Your browser is old and dusty. Try Google Chrome!

Details for slr1220

ORF slr1220
Accession NP_440823.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -10 -24 19.6658 0.0139
NP_441061.1_2 Forward -115 -101 2.85119 0.17
NP_441061.1_2 Forward -336 -322 1.37622 0.191
NP_440795.1_7 Forward -17 -10 14.6904 0.0123
NP_440795.1_7 Reverse -10 -17 14.6904 0.0123
NP_441418.1_6 Reverse -9 -28 -0.688862 0.0105
NP_441418.1_6 Reverse -368 -387 -29.6965 0.234
NP_442657.1_5 Forward -145 -131 19.2111 0.175
NP_442291.1_5 Reverse -8 -24 -1.71142 0.202
NP_440897.1_6 Reverse -15 -34 3.73524 0.142
NP_440897.1_6 Reverse -101 -120 -2.65624 0.219
NP_440897.1_6 Forward -291 -272 -4.32786 0.273
NP_441453.1_4 Reverse -9 -17 16.539 0.00633
NP_441453.1_4 Forward -18 -10 16.539 0.00633
NP_441453.1_4 Reverse -328 -336 5.23096 0.157
NP_441453.1_4 Reverse -107 -115 4.14932 0.264
NP_442151.1_6 Forward -337 -323 14.1593 0.0395
NP_442151.1_6 Forward -18 -4 8.06273 0.183
NP_442151.1_6 Forward -377 -363 5.50613 0.274
NP_441818.1_9 Forward -330 -311 -1.27885 0.2
NP_442169.1_1 Reverse -181 -200 -0.787193 0.262
NP_442169.1_1 Reverse -89 -108 -3.54046 0.295
NP_440259.1_4 Forward -267 -253 11.7209 0.255
NP_441098.1_3 Forward -156 -137 -6.02333 0.28
NP_442655.1_2 Forward -307 -288 14.5524 0.0601
NP_442173.1_1 Forward -17 -9 15.4574 0.00633
NP_442173.1_1 Reverse -10 -18 15.4574 0.00633
NP_442173.1_1 Forward -336 -328 9.45919 0.0825
NP_442752.1_4 Forward -18 -11 13.8055 0.0199
NP_442752.1_4 Reverse -9 -16 13.8055 0.0199
NP_443027.1_4 Forward -20 -10 14.828 0.0437
NP_441812.1_3 Reverse -8 -22 8.06273 0.254
NP_442975.1_10 Forward -22 -8 14.0603 0.0459
NP_440784.1_7 Forward -17 -10 15.9687 0.0123
NP_440784.1_7 Reverse -10 -17 15.9687 0.0123
NP_440784.1_7 Reverse -108 -115 10.2655 0.0801
NP_440061.1_9 Reverse -232 -246 14.1586 0.0722
NP_440061.1_9 Reverse -99 -113 14.0603 0.0735
NP_440061.1_9 Forward -20 -6 8.25877 0.177
NP_440061.1_9 Forward -339 -325 5.1122 0.294
NP_441476.1_5 Reverse -96 -115 6.58763 0.132
NP_441476.1_5 Forward -23 -4 -2.45882 0.229
NP_441476.1_5 Forward -281 -262 -7.86702 0.291
NP_439979.1_2 Reverse -218 -237 8.06259 0.258
NP_439979.1_9 Reverse -317 -335 7.09898 0.288
NP_442062.1_8 Reverse -9 -19 19.4496 0.000558
NP_442062.1_8 Forward -18 -8 17.3846 0.00193
NP_442062.1_8 Reverse -368 -378 6.27322 0.132
NP_442062.1_8 Forward -110 -100 4.60159 0.206
NP_442062.1_8 Reverse -107 -117 3.91327 0.243
NP_440304.1_4 Forward -20 -10 10.8948 0.051
NP_440304.1_4 Reverse -7 -17 1.84832 0.299
NP_442268.1_1 Forward -284 -265 16.6174 0.271
NP_442242.1_4 Forward -17 -10 14.3954 0.0124
NP_442242.1_4 Reverse -10 -17 14.3954 0.0124
NP_442242.1_4 Reverse -369 -376 9.47889 0.251
NP_440011.1_1 Reverse -13 -32 15.7324 0.173
NP_440011.1_1 Forward -305 -286 11.9958 0.265
