Your browser is old and dusty. Try Google Chrome!

Details for slr1236

ORF slr1236
Accession NP_440843.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -301 -282 -21.9284 0.163
NP_441418.1_6 Forward -289 -270 -22.5183 0.179
NP_441480.1_1 Forward -43 -24 12.1925 0.108
NP_440897.1_6 Reverse -102 -121 -1.18128 0.187
NP_441453.1_4 Forward -345 -337 14.8674 0.00947
NP_441453.1_4 Reverse -336 -344 6.80426 0.121
NP_441453.1_7 Reverse -256 -263 12.9205 0.23
NP_441630.1_3 Forward -353 -334 -1.08219 0.291
NP_440120.1_4 Forward -261 -247 19.5675 0.0521
NP_442173.1_1 Reverse -337 -345 13.8841 0.0225
NP_442173.1_1 Forward -344 -336 12.0158 0.0316
NP_442752.1_4 Reverse -336 -343 13.8055 0.0199
NP_442752.1_4 Forward -195 -188 12.1338 0.0546
NP_442752.1_4 Reverse -11 -18 5.54565 0.194
NP_443027.1_4 Reverse -9 -19 6.46988 0.275
NP_442975.1_10 Forward -112 -98 5.01387 0.234
NP_441225.1_1 Reverse -78 -97 -1.27885 0.149
NP_440784.1_7 Reverse -337 -344 6.23397 0.241
NP_440784.1_7 Forward -344 -337 6.13563 0.241
NP_442909.1_7 Reverse -289 -303 5.99717 0.258
NP_442909.1_7 Forward -19 -5 5.80051 0.269
NP_440061.1_9 Reverse -288 -302 9.43874 0.145
NP_440061.1_9 Reverse -104 -118 6.98048 0.223
NP_440061.1_9 Reverse -289 -303 4.91554 0.3
NP_442062.1_8 Reverse -336 -346 7.94484 0.0848
NP_441859.1_2 Reverse -245 -264 10.4217 0.266
NP_440304.1_4 Reverse -216 -226 3.32329 0.299
NP_441035.1_3 Reverse -98 -117 -0.688862 0.297
NP_441208.1_9 Forward -292 -278 9.63603 0.207
NP_441208.1_9 Forward -348 -334 8.65272 0.219
NP_440132.1_1 Forward -303 -285 10.0489 0.223
NP_442110.1_7 Forward -223 -209 2.06454 0.222
NP_441925.1_4 Reverse -287 -306 -7.27777 0.194
NP_441925.1_4 Forward -118 -99 -12.9809 0.257
NP_440769.1_8 Reverse -366 -385 15.9291 0.148
NP_440856.1_4 Reverse -329 -348 1.67108 0.157
NP_441083.1_5 Reverse -336 -346 6.96153 0.0717
NP_441083.1_5 Forward -345 -335 0.766681 0.218
NP_441083.1_5 Forward -20 -10 -0.904945 0.283
NP_442115.2_7 Reverse -293 -310 8.29864 0.204
NP_441738.1_2 Forward -343 -336 15.28 0.0102
NP_441558.1_5 Reverse -334 -353 6.98095 0.198
NP_440209.1_1 Reverse -336 -344 8.57422 0.0425
NP_440447.1_5 Forward -266 -256 11.7798 0.291
NP_441716.1_1 Forward -20 -6 12.4876 0.0769
NP_442111.1_4 Forward -346 -332 8.45605 0.0744
NP_440906.1_5 Reverse -337 -344 6.23397 0.234
NP_440906.1_5 Forward -344 -337 6.13563 0.241
NP_440012.1_6 Forward -300 -281 7.66927 0.247
NP_440747.1_10 Reverse -333 -345 -2.4193 0.0434
NP_440747.1_10 Forward -292 -280 -12.0557 0.199
NP_440944.1_2 Forward -375 -356 2.3594 0.249
NP_442634.1_4 Forward -291 -277 4.22782 0.0819
NP_440470.1_5 Reverse -365 -384 10.1695 0.204
NP_440403.1_4 Reverse -2 -21 2.0644 0.13
NP_440403.1_4 Reverse -209 -228 -6.49039 0.234
NP_440403.1_4 Forward -358 -339 -6.68705 0.235
NP_440842.1_10 Reverse -107 -121 3.14618 0.266
NP_441014.1_10 Forward -319 -300 0.195343 0.245
NP_442848.1_1 Reverse -5 -19 -2.75368 0.263
NP_442848.1_9 Reverse -286 -305 -1.37718 0.289
NP_441012.1_4 Reverse -288 -301 7.98409 0.272
NP_443018.1_3 Forward -344 -337 11.7405 0.0655
NP_443018.1_3 Reverse -337 -344 5.44732 0.193
NP_440376.1_1 Reverse -336 -345 5.89959 0.116
