441732.1_2 Reverse -174 -190 -7.11963 0.0695
NP_441732.1_2 Reverse -218 -234 -16.3627 0.165
NP_440629.1_6 Forward -373 -354 14.3596 0.181
NP_440760.1_1 Reverse -222 -241 -11.3086 0.0851
NP_442797.1_7 Reverse -221 -239 9.36059 0.173
NP_440578.1_10 Reverse -70 -89 11.4058 0.25
NP_441072.1_2 Forward -242 -223 11.3075 0.188
NP_441072.1_2 Reverse -218 -237 10.3242 0.2
NP_442010.1_9 Reverse -138 -152 24.5816 0.00217
NP_442489.1_7 Forward -231 -222 20.1576 0.000695
NP_442489.1_7 Reverse -222 -231 20.1576 0.000695
NP_441830.1_2 Reverse -163 -182 -2.36049 0.275
NP_440559.1_1 Reverse -223 -232 8.75118 0.0586
NP_440559.1_1 Forward -230 -221 8.75118 0.0586
NP_441659.2_8 Forward -231 -221 11.9764 0.0147
NP_441659.2_8 Reverse -222 -232 11.9764 0.0147
NP_440363.1_9 Forward -243 -225 12.3105 0.288
NP_441040.1_2 Reverse -227 -246 -16.3235 0.295
NP_442346.1_5 Forward -232 -222 9.02648 0.118
NP_442346.1_5 Reverse -221 -231 9.02648 0.118
NP_442346.1_5 Reverse -68 -78 6.76487 0.192
NP_440545.1_3 Forward -235 -218 -2.71443 0.191
NP_440545.1_3 Reverse -354 -371 -4.28772 0.223
NP_440459.1_2 Reverse -163 -180 8.00365 0.272
NP_442311.1_5 Reverse -160 -179 6.09597 0.245
NP_441888.1_7 Reverse -217 -231 2.94952 0.225
NP_441948.1_4 Reverse -215 -233 8.18062 0.0623
NP_441833.1_4 Forward -230 -223 15.9687 0.0124
NP_441833.1_4 Reverse -223 -230 15.9687 0.0124
NP_441329.1_6 Reverse -59 -78 1.00224 0.245
NP_441895.1_2 Reverse -205 -224 -17.7001 0.234
NP_442162.1_9 Forward -230 -223 16.2637 0.0124
NP_442162.1_9 Reverse -223 -230 16.2637 0.0124
NP_440671.1_4 Forward -237 -223 9.14437 0.184
NP_440671.1_4 Reverse -216 -230 8.84938 0.188
NP_442140.1_3 Reverse -223 -233 17.4829 0.0159
NP_442140.1_3 Forward -230 -220 8.33817 0.119
NP_442723.1_1 Reverse -195 -214 1.76863 0.292
NP_441671.1_1 Reverse -347 -366 -0.787193 0.273
NP_440875.1_9 Reverse -224 -234 17.619 0.0104
NP_441813.1_5 Reverse -220 -230 17.188 0.00979
NP_441813.1_5 Forward -233 -223 10.0098 0.0208
NP_440590.1_4 Reverse -223 -236 11.9173 0.0173
NP_440590.1_4 Forward -237 -224 -1.06236 0.21
NP_440590.1_4 Forward -230 -217 -5.38892 0.277
NP_440567.1_1 Reverse -223 -237 20.4524 0.012
NP_440567.1_1 Forward -230 -216 6.88276 0.08
NP_442497.1_10 Forward -230 -221 10.4228 0.0087
NP_442497.1_10 Reverse -223 -232 10.4228 0.0087
NP_440821.1_4 Reverse -220 -230 19.0562 0.00399
NP_440821.1_4 Forward -233 -223 18.7612 0.00422
NP_441239.1_9 Forward -233 -221 18.6235 0.0114
NP_441239.1_9 Reverse -220 -232 15.8703 0.0178