NP_442181.1_7 Reverse -90 -108 16.9321 0.205
NP_439918.1_2 Forward -330 -311 -0.0988766 0.227
NP_439918.1_2 Forward -296 -277 -0.590531 0.233
NP_439918.1_3 Reverse -6 -25 6.4893 0.264
NP_441619.1_8 Reverse -3 -17 10.2254 0.187
NP_441208.1_9 Reverse -6 -20 5.40779 0.267
NP_441594.1_6 Forward -27 -8 13.5691 0.109
NP_440370.1_10 Forward -236 -217 8.84924 0.24
NP_440370.1_10 Reverse -319 -338 8.45592 0.241
NP_442742.1_9 Forward -190 -171 -12.7836 0.269
NP_442110.1_7 Forward -337 -323 4.52282 0.2
NP_442110.1_7 Reverse -9 -23 3.44117 0.21
NP_441082.1_10 Forward -302 -289 11.524 0.236
NP_441925.1_4 Reverse -280 -299 -1.08295 0.155
NP_440273.1_3 Reverse -90 -109 6.39097 0.232
NP_440856.1_7 Reverse -235 -254 -3.73712 0.202
NP_441083.1_3 Forward -117 -107 14.9258 0.143
NP_441083.1_5 Forward -18 -8 20.3345 0.00053
NP_441083.1_5 Reverse -9 -19 11.3864 0.0159
NP_441083.1_5 Reverse -368 -378 6.96153 0.0717
NP_441083.1_5 Forward -377 -367 0.963343 0.218
NP_441083.1_5 Reverse -302 -312 0.275027 0.237
NP_441434.1_7 Forward -16 -2 2.75286 0.27
NP_440109.1_6 Reverse -5 -24 6.88262 0.268
NP_441738.1_2 Forward -16 -9 15.28 0.0102
NP_441738.1_2 Reverse -11 -18 15.28 0.0102
NP_441738.1_2 Reverse -330 -337 10.0685 0.125
NP_441738.1_2 Forward -167 -160 6.52862 0.261
NP_440209.1_1 Reverse -9 -17 18.1123 0.00295
NP_440209.1_1 Forward -18 -10 18.1123 0.00295
NP_442889.1_8 Forward -21 -7 13.5686 0.0588
NP_442889.1_8 Reverse -104 -118 3.93223 0.27
NP_440407.1_6 Reverse -177 -191 10.9143 0.28
NP_441713.1_1 Forward -24 -5 -15.3402 0.261
NP_441770.1_1 Forward -31 -12 12.9783 0.277
NP_441716.1_1 Reverse -9 -23 10.226 0.0968
NP_442111.1_4 Reverse -8 -22 19.6658 0.00373
NP_441163.1_1 Forward -26 -9 8.39624 0.232
NP_441163.1_1 Forward -117 -100 8.00291 0.233
NP_440343.1_3 Reverse -311 -329 3.95163 0.266
NP_440906.1_5 Forward -17 -10 15.8704 0.0124
NP_440906.1_5 Reverse -10 -17 15.8704 0.0124
NP_440747.1_10 Reverse -6 -18 14.887 0.00223
NP_440747.1_10 Forward -21 -9 7.70879 0.00236
NP_440747.1_10 Reverse -365 -377 -2.32097 0.0331
NP_440747.1_10 Forward -119 -107 -4.38592 0.0974
NP_442973.1_5 Forward -27 -8 14.8474 0.127
NP_441486.1_1 Forward -21 -7 13.7659 0.00763
NP_441486.1_1 Reverse -6 -20 11.3077 0.0164
NP_441486.1_1 Reverse -104 -118 3.53951 0.0575
NP_441486.1_1 Reverse -365 -379 -4.52363 0.201
NP_442634.1_4 Reverse -7 -21 -1.67204 0.149
NP_442634.1_4 Forward -379 -365 -5.40861 0.253
NP_440403.1_4 Reverse -310 -329 -5.50708 0.22
NP_440403.1_10 Forward -27 -8 5.89931 0.238
NP_440842.1_4 Reverse -132 -151 4.8946 0.188
NP_442848.1_1 Reverse -101 -115 1.08123 0.25
NP_442848.1_1 Forward -24 -10 -1.47537 0.263
NP_442848.1_1 Reverse -3 -17 -3.44199 0.267
NP_441012.1_4 Reverse -11 -24 7.88576 0.272
NP_441012.1_4 Forward -22 -9 7.19745 0.272
NP_443018.1_3 Forward -17 -10 14.8871 0.0123