NP_440376.1_1 Forward -289 -280 4.52295 0.156
NP_440376.1_1 Forward -301 -292 2.26134 0.228
NP_440376.1_1 Forward -345 -336 -0.0986038 0.285
NP_440376.1_1 Forward -203 -194 -0.68859 0.291
NP_442687.1_7 Reverse -335 -345 5.78156 0.188
NP_442485.1_3 Forward -300 -281 -4.72043 0.285
NP_441846.1_10 Forward -202 -183 -22.9117 0.271
NP_441763.1_10 Reverse -269 -288 8.4551 0.216
NP_440360.1_10 Forward -109 -95 11.5043 0.16
NP_442782.1_2 Reverse -280 -294 1.08123 0.282
NP_442782.1_2 Reverse -1 -15 0.786239 0.284
NP_441414.1_9 Reverse -300 -319 -5.40875 0.176
NP_440184.1_5 Reverse -1 -20 7.57094 0.224
NP_441487.1_9 Forward -119 -100 -1.86883 0.289
NP_441958.1_5 Reverse -335 -345 17.6796 0.00183
NP_441958.1_5 Forward -346 -336 0.963343 0.12
NP_440203.1_5 Forward -17 -7 10.501 0.224
NP_439905.1_1 Forward -110 -97 7.09911 0.268
NP_440984.1_7 Forward -350 -336 6.3911 0.217
NP_440984.1_7 Reverse -288 -302 5.70279 0.245
NP_440984.1_7 Reverse -331 -345 5.30946 0.259
NP_442690.1_1 Forward -162 -143 -16.5201 0.289
NP_442690.1_1 Reverse -364 -383 -17.2085 0.298
NP_442911.1_2 Forward -282 -263 -10.7186 0.286
NP_440993.1_4 Reverse -379 -396 6.33202 0.246
NP_440602.1_2 Forward -350 -331 2.16274 0.263
NP_439975.1_3 Forward -258 -245 16.7355 0.201
NP_442567.1_4 Forward -279 -260 13.0775 0.273
NP_441938.1_10 Forward -186 -168 13.2938 0.236
NP_441294.1_7 Forward -349 -335 10.4025 0.191
NP_441646.1_7 Reverse -287 -301 15.5359 0.243
NP_441000.1_6 Forward -346 -332 -4.03198 0.225
NP_441674.1_10 Forward -43 -25 -0.0791831 0.29
NP_440147.1_4 Forward -347 -334 8.37742 0.0518
NP_440147.1_4 Reverse -334 -347 6.80412 0.0829
NP_441550.1_8 Reverse -334 -344 14.5325 0.0141
NP_441550.1_8 Forward -347 -337 11.8776 0.0415
NP_441916.1_7 Forward -345 -335 10.0098 0.0283
NP_441916.1_7 Reverse -336 -346 5.09324 0.146
NP_441041.1_4 Forward -301 -282 -12.4886 0.266
NP_441041.1_7 Reverse -333 -345 6.44582 0.21
NP_442004.1_6 Reverse -186 -200 3.14618 0.248
NP_439966.1_7 Reverse -334 -344 4.60114 0.265
NP_439966.1_7 Reverse -298 -308 4.50281 0.269
NP_442941.1_3 Forward -344 -334 9.41981 0.0319
NP_440983.1_5 Reverse -14 -33 -2.55715 0.231
NP_440260.1_8 Forward -298 -280 -4.99573 0.273
NP_440260.1_8 Forward -65 -47 -6.76569 0.295
NP_442281.1_1 Forward -350 -336 11.7003 0.0438
NP_442281.1_1 Reverse -331 -345 3.44058 0.231
NP_441334.1_7 Reverse -278 -297 -21.0434 0.287
NP_442256.1_2 Forward -347 -329 -9.22396 0.254
NP_442012.1_1 Reverse -286 -305 5.211 0.153
NP_442012.1_1 Reverse -5 -24 1.76941 0.212
NP_441457.1_7 Reverse -278 -297 -0.197208 0.288
NP_441644.1_6 Forward -345 -335 16.4008 0.00405
NP_442215.1_2 Reverse -341 -357 -6.92296 0.281
NP_442247.1_8 Reverse -334 -348 10.3243 0.247
NP_440929.1_8 Forward -345 -336 7.17789 0.0713
NP_442933.1_10 Forward -345 -336 8.06287 0.0885
NP_442933.1_10 Reverse -336 -345 7.96454 0.0937
NP_442554.1_8 Forward -344 -334 7.45319 0.092
NP_442554.1_8 Reverse -337 -347 2.24165 0.276
NP_441762.1_7 Forward -346 -334 -6.35254 0.284
NP_442142.1_4 Reverse -283 -296 6.90188 0.153
NP_442292.1_1 Forward -344 -335 7.66954 0.0634
NP_441523.1_6 Reverse -276 -295 8.55425 0.19
NP_441523.1_6 Reverse -7 -26 3.53937 0.272