NP_441239.1_9 Reverse -227 -239 3.77555 0.276
NP_440665.1_2 Reverse -234 -253 -3.83545 0.246
NP_442044.1_1 Forward -245 -226 -7.57203 0.224
NP_442193.1_1 Reverse -310 -328 8.27895 0.272
NP_442105.1_9 Forward -184 -170 14.1576 0.294
NP_440989.1_1 Forward -42 -23 27.8355 0.00108
NP_440989.1_3 Forward -236 -217 23.3039 0.0125
NP_440989.1_8 Forward -380 -361 35.3003 0.00000529
NP_440989.1_9 Forward -333 -315 26.6442 0.000627
NP_440989.1_10 Forward -359 -340 37.6602 0.0000028
NP_441874.1_1 Forward -218 -204 11.8976 0.24
NP_440354.1_7 Forward -237 -219 10.3439 0.224
NP_442138.1_1 Reverse -220 -239 2.6536 0.24
NP_440546.1_4 Forward -231 -221 11.8882 0.0679
NP_440546.1_4 Reverse -222 -232 11.8882 0.0679
NP_440462.1_6 Forward -233 -223 17.9746 0.00578
NP_440462.1_6 Reverse -220 -230 15.418 0.0142
NP_440462.1_6 Reverse -253 -263 3.22496 0.255
NP_440868.1_4 Forward -235 -223 10.0687 0.0405
NP_440868.1_4 Reverse -218 -230 8.6921 0.0582
NP_442402.1_4 Reverse -191 -210 -4.32786 0.224
NP_441084.1_6 Reverse -245 -259 11.768 0.188
NP_440696.1_3 Forward -231 -213 1.49411 0.217
NP_440696.1_6 Forward -250 -231 5.89931 0.266
NP_442039.1_4 Forward -230 -223 15.1821 0.0124
NP_442039.1_4 Reverse -223 -230 15.1821 0.0124
NP_441811.1_4 Reverse -220 -239 9.24257 0.156
NP_441811.1_4 Forward -176 -157 1.96607 0.29
NP_441811.1_8 Reverse -159 -173 5.50613 0.299
NP_441926.1_3 Reverse -222 -238 5.56507 0.17
NP_441926.1_3 Forward -231 -215 4.58176 0.184
NP_442837.1_3 Forward -230 -223 15.7721 0.0124
NP_442837.1_3 Reverse -223 -230 15.7721 0.0124
NP_442053.1_1 Forward -231 -222 18.3876 0.0007
NP_442053.1_1 Reverse -222 -231 18.3876 0.0007
NP_442053.1_1 Forward -238 -229 4.22796 0.261
NP_440505.1_3 Forward -233 -223 14.1397 0.0235
NP_440505.1_3 Reverse -220 -230 13.8447 0.0247
NP_440505.1_3 Forward -278 -268 5.97822 0.202
NP_441252.1_6 Reverse -240 -247 11.6422 0.288
NP_442532.1_3 Forward -73 -54 23.4304 0.00293
NP_440914.1_1 Forward -231 -221 8.6151 0.186
NP_440914.1_1 Reverse -222 -232 8.6151 0.186
NP_441011.1_8 Forward -230 -221 16.9127 0.00602
NP_441011.1_8 Reverse -223 -232 16.9127 0.00602
NP_440068.1_1 Forward -211 -192 -3.63879 0.249
NP_442533.1_6 Forward -231 -222 17.2076 0.00137
NP_442533.1_6 Reverse -222 -231 17.2076 0.00137
NP_442533.1_6 Reverse -229 -238 4.22796 0.186
NP_442232.1_3 Forward -239 -220 -11.5053 0.282
NP_442535.1_6 Reverse -185 -203 15.7609 0.262
NP_441482.1_7 Reverse -216 -230 6.09611 0.0343