NP_443018.1_3 Reverse -10 -17 14.8871 0.0123
NP_443018.1_3 Forward -115 -108 4.26735 0.267
NP_443018.1_3 Reverse -108 -115 4.16902 0.278
NP_441634.1_8 Forward -112 -98 3.04785 0.157
NP_441634.1_8 Reverse -7 -21 -3.147 0.295
NP_440376.1_1 Forward -18 -9 19.4693 0.000692
NP_440376.1_1 Reverse -9 -18 19.4693 0.000692
NP_440376.1_1 Reverse -368 -377 6.29291 0.104
NP_440376.1_1 Reverse -101 -110 3.93297 0.188
NP_440376.1_1 Forward -337 -328 2.458 0.221
NP_440376.1_1 Forward -377 -368 0.0980582 0.285
NP_441588.1_4 Forward -16 -6 15.9097 0.0369
NP_442687.1_7 Forward -378 -368 17.6796 0.00648
NP_442687.1_7 Forward -19 -9 15.8113 0.0125
NP_442687.1_7 Reverse -8 -18 8.92815 0.0994
NP_442485.1_3 Forward -29 -10 2.45773 0.209
NP_441763.1_10 Forward -287 -268 14.4533 0.121
NP_440887.1_6 Reverse -164 -183 13.0775 0.295
NP_442658.1_1 Forward -20 -10 15.9091 0.00966
NP_442658.1_1 Reverse -7 -17 6.76441 0.214
NP_440141.1_4 Reverse -12 -31 -4.6221 0.296
NP_440141.1_8 Reverse -86 -105 6.68596 0.254
NP_441855.2_4 Forward -26 -7 10.5835 0.246
NP_441855.2_4 Forward -117 -98 9.33025 0.282
NP_442782.1_2 Forward -127 -113 8.84938 0.198
NP_442782.1_2 Reverse -9 -23 0.88457 0.282
NP_442782.1_7 Forward -26 -7 2.85105 0.193
NP_442544.1_6 Forward -25 -6 -7.08038 0.298
NP_441414.1_9 Reverse -245 -264 -4.91709 0.164
NP_439959.1_6 Forward -287 -268 5.60432 0.278
NP_442937.1_5 Reverse -4 -23 12.3892 0.111
NP_442937.1_5 Reverse -16 -35 8.16093 0.231
NP_442321.1_4 Reverse -351 -370 -2.45882 0.273
NP_441958.1_5 Forward -19 -9 12.2714 0.00183
NP_441958.1_5 Reverse -8 -18 12.2714 0.00183
NP_441958.1_5 Forward -378 -368 0.963343 0.12
NP_442836.1_5 Reverse -322 -341 5.60432 0.185
NP_442911.1_2 Forward -28 -9 -2.26216 0.096
NP_442911.1_2 Forward -126 -107 -7.08038 0.2
NP_440153.1_5 Reverse -10 -24 7.07942 0.173
NP_440153.1_5 Forward -336 -322 1.67122 0.245
NP_441591.1_10 Forward -300 -281 10.4225 0.196
NP_442064.1_4 Forward -231 -212 7.66846 0.242
NP_442064.1_4 Forward -28 -9 4.91521 0.283
NP_443055.1_6 Reverse -1 -19 -2.73484 0.299
NP_442236.1_7 Reverse -2 -21 8.16093 0.288
NP_440388.1_2 Reverse -376 -395 -0.688862 0.233
NP_441099.1_5 Forward -28 -9 -1.18052 0.105
NP_442002.1_1 Forward -300 -282 0.412472 0.192
NP_442002.1_9 Forward -19 -12 10.7572 0.185
NP_441294.1_7 Forward -15 -1 12.3223 0.103
NP_441294.1_7 Forward -247 -233 10.0185 0.213
NP_440411.1_10 Reverse -1 -20 10.1641 0.275
NP_441646.1_1 Forward -250 -231 -1.47551 0.287
NP_442438.1_10 Forward -23 -9 10.9143 0.0478
NP_442438.1_10 Reverse -4 -18 4.03116 0.152
NP_442438.1_10 Reverse -363 -377 -1.08205 0.291
NP_440377.1_1 Reverse -256 -273 10.0175 0.299
NP_441000.1_6 Forward -19 -5 -4.91696 0.254
NP_442771.1_1 Forward -20 -2 -5.78238 0.166
NP_442771.1_1 Reverse -7 -25 -8.63398 0.2
NP_440147.1_4 Reverse -7 -20 10.049 0.0355