NP_443009.1_5 Forward -196 -185 6.44969 0.161
NP_443009.1_5 Reverse -335 -346 6.25303 0.169
NP_442301.1_2 Reverse -285 -304 3.44025 0.294
NP_442408.2_7 Reverse -55 -74 19.764 0.0726
NP_441715.1_4 Forward -344 -334 6.96153 0.121
NP_441448.1_1 Reverse -91 -110 12.4875 0.169
NP_440183.1_9 Reverse -249 -268 -14.6519 0.267
NP_441468.1_1 Reverse -337 -344 6.13563 0.209
NP_441468.1_1 Forward -344 -337 6.0373 0.223
NP_441020.2_6 Forward -303 -286 8.98696 0.182
NP_441015.1_10 Reverse -97 -116 -11.3086 0.294
NP_441673.1_1 Forward -345 -336 1.27803 0.155
NP_441673.1_1 Reverse -336 -345 1.27803 0.155
NP_441673.1_1 Reverse -280 -289 -8.06341 0.254
NP_441731.1_3 Reverse -328 -347 -4.52377 0.284
NP_441876.1_9 Forward -145 -135 14.7292 0.267
NP_441826.1_2 Reverse -337 -351 -1.47537 0.248
NP_441826.1_2 Reverse -212 -226 -2.95034 0.28
NP_441330.1_1 Reverse -331 -350 -12.8819 0.183
NP_441637.1_9 Reverse -239 -257 -4.01242 0.296
NP_442868.1_6 Reverse -334 -344 0.668351 0.213
NP_442719.1_2 Forward -158 -140 7.3932 0.119
NP_442719.1_2 Reverse -239 -257 6.31156 0.135
NP_443058.1_7 Forward -36 -17 10.3242 0.206
NP_442808.1_1 Reverse -185 -195 3.51951 0.238
NP_441101.1_10 Reverse -287 -306 -4.91709 0.281
NP_440031.1_10 Forward -264 -245 6.98095 0.237
NP_442542.1_2 Reverse -100 -113 13.6873 0.114
NP_440558.1_2 Forward -298 -279 -4.52377 0.246
NP_441878.1_6 Forward -346 -336 0.668351 0.139
NP_441878.1_6 Reverse -101 -111 -6.50981 0.191
NP_441878.1_6 Forward -302 -292 -6.90313 0.198
NP_441036.1_8 Reverse -335 -345 10.5014 0.167
NP_441036.1_8 Reverse -185 -195 5.28991 0.295
NP_441557.1_5 Reverse -336 -345 8.94785 0.0289
NP_441557.1_5 Forward -345 -336 0.688044 0.128
NP_441590.1_4 Reverse -21 -40 10.6184 0.249
NP_441308.1_8 Forward -95 -85 8.92815 0.24
NP_442347.1_2 Forward -19 -10 17.7976 0.056
NP_442594.1_8 Forward -212 -193 2.55606 0.295
NP_442508.1_8 Forward -36 -19 16.4601 0.223
NP_441633.1_3 Forward -229 -216 -5.09393 0.223
NP_440136.1_2 Reverse -337 -344 6.23397 0.171
NP_440136.1_2 Forward -344 -337 6.13563 0.193
NP_442590.1_10 Forward -41 -22 3.34271 0.294
NP_442998.1_10 Forward -343 -336 15.5754 0.0102
NP_440899.1_1 Reverse -82 -101 8.60263 0.23
NP_441799.1_1 Forward -349 -335 14.5519 0.0228
NP_441799.1_4 Forward -110 -91 -3.04881 0.203
NP_441007.1_10 Reverse -97 -110 -0.177378 0.268
NP_442334.1_2 Forward -204 -187 -13.7275 0.297
NP_442201.1_10 Forward -356 -337 -8.55534 0.221
NP_442333.2_5 Forward -356 -337 -15.5368 0.298
NP_440256.1_1 Reverse -333 -352 -9.34199 0.278
NP_441559.1_8 Forward -294 -280 9.2427 0.0659
NP_441559.1_8 Forward -15 -1 2.2612 0.147
NP_440915.1_6 Reverse -332 -346 -0.590395 0.202
NP_440997.1_6 Reverse -6 -25 17.3057 0.0808
NP_441296.1_9 Forward -14 -1 8.86849 0.289
NP_440717.1_3 Reverse -189 -203 10.9137 0.23
NP_442785.1_7 Reverse -334 -348 11.111 0.228
NP_441464.1_8 Reverse -292 -306 17.6992 0.072
NP_441464.1_10 Forward -31 -17 9.5377 0.262
NP_441464.1_10 Forward -213 -199 9.34103 0.262
NP_441340.1_5 Reverse -337 -344 13.5105 0.0314
NP_441340.1_5 Forward -344 -337 5.84064 0.208
NP_442240.1_2 Forward -33 -14 -0.590531 0.0609
NP_442240.1_2 Reverse -341 -360 -6.29373 0.114