NP_439944.1_8 Reverse -282 -301 13.4708 0.238
NP_439944.1_9 Reverse -223 -233 10.4031 0.0887
NP_439944.1_9 Forward -230 -220 10.3048 0.0887
NP_442269.1_10 Reverse -160 -179 4.916 0.241
NP_442202.1_4 Forward -233 -219 15.1623 0.194
NP_442202.1_6 Forward -331 -312 1.27776 0.265
NP_441527.1_4 Reverse -59 -78 -12.2711 0.285
NP_441680.1_4 Forward -173 -154 -3.54046 0.299
NP_441961.1_4 Forward -239 -220 6.98095 0.27
NP_441106.1_1 Reverse -221 -230 18.191 0.0028
NP_441106.1_1 Forward -232 -223 18.191 0.0028
NP_441420.1_1 Reverse -221 -240 0.196116 0.219
NP_440429.1_2 Reverse -223 -242 8.06259 0.274
NP_442306.1_10 Reverse -217 -236 -20.4534 0.21
NP_441186.1_5 Reverse -286 -305 17.1404 0.193
NP_441286.1_1 Reverse -221 -233 5.25052 0.0259
NP_441286.1_1 Forward -232 -220 4.95553 0.027
NP_441286.1_1 Reverse -139 -151 -6.15587 0.251
NP_442674.1_3 Reverse -14 -33 2.6536 0.3
NP_440670.1_8 Forward -231 -222 18.3876 0.000699
NP_440670.1_8 Reverse -222 -231 18.3876 0.000699
NP_440886.1_7 Forward -232 -222 17.7774 0.0011
NP_440886.1_7 Reverse -221 -231 17.7774 0.0011
NP_440886.1_7 Reverse -228 -238 4.30615 0.243
NP_442614.1_2 Forward -149 -135 6.98109 0.276
NP_439995.1_5 Reverse -212 -231 4.916 0.283
NP_442072.1_9 Reverse -221 -239 -3.42244 0.0355
NP_442072.1_9 Forward -239 -221 -13.5505 0.115
NP_442072.1_9 Forward -232 -214 -14.3372 0.142
NP_440907.2_8 Reverse -223 -233 17.4824 0.00685
NP_440907.2_8 Forward -230 -220 7.84605 0.117
NP_440907.2_8 Reverse -141 -151 5.78111 0.188
NP_441021.1_1 Reverse -223 -242 -3.3438 0.154
NP_441021.1_8 Reverse -217 -235 2.18243 0.251
NP_440193.1_1 Forward -189 -170 13.9877 0.292
NP_441463.1_3 Reverse -212 -231 -1.67217 0.145
NP_441626.1_2 Forward -230 -223 15.7721 0.0124
NP_441626.1_2 Reverse -223 -230 15.7721 0.0124
NP_442615.1_1 Forward -240 -222 5.23069 0.0398
NP_441962.1_4 Forward -236 -217 1.37609 0.103
NP_441962.1_4 Forward -239 -220 -14.1602 0.284
NP_440387.1_1 Forward -231 -215 23.2646 0.00161
NP_440387.1_1 Reverse -222 -238 17.3648 0.0044
NP_441431.1_2 Forward -234 -220 9.43874 0.186
NP_441993.1_1 Reverse -222 -241 0.874656 0.29
NP_441174.1_1 Reverse -349 -364 12.8613 0.231
NP_440114.1_10 Reverse -222 -236 15.9292 0.0214
NP_440114.1_10 Forward -231 -217 10.7177 0.138
NP_441817.1_10 Forward -236 -217 12.1925 0.244
NP_442324.1_1 Forward -294 -275 12.2908 0.264
NP_440287.1_6 Forward -80 -61 2.75272 0.228
NP_441720.1_2 Forward -235 -216 8.25844 0.213
NP_440766.1_4 Forward -235 -221 8.25939 0.0871