NP_440147.1_4 Forward -20 -7 3.46087 0.187
NP_440147.1_4 Forward -339 -326 1.00259 0.242
NP_440147.1_4 Forward -379 -366 0.805932 0.244
NP_441550.1_8 Reverse -7 -17 14.6309 0.0132
NP_441550.1_8 Reverse -326 -336 6.27276 0.214
NP_441550.1_8 Forward -20 -10 6.0761 0.214
NP_441550.1_8 Forward -379 -369 5.58445 0.242
NP_441916.1_7 Reverse -9 -19 18.4663 0.00144
NP_441916.1_7 Forward -18 -8 10.3048 0.0261
NP_441916.1_10 Forward -26 -7 0.294447 0.286
NP_441041.1_4 Reverse -9 -28 -7.86702 0.194
NP_441041.1_7 Forward -340 -328 11.5962 0.0757
NP_441041.1_7 Forward -21 -9 7.61196 0.162
NP_442396.1_5 Reverse -5 -18 20.1771 0.00762
NP_442004.1_6 Forward -18 -4 8.55439 0.14
NP_441725.1_4 Forward -23 -9 3.63724 0.278
NP_441725.1_5 Reverse -10 -20 11.2881 0.0247
NP_441725.1_5 Forward -17 -7 2.04498 0.115
NP_441725.1_5 Reverse -369 -379 0.471689 0.173
NP_439966.1_7 Forward -20 -10 18.4657 0.00473
NP_439966.1_7 Reverse -326 -336 10.0093 0.0968
NP_439966.1_7 Reverse -105 -115 8.73102 0.13
NP_439966.1_7 Reverse -7 -17 7.25606 0.15
NP_439966.1_8 Forward -347 -328 11.2092 0.152
NP_439966.1_9 Forward -339 -330 6.29291 0.253
NP_439966.1_9 Forward -20 -11 0.983037 0.253
NP_442941.1_3 Reverse -10 -20 11.4848 0.0116
NP_442941.1_3 Forward -17 -7 11.0914 0.0116
NP_442941.1_3 Forward -376 -366 0.668351 0.19
NP_442941.1_3 Forward -115 -105 0.668351 0.19
NP_440289.1_2 Forward -21 -8 11.819 0.0171
NP_441678.1_2 Forward -224 -205 9.73422 0.238
NP_442281.1_1 Forward -23 -9 20.4518 0.00192
NP_442012.1_1 Forward -250 -231 7.37428 0.111
NP_442012.1_1 Forward -116 -97 4.32602 0.17
NP_442012.1_1 Reverse -3 -22 -0.885524 0.27
NP_441556.1_10 Forward -115 -101 15.5753 0.144
NP_442982.1_5 Reverse -358 -377 -1.57384 0.267
NP_441644.1_6 Forward -18 -8 17.3841 0.00127
NP_441644.1_6 Reverse -9 -19 10.1076 0.0628
NP_441644.1_6 Reverse -368 -378 8.53436 0.0982
NP_441644.1_6 Reverse -15 -25 4.30615 0.242
NP_441644.1_6 Reverse -107 -117 3.71617 0.267
NP_442215.1_2 Reverse -7 -23 6.54838 0.0702
NP_442215.1_2 Forward -27 -11 -2.79306 0.204
NP_442215.1_2 Forward -118 -102 -3.8747 0.223
NP_442215.1_2 Forward -379 -363 -4.26803 0.23
NP_442215.1_2 Forward -20 -4 -4.36636 0.232
NP_442215.1_2 Forward -339 -323 -6.13632 0.264
NP_442215.1_2 Reverse -366 -382 -7.51295 0.297
NP_442029.1_6 Reverse -4 -23 16.8141 0.0975
NP_440253.1_2 Reverse -9 -27 -0.964162 0.227
NP_440253.1_2 Forward -169 -151 -3.71743 0.3
NP_440929.1_8 Forward -18 -9 19.2726 0.000701
NP_440929.1_8 Reverse -9 -18 19.2726 0.000701
NP_440929.1_8 Forward -116 -107 6.39124 0.0992
NP_440929.1_8 Reverse -328 -337 4.91628 0.162
NP_442933.1_10 Forward -18 -9 17.601 0.00325
NP_442933.1_10 Reverse -9 -18 17.601 0.00325
NP_442933.1_10 Forward -377 -368 4.22796 0.267
NP_442933.1_10 Forward -116 -107 3.7363 0.284
NP_441751.2_8 Reverse -10 -24 9.5377 0.0312