NP_442950.1_1 Reverse -312 -331 -1.57384 0.206
NP_442950.1_1 Forward -252 -233 -6.09707 0.3
NP_440586.1_1 Forward -305 -286 -4.6221 0.278
NP_440586.1_1 Forward -296 -277 -5.11376 0.28
NP_440586.1_8 Forward -344 -337 9.47853 0.146
NP_440586.1_8 Reverse -337 -344 5.74197 0.283
NP_442959.1_5 Forward -246 -227 12.8808 0.222
NP_442959.1_7 Reverse -192 -211 -5.50708 0.299
NP_441262.1_3 Reverse -336 -343 14.7888 0.0223
NP_443051.1_1 Reverse -335 -344 16.6177 0.00754
NP_443051.1_1 Forward -346 -337 -1.08191 0.281
NP_439996.1_2 Reverse -210 -229 5.60432 0.244
NP_439937.1_9 Reverse -246 -263 -14.5148 0.287
NP_439937.1_9 Reverse -10 -27 -15.9897 0.287
NP_440926.1_9 Forward -130 -111 10.1275 0.275
NP_440439.1_1 Reverse -333 -346 18.5055 0.0105
NP_440372.1_2 Reverse -337 -344 13.8055 0.0214
NP_440372.1_2 Forward -344 -337 6.52896 0.188
NP_441789.1_7 Reverse -177 -196 7.86512 0.193
NP_440819.1_5 Reverse -115 -123 7.59091 0.272
NP_441803.1_2 Reverse -94 -113 -1.27885 0.297
NP_441803.1_10 Forward -302 -288 13.6676 0.295
NP_442384.1_10 Forward -345 -332 6.31247 0.105
NP_442384.1_10 Reverse -280 -293 2.57589 0.22
NP_442384.1_10 Forward -20 -7 0.314277 0.294
NP_441877.1_9 Reverse -361 -378 13.3135 0.127
NP_441877.1_9 Forward -165 -148 1.61214 0.297
NP_442262.1_10 Forward -344 -337 13.2155 0.0213
NP_441689.1_5 Reverse -334 -344 5.78111 0.197
NP_440531.1_6 Forward -219 -200 -0.4922 0.214
NP_440531.1_8 Forward -130 -111 22.1239 0.0383
NP_441965.1_3 Forward -308 -289 1.76941 0.219
NP_442693.1_6 Reverse -274 -293 9.3409 0.278
NP_441896.1_5 Forward -29 -22 15.3787 0.268
NP_440894.1_10 Forward -25 -6 15.2408 0.0889
NP_441679.1_1 Forward -262 -243 1.47442 0.152
NP_441894.1_1 Reverse -107 -126 -4.03212 0.191
NP_440999.1_1 Reverse -17 -36 1.6703 0.259
NP_440999.1_9 Forward -353 -339 3.73617 0.124
NP_440888.1_2 Forward -345 -331 9.43874 0.127
NP_440888.1_2 Forward -289 -275 9.24208 0.134
NP_440888.1_2 Forward -20 -6 5.30886 0.284
NP_440600.1_4 Forward -353 -335 -2.43913 0.197
NP_442033.1_10 Forward -22 -3 -9.14533 0.212
NP_440575.1_1 Reverse -161 -180 -3.44288 0.294
NP_441543.1_2 Forward -344 -335 6.09625 0.153
NP_441551.1_5 Forward -349 -333 7.62932 0.243
NP_441178.1_6 Reverse -199 -218 1.6703 0.279
NP_441319.1_9 Forward -345 -326 19.0757 0.201
NP_442315.1_2 Forward -208 -196 15.5753 0.27
NP_443064.1_6 Reverse -186 -196 11.3065 0.13
NP_443064.1_6 Reverse -336 -346 9.07643 0.247
NP_443064.1_6 Reverse -11 -21 8.30077 0.3
NP_442578.1_7 Reverse -337 -344 6.0373 0.18
NP_440710.1_1 Forward -119 -101 -8.04399 0.254
NP_441462.1_2 Reverse -336 -346 17.3846 0.00406
NP_441462.1_2 Forward -345 -335 0.668351 0.135
NP_443062.1_1 Forward -345 -327 14.2989 0.0493
NP_443062.1_6 Reverse -68 -87 6.29264 0.183
NP_442204.1_1 Reverse -332 -343 11.3667 0.0565
NP_442204.1_1 Forward -293 -282 1.4353 0.271
NP_440516.1_6 Reverse -192 -206 10.0287 0.233
NP_440516.1_8 Reverse -336 -345 9.4395 0.0183
NP_440516.1_8 Forward -345 -336 5.11294 0.118
NP_442428.1_5 Reverse -337 -344 6.13563 0.209
NP_442428.1_5 Forward -344 -337 6.0373 0.212
NP_442120.1_10 Forward -295 -276 -14.5535 0.288
NP_440673.1_3 Forward -343 -336 12.4288 0.0426