NP_440422.1_10 Reverse -313 -332 8.17758 0.212
NP_440458.1_1 Reverse -79 -98 7.37428 0.105
NP_439910.1_2 Reverse -214 -231 -13.3342 0.162
NP_442867.1_8 Forward -179 -160 6.68596 0.257
NP_440457.1_1 Forward -242 -230 9.67541 0.092
NP_440457.1_1 Reverse -218 -230 9.57708 0.092
NP_440457.1_1 Forward -235 -223 7.90546 0.101
NP_440457.1_1 Reverse -354 -366 7.4138 0.105
NP_440457.1_1 Reverse -343 -355 1.41561 0.239
NP_440798.1_2 Reverse -203 -217 15.6336 0.235
NP_440798.1_6 Reverse -223 -236 2.77255 0.16
NP_441984.1_3 Reverse -347 -365 6.90232 0.261
NP_441984.1_3 Reverse -281 -299 5.91901 0.276
NP_441332.1_6 Reverse -235 -245 12.6149 0.221
NP_442509.1_9 Forward -231 -221 16.2041 0.00739
NP_442509.1_9 Reverse -222 -232 16.2041 0.00739
NP_441440.1_1 Forward -243 -224 8.55425 0.284
NP_440554.1_4 Forward -230 -220 14.6313 0.02
NP_440554.1_4 Reverse -223 -233 13.943 0.0218
NP_441845.1_6 Forward -243 -225 0.412472 0.274
NP_441885.1_5 Forward -231 -221 11.4848 0.00668
NP_441885.1_5 Reverse -222 -232 11.4848 0.00668
NP_440478.1_4 Forward -248 -229 12.2908 0.235
NP_442341.1_7 Reverse -221 -235 12.291 0.0455
NP_442341.1_7 Forward -232 -218 9.34103 0.0751
NP_442341.1_7 Reverse -372 -386 4.62115 0.185
NP_442395.2_4 Reverse -221 -240 5.40686 0.162
NP_440423.1_6 Forward -239 -220 -12.6852 0.198
NP_443000.1_7 Reverse -220 -230 8.73149 0.0437
NP_443000.1_7 Forward -233 -223 2.04498 0.226
NP_440507.2_6 Forward -261 -242 15.5357 0.235
NP_441842.1_10 Forward -238 -224 7.47274 0.257
NP_440275.1_3 Forward -233 -223 17.9746 0.0082
NP_440275.1_3 Reverse -220 -230 8.4365 0.0602
NP_440091.1_1 Forward -235 -223 22.0651 0.00953
NP_440091.1_1 Reverse -218 -230 10.8554 0.0429
NP_443010.1_10 Forward -234 -217 9.24526 0.143
NP_441359.1_5 Reverse -219 -238 4.916 0.204
NP_442451.1_2 Forward -239 -220 -11.6036 0.297
NP_439962.1_4 Reverse -229 -248 -6.39206 0.283
NP_439962.1_4 Forward -239 -220 -8.752 0.298
NP_440149.1_8 Forward -231 -212 -4.42544 0.207
NP_441105.1_3 Reverse -167 -186 -3.83545 0.185
NP_441105.1_3 Forward -242 -223 -9.44032 0.289
NP_441105.1_3 Forward -21 -2 -9.53865 0.29
NP_442373.1_2 Forward -252 -233 -11.2103 0.293
NP_440216.1_1 Reverse -222 -236 7.57108 0.00935
NP_440216.1_1 Forward -231 -217 6.58777 0.0145
NP_440216.1_1 Reverse -229 -243 -4.22864 0.103
NP_440216.1_1 Forward -238 -224 -11.4068 0.184
NP_440216.1_1 Forward -363 -349 -12.6851 0.296
NP_440216.1_9 Reverse -52 -61 13.3727 0.197
NP_440172.1_1 Forward -231 -221 8.73149 0.0586