NP_441751.2_8 Forward -115 -101 4.22782 0.0521
NP_441751.2_8 Forward -17 -3 -2.16369 0.132
NP_442554.1_8 Forward -17 -7 15.3197 0.00882
NP_442554.1_8 Reverse -10 -20 13.8447 0.0145
NP_442554.1_8 Forward -336 -326 6.46988 0.117
NP_442554.1_8 Forward -115 -105 5.28991 0.153
NP_442554.1_8 Forward -370 -360 2.63497 0.265
NP_441762.1_7 Forward -19 -7 9.57708 0.0142
NP_441762.1_7 Reverse -8 -20 2.89058 0.0676
NP_442142.1_4 Forward -21 -8 17.1282 0.0264
NP_442142.1_4 Reverse -6 -19 5.52525 0.188
NP_442142.1_4 Reverse -104 -117 3.65697 0.248
NP_442292.1_1 Forward -17 -8 18.486 0.00229
NP_442292.1_1 Reverse -10 -19 9.63616 0.0183
NP_442292.1_1 Reverse -108 -117 5.50626 0.143
NP_442292.1_1 Forward -376 -367 -0.491928 0.252
NP_442292.1_1 Forward -115 -106 -0.786921 0.287
NP_440039.1_9 Forward -29 -10 11.8975 0.284
NP_442476.1_6 Forward -17 -3 9.73436 0.0801
NP_443009.1_5 Reverse -8 -19 18.3477 0.00265
NP_443009.1_5 Forward -111 -100 10.9729 0.0699
NP_443009.1_5 Forward -245 -234 7.72798 0.122
NP_443009.1_5 Reverse -327 -338 6.64635 0.154
NP_443009.1_5 Forward -378 -367 6.54802 0.157
NP_441715.1_4 Reverse -10 -20 16.303 0.0117
NP_441715.1_4 Forward -17 -7 7.94484 0.107
NP_441448.1_1 Reverse -245 -264 10.0292 0.191
NP_441448.1_1 Reverse -173 -192 7.57094 0.221
NP_441198.1_8 Forward -246 -236 11.6111 0.193
NP_440464.1_10 Forward -17 -7 13.0082 0.169
NP_441468.1_1 Forward -17 -10 15.8704 0.0124
NP_441468.1_1 Reverse -10 -17 15.8704 0.0124
NP_441468.1_1 Forward -115 -108 10.2655 0.0906
NP_441020.2_6 Reverse -7 -24 8.98696 0.182
NP_441020.2_6 Reverse -158 -175 8.20031 0.205
NP_441020.2_6 Reverse -366 -383 6.03703 0.28
NP_441015.1_10 Reverse -10 -29 -1.96717 0.176
NP_441015.1_10 Reverse -16 -35 -2.26216 0.178
NP_441673.1_1 Forward -18 -9 20.8459 0.000698
NP_441673.1_1 Reverse -9 -18 20.8459 0.000698
NP_441673.1_1 Forward -377 -368 1.27803 0.155
NP_441673.1_1 Reverse -368 -377 1.27803 0.155
NP_442253.1_5 Forward -247 -230 2.30045 0.156
NP_442253.1_5 Forward -113 -96 1.71047 0.159
NP_442253.1_5 Reverse -98 -115 -0.256152 0.221
NP_441876.1_9 Reverse -240 -250 10.206 0.299
NP_441826.1_2 Forward -24 -10 19.9608 0.00795
NP_441826.1_2 Reverse -101 -115 4.52282 0.102
NP_441826.1_2 Reverse -362 -376 2.85119 0.119
NP_441826.1_2 Reverse -322 -336 -4.32697 0.295
NP_441826.1_2 Forward -250 -236 -4.4253 0.296
NP_441826.1_5 Forward -336 -317 2.45773 0.276
NP_442868.1_6 Reverse -7 -17 9.81313 0.038
NP_442868.1_6 Reverse -326 -336 4.40493 0.178
NP_442868.1_6 Forward -20 -10 0.963343 0.205
NP_441056.1_1 Reverse -9 -28 -4.52377 0.25
NP_441056.1_1 Forward -97 -78 -8.752 0.283
NP_441612.1_2 Forward -18 -8 8.54929 0.21
NP_442227.1_2 Forward -108 -89 -1.18052 0.262
NP_442227.1_2 Reverse -275 -294 -3.14714 0.289
NP_442361.1_3 Forward -24 -11 7.49244 0.3