NP_441052.1_2 Forward -20 -10 5.97822 0.0968
NP_442219.1_9 Forward -19 -10 1.76968 0.298
NP_440436.1_4 Reverse -337 -346 5.11253 0.222
NP_441884.1_9 Forward -23 -4 -24.0916 0.284
NP_442864.1_7 Forward -264 -246 5.52568 0.274
NP_441719.1_4 Reverse -337 -344 6.82395 0.0855
NP_441719.1_4 Forward -344 -337 6.52896 0.188
NP_441733.1_10 Reverse -333 -346 3.75586 0.288
NP_441004.1_1 Forward -307 -288 -9.34199 0.206
NP_441004.1_1 Reverse -135 -154 -17.4051 0.291
NP_441004.1_1 Forward -262 -243 -18.0934 0.297
NP_442366.1_3 Forward -346 -328 -0.7675 0.199
NP_442366.1_5 Forward -348 -338 9.91099 0.298
NP_442206.1_1 Forward -111 -92 36.3819 0.00000866
NP_440328.1_4 Forward -351 -332 12.5858 0.0513
NP_440328.1_4 Reverse -330 -349 4.22769 0.168
NP_440328.1_4 Reverse -5 -24 -0.787193 0.289
NP_443054.1_2 Forward -354 -340 0.294584 0.269
NP_443054.1_2 Forward -229 -215 -0.492064 0.295
NP_440864.1_3 Forward -105 -86 21.7306 0.0176
NP_440864.1_9 Forward -219 -200 -5.21209 0.231
NP_441851.1_10 Forward -196 -186 5.78156 0.2
NP_442001.1_4 Forward -242 -223 14.7483 0.189
NP_441542.1_4 Forward -156 -142 3.14618 0.291
NP_442515.1_1 Reverse -10 -24 3.04785 0.125
NP_442515.1_1 Reverse -11 -25 1.76955 0.149
NP_442515.1_1 Reverse -291 -305 -4.13031 0.298
NP_441396.1_5 Forward -308 -299 8.75118 0.21
NP_440593.1_9 Reverse -288 -302 7.47274 0.29
NP_440463.1_7 Forward -144 -130 14.8476 0.296
NP_440338.1_4 Reverse -153 -172 6.98015 0.285
NP_440389.1_2 Forward -203 -184 16.4207 0.241
NP_440432.1_9 Forward -344 -329 -3.06836 0.179
NP_440432.1_9 Forward -226 -211 -4.83832 0.224
NP_440432.1_9 Reverse -248 -263 -5.42831 0.248
NP_441477.1_10 Forward -21 -3 1.29745 0.264
NP_440588.1_2 Forward -26 -7 -1.67217 0.156
NP_441031.1_1 Forward -374 -355 4.60539 0.288
NP_439950.1_1 Reverse -262 -271 16.126 0.145
NP_442006.1_2 Forward -265 -248 0.727158 0.124
NP_442006.1_2 Reverse -93 -110 -16.8741 0.265
NP_440483.1_1 Forward -34 -15 -6.78538 0.252
NP_441570.1_1 Forward -20 -2 -11.5839 0.198
NP_441078.1_4 Reverse -336 -345 0.0980582 0.205
NP_441078.1_4 Forward -345 -336 0.0980582 0.205
NP_442729.1_8 Reverse -289 -302 7.09911 0.166
NP_441663.1_8 Reverse -180 -199 -2.0655 0.258
NP_442348.1_2 Forward -63 -54 12.5861 0.218
NP_442443.1_1 Forward -297 -278 -1.57384 0.237
NP_442443.1_1 Forward -264 -245 -3.04881 0.264
NP_440526.1_3 Forward -226 -215 6.54802 0.195
NP_441432.1_8 Reverse -335 -344 14.0611 0.0258
NP_441432.1_8 Reverse -279 -288 5.3096 0.17
NP_440497.1_6 Reverse -20 -39 -7.4737 0.292
NP_441945.1_10 Forward -319 -300 8.16093 0.277
NP_441072.1_2 Reverse -325 -344 8.84924 0.231
NP_442489.1_7 Forward -345 -336 0.786375 0.152
NP_442489.1_7 Reverse -336 -345 0.589713 0.17
NP_442489.1_7 Forward -289 -280 -1.77023 0.247
NP_440559.1_1 Reverse -337 -346 14.651 0.0144
NP_442763.1_9 Reverse -167 -186 14.5516 0.184
NP_441659.2_8 Forward -345 -335 15.5163 0.006
NP_441659.2_8 Forward -111 -101 1.16001 0.248
NP_441659.2_8 Reverse -336 -346 0.176696 0.271
NP_440860.1_8 Forward -22 -3 13.7658 0.296
NP_441022.1_1 Forward -375 -366 13.081 0.216
NP_442008.1_2 Forward -348 -329 11.7992 0.113
NP_440779.1_5 Forward -345 -328 -6.25434 0.17
NP_442346.1_5 Reverse -335 -345 6.66654 0.195