NP_440172.1_1 Reverse -222 -232 8.73149 0.0586
NP_440172.1_1 Reverse -311 -321 5.09324 0.153
NP_440172.1_1 Reverse -178 -188 2.92996 0.258
NP_442015.1_10 Reverse -218 -231 0.805932 0.218
NP_441226.1_7 Forward -230 -223 14.4934 0.0123
NP_441226.1_7 Reverse -223 -230 14.4934 0.0123
NP_441111.1_7 Forward -230 -222 18.7023 0.00294
NP_441111.1_7 Reverse -223 -231 18.7023 0.00294
NP_442379.1_10 Forward -238 -221 0.0388413 0.223
NP_441766.1_2 Forward -231 -222 17.5026 0.00297
NP_441766.1_2 Reverse -222 -231 17.5026 0.00297
NP_442417.1_5 Forward -231 -217 12.586 0.0953
NP_440416.1_1 Reverse -222 -241 -14.4552 0.288
NP_443052.1_8 Forward -241 -222 -8.85033 0.179
NP_443052.1_9 Reverse -230 -249 0.0977854 0.203
NP_440591.1_9 Forward -238 -220 6.11567 0.228
NP_440261.1_5 Reverse -223 -236 -10.6005 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATCGTTCTTTTTACTGTACAGATTGACAACCATTCCAGCGCCCCCCGGTTGCACTCCTAATGGTTCTAGATCACCGTAAAAAAATCGCCTCAATTGGTCTCCACTGCCTGTTTTTCCTTTACTGGCGATAATAAGTTCGATCTGTTCTTGGCTTGCCGAAGGGGGAGCGGCGATCGCCGTACTTTGAGTTTGGGGTAGAAAACTGTGAAGGGCGACATCTCCTAGGCCAATCATGCCAGCCAGAATAAGGGGGGTTAGCAAAGAACTAACGGTTTTTAGTCTTAACATCGAGTTTTTAGGAATGGGAATTATTGATTGAGATATCATTGCCTGTTTTTTTTTCGATGGGAAGCCGGCAAAATAGAATATGCCATATGCCAGATTGGAATAGGTATTGCG

CDS

ATGGATCGTCTTGCTTGTATGCAGAGCTTTGTTCGAGCAATTGAAATGAATAGCTTTTCCGCCGCCGCGAGGGAGCAACAAACAACTCAACCAACTATCAGTAAACAAATTGCCGCCTTGGAAAAATATCTGGGGGTACGGTTAATCACTCGCTCCACTACCAAACTAAATTTGACAGAGGAAGGGAAACAATATTATCAATACTGTCAACAAATTTTAGAAACAGTTGCTGAAGCTGAAGCAAGTTTAGAAGGTAAAGAAAAAGCCGTTGGCACCTTACGGCTGGGTTGTTCAGTCCTATTCGGCGAAATGCAAATTGTGCCCCGCTTAAGTCTGTTTATCGCCCGTTATCCCCAGGTCAAAATAGATTTAATGATGGCCGACTATTTTGTTGATATGGTGCAGGAAGGACTAGATCTTGCTATTCGTATTGGAAATCATCAAGATAAGGCTCTAATTAGTGAAAGAATTGGTATTACTCGTCGTGTAACAGTCGCCAGTACCAGTTATTTTGAAAAATCAGGAGAACCGAAAACACCAGAGGAATTGACCAGACACAACTGTATTGTATACACATCCTTGTCCACCATTAATGAATGGCATTTTCATGGAAAAAATGGAGTCATTGCAATCAATGTTAAAGGTAGTTTTCAAACCAATAGCTCCGTTGCTGTGCGAGCCGCAGTTTTATCAGATTTAGGCATTGCAATTGCTCCCATCTGGATGTTTGGTGACGATATTTACCAGGGGAATCTTAAAGTTGTTTTACAGGATTATCAACCCGTCCCTTTTCCCATTTATGCGGTCTATCGTCGCAGTCGCTTTTATCCTGCCAAAGTTCATTGCTTTATTGATTTTTTGCGGGAAGAATTTAAGCTAGATCCCTGGGTTTCTGATTATGGTGTTTAG

Protein

MDRLACMQSFVRAIEMNSFSAAAREQQTTQPTISKQIAALEKYLGVRLITRSTTKLNLTEEGKQYYQYCQQILETVAEAEASLEGKEKAVGTLRLGCSVLFGEMQIVPRLSLFIARYPQVKIDLMMADYFVDMVQEGLDLAIRIGNHQDKALISERIGITRRVTVASTSYFEKSGEPKTPEELTRHNCIVYTSLSTINEWHFHGKNGVIAINVKGSFQTNSSVAVRAAVLSDLGIAIAPIWMFGDDIYQGNLKVVLQDYQPVPFPIYAVYRRSRFYPAKVHCFIDFLREEFKLDPWVSDYGV