NP_442808.1_1 Forward -19 -9 18.4657 0.00201
NP_442808.1_1 Reverse -287 -297 11.4843 0.0481
NP_442808.1_1 Reverse -8 -18 8.63269 0.0481
NP_442808.1_1 Reverse -288 -298 6.0761 0.131
NP_441101.1_10 Reverse -281 -300 -0.787193 0.19
NP_442050.1_5 Reverse -326 -336 10.9926 0.116
NP_442050.1_5 Forward -171 -161 9.41933 0.193
NP_442050.1_5 Forward -20 -10 9.12434 0.193
NP_442050.1_5 Reverse -7 -17 7.64939 0.243
NP_440558.1_2 Reverse -98 -117 1.37609 0.181
NP_440558.1_2 Forward -119 -100 0.786102 0.185
NP_440558.1_2 Forward -27 -8 -0.688862 0.204
NP_440558.1_2 Reverse -318 -337 -4.42544 0.245
NP_441518.1_3 Reverse -97 -116 -15.3402 0.291
NP_441518.1_4 Forward -177 -158 3.14526 0.288
NP_441878.1_6 Forward -19 -9 10.4031 0.0176
NP_441878.1_6 Reverse -8 -18 10.4031 0.0176
NP_441878.1_6 Forward -378 -368 1.25834 0.108
NP_441878.1_6 Forward -117 -107 0.865012 0.132
NP_441878.1_6 Reverse -100 -110 -7.49312 0.231
NP_441878.1_6 Reverse -367 -377 -7.59145 0.245
NP_441036.1_8 Forward -19 -9 17.7779 0.000554
NP_441036.1_8 Reverse -8 -18 8.33817 0.174
NP_441036.1_8 Forward -338 -328 5.68323 0.265
NP_441557.1_5 Forward -18 -9 19.9609 0.000699
NP_441557.1_5 Reverse -9 -18 19.9609 0.000699
NP_441557.1_5 Forward -377 -368 0.393051 0.166
NP_441557.1_5 Reverse -368 -377 0.393051 0.166
NP_442356.1_2 Forward -186 -167 18.9481 0.0684
NP_442066.2_4 Reverse -9 -28 7.66927 0.0828
NP_442419.1_2 Forward -115 -96 4.52268 0.184
NP_441308.1_8 Forward -20 -10 10.1081 0.22
NP_441458.1_10 Forward -27 -8 7.07928 0.196
NP_442183.1_1 Reverse -9 -23 19.1741 0.0065
NP_442397.1_9 Reverse -94 -113 12.1925 0.227
NP_441574.1_1 Reverse -9 -28 -4.32711 0.252
NP_442444.1_6 Reverse -259 -277 16.0159 0.172
NP_440058.1_7 Reverse -4 -23 10.1275 0.18
NP_442347.1_2 Forward -17 -8 12.4878 0.056
NP_442347.1_2 Reverse -10 -19 11.1111 0.056
NP_442347.1_2 Reverse -283 -292 6.39124 0.17
NP_442347.1_2 Forward -376 -367 5.01461 0.244
NP_442645.1_2 Reverse -1 -20 -2.45882 0.0487
NP_442645.1_2 Forward -118 -99 -16.2252 0.227
NP_442645.1_2 Reverse -99 -118 -17.2085 0.25
NP_442645.1_2 Reverse -360 -379 -20.2567 0.288
NP_441037.1_4 Reverse -7 -17 7.9999 0.237
NP_441037.1_4 Forward -20 -10 7.02532 0.237
NP_442594.1_7 Forward -29 -10 10.1267 0.186
NP_441633.1_3 Reverse -7 -20 8.47575 0.0377
NP_441633.1_3 Forward -20 -7 -3.71729 0.177
NP_441633.1_3 Forward -339 -326 -4.60227 0.205
NP_440136.1_2 Forward -17 -10 15.9687 0.0123
NP_440136.1_2 Reverse -10 -17 15.9687 0.0123
NP_442998.1_5 Reverse -180 -190 13.353 0.158
NP_442998.1_5 Reverse -181 -191 11.3864 0.187
NP_442998.1_5 Reverse -252 -262 9.91146 0.232
NP_442998.1_5 Reverse -210 -220 7.74818 0.284
NP_442998.1_10 Forward -16 -9 15.5754 0.0102
NP_442998.1_10 Reverse -11 -18 15.5754 0.0102
NP_440299.1_1 Forward -22 -9 20.1765 0.00128
NP_440299.1_1 Reverse -5 -18 18.9965 0.00298