NP_442346.1_5 Forward -346 -336 5.97822 0.219
NP_440545.1_3 Reverse -276 -293 -3.20608 0.201
NP_440545.1_3 Reverse -7 -24 -3.40274 0.203
NP_440545.1_3 Forward -115 -98 -4.97604 0.237
NP_440545.1_3 Forward -349 -332 -6.54933 0.283
NP_441856.1_7 Forward -318 -299 9.24257 0.292
NP_440025.1_1 Forward -253 -234 7.27595 0.243
NP_440459.1_3 Reverse -353 -372 8.06259 0.178
NP_441653.1_2 Reverse -175 -194 3.91615 0.264
NP_442603.1_7 Forward -20 -6 11.307 0.117
NP_441833.1_4 Forward -344 -337 6.52896 0.0924
NP_441833.1_4 Reverse -337 -344 6.23397 0.163
NP_440751.1_3 Reverse -184 -203 8.94676 0.264
NP_441895.1_10 Reverse -134 -153 -27.7299 0.29
NP_442162.1_9 Forward -344 -337 12.9205 0.0282
NP_442162.1_9 Reverse -337 -344 12.9205 0.0282
NP_442140.1_3 Reverse -41 -51 4.3066 0.248
NP_442140.1_3 Reverse -337 -347 4.0116 0.265
NP_440875.1_9 Forward -343 -333 16.5483 0.0145
NP_441813.1_5 Reverse -334 -344 8.4365 0.0432
NP_441813.1_5 Forward -347 -337 4.89658 0.143
NP_440073.1_2 Forward -276 -257 5.70265 0.234
NP_442497.1_10 Reverse -337 -346 8.25953 0.047
NP_442497.1_10 Forward -344 -335 7.76787 0.0731
NP_441239.1_9 Forward -347 -335 7.90546 0.147
NP_441239.1_9 Forward -112 -100 3.57889 0.283
NP_440156.1_4 Reverse -248 -258 16.4008 0.176
NP_441892.1_1 Forward -354 -337 5.15205 0.105
NP_441892.1_1 Reverse -209 -226 -4.77938 0.268
NP_442044.1_1 Reverse -6 -25 3.93269 0.131
NP_442044.1_9 Forward -289 -270 4.32602 0.23
NP_442643.1_3 Reverse -275 -294 5.70265 0.112
NP_440546.1_4 Reverse -336 -346 15.4756 0.0459
NP_440546.1_4 Forward -345 -335 11.6943 0.0748
NP_442041.1_5 Forward -351 -332 1.0811 0.257
NP_441509.1_1 Reverse -85 -104 11.7008 0.215
NP_440462.1_4 Reverse -86 -100 5.60446 0.29
NP_440462.1_6 Reverse -334 -344 9.22315 0.049
NP_442899.1_4 Forward -363 -347 6.2527 0.259
NP_442611.1_1 Forward -309 -290 7.47261 0.144
NP_442611.1_1 Forward -345 -326 -0.39387 0.266
NP_442592.1_2 Reverse -263 -282 4.81767 0.285
NP_440868.1_4 Reverse -332 -344 12.232 0.0245
NP_440401.1_9 Reverse -18 -25 14.5917 0.287
NP_441249.1_8 Forward -179 -160 1.76941 0.284
NP_442402.1_4 Forward -155 -136 -0.492971 0.189
NP_442402.1_4 Reverse -232 -251 -0.984623 0.189
NP_442402.1_4 Reverse -241 -260 -6.09781 0.25
NP_442402.1_6 Reverse -258 -267 13.1761 0.289
NP_442402.1_10 Forward -269 -259 11.091 0.269
NP_441843.2_4 Reverse -236 -255 19.0622 0.163
NP_440843.1_2 Forward -22 -3 18.7807 0.249
NP_440843.1_8 Forward -295 -276 17.699 0.233
NP_442039.1_4 Reverse -337 -344 11.6422 0.0747
NP_441811.1_8 Forward -26 -12 10.4227 0.219
NP_440008.1_9 Forward -201 -182 7.47261 0.283
NP_442409.1_10 Forward -321 -307 15.1419 0.293
NP_442837.1_3 Forward -19 -12 6.52896 0.2
NP_442837.1_3 Forward -344 -337 6.0373 0.25
NP_442837.1_3 Reverse -337 -344 6.0373 0.25
NP_442053.1_1 Forward -345 -336 7.17789 0.104
NP_440505.1_3 Reverse -334 -344 15.6147 0.0106
NP_441408.2_7 Reverse -278 -297 -3.63879 0.274
NP_440914.1_1 Forward -345 -335 13.1043 0.0386
NP_440914.1_1 Reverse -280 -290 9.39583 0.186
NP_441011.1_8 Reverse -337 -346 12.0944 0.0517
NP_441011.1_8 Forward -344 -335 6.78456 0.184
NP_441011.1_8 Forward -308 -299 5.50626 0.256
NP_442533.1_1 Forward -306 -287 -16.7168 0.275
NP_442533.1_6 Reverse -336 -345 5.40793 0.14
NP_442533.1_6 Reverse -292 -301 4.81794 0.172
NP_442533.1_6 Forward -345 -336 4.52295 0.179
NP_442533.1_6 Forward -115 -106 1.47469 0.298
NP_441089.1_10 Reverse -325 -344 7.96426 0.214
NP_442541.1_10 Reverse -247 -261 4.32555 0.252
NP_441108.1_2 Forward -158 -139 7.07928 0.245
NP_441028.1_6 Reverse -252 -262 10.9926 0.193
NP_441028.1_6 Reverse -173 -183 5.48612 0.255
NP_441028.1_6 Forward -39 -29 5.19112 0.265
NP_441028.1_6 Forward -19 -9 3.42118 0.296
NP_440115.1_6 Reverse -333 -343 14.0414 0.0615
NP_440115.1_6 Reverse -8 -18 5.38824 0.25
NP_440115.1_6 Forward -301 -291 4.60159 0.293
NP_442890.1_9 Reverse -3 -22 12.5858 0.254
NP_441972.1_5 Reverse -34 -53 -9.83364 0.293
NP_441106.1_1 Reverse -335 -344 8.75118 0.0469
NP_441869.1_2 Reverse -329 -348 9.83255 0.274
NP_439903.1_6 Forward -292 -273 6.58682 0.167
NP_440444.1_3 Forward -277 -258 0.786102 0.278
NP_441286.1_1 Reverse -10 -22 -4.68091 0.168
NP_441286.1_1 Forward -228 -216 -5.95921 0.235
NP_442674.1_3 Reverse -210 -229 3.63691 0.294
NP_440670.1_8 Reverse -336 -345 8.65285 0.0627
NP_440670.1_8 Forward -345 -336 6.29291 0.124
NP_439955.1_10 Reverse -41 -60 13.2733 0.258
NP_440886.1_7 Reverse -299 -309 6.37109 0.13
NP_440886.1_7 Reverse -193 -203 3.8145 0.265
NP_442614.1_2 Reverse -336 -350 6.29277 0.291
NP_442072.1_6 Reverse -60 -79 21.6314 0.141
NP_442022.1_4 Reverse -138 -157 5.40766 0.286
NP_440907.2_8 Forward -344 -334 7.84605 0.117
NP_440907.2_8 Reverse -12 -22 4.10949 0.278
NP_440907.2_8 Reverse -337 -347 3.8145 0.297
NP_442842.1_10 Forward -323 -304 2.11575 0.254
NP_441626.1_2 Reverse -337 -344 12.2322 0.0511
NP_441626.1_2 Forward -344 -337 5.93897 0.231
NP_442615.1_1 Reverse -327 -345 -3.22577 0.159
NP_440387.1_1 Forward -289 -273 -4.07137 0.174
NP_441431.1_2 Reverse -333 -347 14.1586 0.0714
NP_441993.1_1 Forward -312 -293 5.84498 0.194
NP_441993.1_1 Forward -295 -276 4.09075 0.225
NP_440114.1_10 Reverse -336 -350 12.6843 0.0754
NP_440114.1_10 Forward -345 -331 6.19444 0.282
NP_442698.1_10 Forward -260 -241 1.76941 0.296
NP_442357.1_3 Forward -221 -202 12.8808 0.171
NP_440293.1_3 Forward -30 -11 0.786102 0.214
NP_442835.1_2 Reverse -329 -348 17.3057 0.154
NP_439910.1_2 Forward -360 -343 -22.5773 0.267
NP_442867.1_8 Reverse -248 -267 7.27595 0.244
NP_440457.1_1 Reverse -332 -344 2.98891 0.204
NP_440798.1_6 Reverse -337 -350 13.3923 0.0445
NP_440798.1_6 Forward -344 -331 9.55739 0.0943
NP_441801.1_4 Forward -268 -258 12.3697 0.201
NP_442680.1_5 Reverse -8 -27 -0.904675 0.297
NP_442297.1_4 Forward -293 -274 15.1558 0.177
NP_441984.1_3 Reverse -15 -33 9.95058 0.195
NP_441332.1_6 Reverse -299 -309 13.4862 0.184
NP_442514.1_5 Forward -272 -253 -9.83437 0.298
NP_440554.1_4 Forward -344 -334 15.0247 0.02
NP_440554.1_4 Reverse -301 -311 2.14332 0.276
NP_441885.1_5 Reverse -336 -346 7.84651 0.0419
NP_441885.1_5 Forward -20 -10 -1.00328 0.248
NP_442341.1_7 Reverse -10 -24 2.85119 0.243
NP_442341.1_7 Forward -21 -7 1.08123 0.299
NP_442341.1_9 Reverse -334 -348 10.9137 0.133
NP_443000.1_7 Reverse -334 -344 10.5998 0.0345
NP_443000.1_7 Forward -291 -281 5.09324 0.15