NP_441799.1_1 Reverse -5 -19 17.4035 0.011
NP_441799.1_1 Forward -381 -367 5.99717 0.187
NP_441799.1_1 Forward -173 -159 5.60385 0.201
NP_441799.1_1 Forward -22 -8 4.03056 0.269
NP_441007.1_10 Reverse -4 -17 1.10092 0.209
NP_442201.1_10 Forward -29 -10 -13.9635 0.28
NP_440256.1_1 Reverse -6 -25 -2.16383 0.113
NP_441362.1_2 Reverse -172 -191 5.46114 0.244
NP_441559.1_8 Forward -23 -9 2.5562 0.143
NP_441559.1_8 Forward -115 -101 -3.83532 0.211
NP_441559.1_8 Reverse -263 -277 -7.37523 0.291
NP_441559.1_8 Reverse -333 -347 -7.67023 0.297
NP_440915.1_6 Forward -22 -8 5.70279 0.0879
NP_440915.1_6 Reverse -5 -19 0.687908 0.155
NP_442855.1_3 Reverse -92 -111 13.4708 0.228
NP_442866.1_1 Reverse -155 -174 -3.24547 0.219
NP_442866.1_1 Reverse -4 -23 -4.52377 0.228
NP_441464.1_8 Forward -18 -4 4.52282 0.269
NP_441464.1_10 Forward -300 -286 7.76774 0.292
NP_441199.1_6 Forward -22 -3 -1.37718 0.292
NP_441494.1_6 Forward -278 -265 14.3756 0.17
NP_442993.1_1 Reverse -9 -25 -7.0213 0.146
NP_442993.1_1 Forward -227 -211 -10.1679 0.21
NP_440677.1_1 Forward -386 -367 24.2872 0.0158
NP_440677.1_1 Forward -27 -8 7.57094 0.234
NP_442386.1_9 Forward -19 -10 15.7322 0.0144
NP_442386.1_9 Reverse -8 -17 13.8639 0.0289
NP_442386.1_9 Reverse -100 -109 8.35743 0.201
NP_442386.1_9 Reverse -327 -336 6.29249 0.226
NP_442386.1_9 Reverse -288 -297 5.30919 0.257
NP_442386.1_10 Forward -298 -285 11.7207 0.195
NP_441340.1_5 Forward -17 -10 15.6737 0.0124
NP_441340.1_5 Reverse -10 -17 15.6737 0.0124
NP_441340.1_5 Reverse -108 -115 4.07068 0.239
NP_441340.1_5 Forward -336 -329 3.97235 0.274
NP_442791.1_5 Reverse -93 -112 -7.76869 0.279
NP_442791.1_5 Reverse -281 -300 -9.63698 0.279
NP_440168.1_2 Forward -32 -13 5.211 0.258
NP_442474.1_9 Reverse -155 -174 10.7175 0.24
NP_442240.1_2 Reverse -10 -29 -14.0619 0.174
NP_440211.1_3 Reverse -289 -308 13.9625 0.287
NP_440586.1_8 Forward -17 -10 13.2151 0.026
NP_440586.1_8 Reverse -10 -17 13.2151 0.026
NP_442251.1_6 Forward -17 -10 15.2804 0.0124
NP_442251.1_6 Reverse -10 -17 15.2804 0.0124
NP_442251.1_6 Reverse -369 -376 10.3639 0.134
NP_440192.1_4 Forward -301 -282 9.30058 0.279
NP_440192.1_4 Forward -300 -281 8.9125 0.289
NP_440684.1_9 Forward -24 -10 15.2409 0.0988
NP_440684.1_9 Reverse -3 -17 6.58777 0.298
NP_441262.1_3 Reverse -9 -16 14.7888 0.0223
NP_441262.1_3 Forward -18 -11 14.7888 0.0223
NP_441262.1_3 Forward -337 -330 11.6422 0.0477
NP_443051.1_1 Reverse -8 -17 10.4228 0.00754
NP_443051.1_1 Forward -19 -10 10.4228 0.00754
NP_440451.1_10 Forward -115 -96 10.0284 0.264
NP_441232.1_8 Reverse -83 -97 19.3708 0.178
NP_439937.1_8 Reverse -7 -26 -1.47551 0.249
NP_439937.1_9 Reverse -299 -316 -12.8431 0.276
NP_439937.1_9 Forward -19 -2 -16.4814 0.287
NP_442294.1_3 Forward -224 -210 14.7486 0.216