NP_440076.1_5 Forward -266 -247 14.1583 0.237
NP_442513.1_5 Forward -294 -275 6.98015 0.282
NP_441842.1_10 Reverse -256 -270 10.3243 0.165
NP_440275.1_3 Reverse -334 -344 13.5497 0.0268
NP_442451.1_2 Reverse -111 -130 -10.7186 0.278
NP_439962.1_4 Reverse -292 -311 1.27776 0.197
NP_439962.1_4 Reverse -296 -315 -2.95047 0.242
NP_442373.1_2 Reverse -132 -151 -11.6036 0.297
NP_440216.1_1 Forward -345 -331 12.9793 0.00589
NP_440216.1_1 Reverse -336 -350 -3.04867 0.0682
NP_440216.1_1 Reverse -102 -116 -10.8168 0.148
NP_440216.1_9 Reverse -276 -285 7.27622 0.286
NP_440172.1_1 Reverse -336 -346 8.82982 0.0586
NP_440172.1_1 Forward -345 -335 4.89658 0.162
NP_440172.1_1 Reverse -280 -290 2.04498 0.286
NP_442371.1_1 Forward -261 -251 13.4509 0.206
NP_441852.1_7 Forward -26 -7 21.3373 0.0489
NP_442015.1_3 Reverse -298 -317 11.11 0.29
NP_442015.1_3 Reverse -290 -309 9.93006 0.296
NP_442015.1_10 Forward -392 -379 8.37742 0.067
NP_442015.1_10 Forward -349 -336 1.88757 0.204
NP_442015.1_10 Forward -100 -87 -1.16069 0.297
NP_441226.1_7 Reverse -337 -344 12.7234 0.0312
NP_441226.1_7 Forward -344 -337 11.5435 0.0757
NP_441757.1_2 Forward -273 -255 6.214 0.289
NP_441111.1_7 Forward -344 -336 8.86921 0.0589
NP_441766.1_2 Reverse -336 -345 8.1612 0.0645
NP_441766.1_2 Forward -345 -336 5.89959 0.103
NP_442252.1_4 Forward -301 -282 15.4374 0.235
NP_440416.1_9 Reverse -329 -348 1.0811 0.0481
NP_440416.1_9 Forward -316 -297 -18.6834 0.262
NP_443052.1_8 Forward -362 -343 -6.49039 0.143
NP_443052.1_9 Reverse -246 -265 0.0977854 0.203
NP_442116.1_6 Forward -384 -367 8.8374 0.238
NP_440845.1_1 Forward -250 -231 -6.49039 0.297
NP_442154.1_1 Forward -303 -285 -15.4188 0.218
NP_442564.1_10 Reverse -191 -205 11.406 0.258
NP_442564.1_10 Reverse -109 -123 9.83269 0.296
NP_440261.1_5 Forward -344 -331 -3.22564 0.12
NP_440261.1_5 Reverse -12 -25 -5.09393 0.185
NP_440261.1_5 Reverse -337 -350 -12.4687 0.297
NP_440988.1_10 Forward -104 -90 4.02751 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CAAACCCACCATTCGGAAGACCTTACAAAAAGTTTACGTAGATCAAACAGCAGTGACCGATCGCCTGGTGGAAGAAATTTATCGTCCTTCCTGTGATGGGGGGGCGGCCCAGGTGTTTGCCTCGGTGTTTAAATCTCCCCAGGGGGAAATGGTGGATAAACTCCTGGCTAAATTACAAGCGCCCCTGTTGGCTATTTGGGGACAGGGGGATCCTTGGATGCGGGTCAAGGAAAGGAGTGTTAAGTTTCGACAACATTACCCCCAACTAACGGAGCATTTTTTGCCGGCGGGCCACTGTCCCCACGACGAAGATCCGTCCACTGTCAATCAGTTAATGCGGGATTGGTTAGCTACCATTGGTTAGTCCCCTATGGTTTGGGGTTGATCCCCACCGTTTGCC

CDS

ATGACCCCATTGACTTTTCGTAACTTAGGTCAATCTAAAGCCCCATCTATTGCGCGGACTTTGGTAACCATTGGCTTGGGTATTGGATTGGCAATGGGGACGGTGGGGTGTAGCCCTAGTTATTCCCGATCGCCGCTGGTGGAATCTTTACCTCTGACGGCCAAGGTAACCATTGGTTCGGAAACAATTCTGTTGGAAGTCGCCACAACTCCTGCCCAGCAGGCCCAGGGCTTGATGTTTCGCACCGAACTAGCTGGTGATCGGGGGATGTTATTCACTTTTCCAGAACCCAGAATTGCCCGCTTTTGGATGAAAAATACCCTGATTCCCCTGGATATGATCTTTTTGCGGGATGGGCAAATTAAACAAATTATTACGAACGTTCCCCCCTGTAAAGCCGATCCTTGTCCCAACTACGGCCCCCTCAACCAAGAGGTTAACCAGGTGTTGGAGCTGGGGGCAGGACGGGCGCAGCAATTAGGTTTGGAAGTTGACCAAGTGCTGGAATTTTTGCCCCTGTCGGGTAGTTTATAG

Protein

MTPLTFRNLGQSKAPSIARTLVTIGLGIGLAMGTVGCSPSYSRSPLVESLPLTAKVTIGSETILLEVATTPAQQAQGLMFRTELAGDRGMLFTFPEPRIARFWMKNTLIPLDMIFLRDGQIKQIITNVPPCKADPCPNYGPLNQEVNQVLELGAGRAQQLGLEVDQVLEFLPLSGSL