NP_441740.2_10 Reverse -3 -22 8.94757 0.286
NP_440408.1_7 Reverse -95 -114 9.73422 0.255
NP_440408.1_7 Forward -289 -270 8.35759 0.281
NP_440439.1_1 Forward -21 -8 8.37742 0.0537
NP_440372.1_2 Forward -17 -10 16.3621 0.0124
NP_440372.1_2 Reverse -10 -17 16.3621 0.0124
NP_440574.1_3 Forward -342 -323 -0.0988766 0.265
NP_441181.1_6 Reverse -10 -28 3.65739 0.268
NP_440819.1_5 Reverse -251 -259 7.98423 0.228
NP_441803.1_2 Forward -23 -4 4.03102 0.182
NP_439977.1_5 Reverse -3 -22 3.44104 0.159
NP_440139.1_1 Reverse -3 -22 10.3234 0.0921
NP_441572.1_7 Forward -24 -5 6.78429 0.0785
NP_441572.1_7 Reverse -374 -393 -5.70374 0.269
NP_440267.1_2 Reverse -363 -377 6.19383 0.239
NP_442384.1_10 Forward -18 -5 16.7355 0.00732
NP_442384.1_10 Reverse -9 -22 15.7522 0.00946
NP_442384.1_10 Reverse -368 -381 4.05085 0.17
NP_442384.1_10 Reverse -101 -114 2.87088 0.21
NP_440364.1_2 Reverse -4 -23 16.6615 0.189
NP_441877.1_7 Forward -23 -4 4.62021 0.218
NP_441018.1_7 Reverse -5 -24 9.43923 0.223
NP_442790.1_4 Forward -27 -8 -7.4737 0.153
NP_442262.1_10 Forward -17 -10 14.1988 0.0123
NP_442262.1_10 Reverse -10 -17 14.1988 0.0123
NP_441689.1_5 Forward -20 -10 8.53436 0.132
NP_441689.1_5 Reverse -7 -17 5.78111 0.197
NP_440163.1_10 Forward -21 -11 16.303 0.0762
NP_440163.1_10 Reverse -365 -375 8.92815 0.256
NP_440344.1_10 Forward -25 -8 11.5436 0.006
NP_440344.1_10 Reverse -2 -19 -9.79426 0.156
NP_440344.1_10 Reverse -275 -292 -11.9575 0.235
NP_440344.1_10 Forward -384 -367 -13.8258 0.296
NP_440531.1_6 Forward -26 -7 -2.0655 0.244
NP_442910.1_1 Forward -25 -6 -7.17871 0.254
NP_442750.1_1 Forward -186 -167 9.63507 0.261
NP_440297.1_9 Reverse -10 -20 9.32148 0.0917
NP_440297.1_9 Forward -17 -7 -0.118297 0.282
NP_440297.1_9 Forward -115 -105 -0.511621 0.289
NP_441592.1_4 Reverse -362 -381 -2.95047 0.274
NP_441896.1_3 Forward -346 -327 -2.16383 0.278
NP_441896.1_5 Reverse -3 -10 15.3787 0.268
NP_440990.1_7 Forward -389 -370 10.0292 0.243
NP_442378.1_4 Forward -331 -312 13.6675 0.269
NP_440999.1_9 Forward -22 -8 13.1759 0.0329
NP_440888.1_2 Reverse -9 -23 14.9452 0.0137
NP_440888.1_2 Forward -18 -4 10.8154 0.0842
NP_440600.1_4 Forward -26 -8 -7.45401 0.291
NP_442147.1_7 Reverse -359 -378 10.1275 0.25
NP_442948.1_2 Reverse -8 -27 6.78429 0.229
NP_442033.1_10 Forward -30 -11 -9.44032 0.215
NP_441543.1_2 Reverse -10 -19 18.486 0.00236
NP_441543.1_2 Forward -17 -8 16.9127 0.00359
NP_441543.1_3 Reverse -286 -300 6.58715 0.286
NP_442845.1_2 Reverse -3 -17 16.2242 0.0636
NP_442845.1_2 Reverse -101 -115 7.66941 0.195
NP_442845.1_2 Forward -377 -363 7.37441 0.195
NP_442845.1_2 Forward -24 -10 5.70279 0.225
NP_441469.1_8 Forward -19 -10 16.126 0.00797
NP_441469.1_8 Reverse -8 -17 6.48957 0.227
NP_443064.1_6 Reverse -368 -378 14.1182 0.0796
NP_443064.1_6 Forward -18 -8 12.5669 0.0796
NP_442578.1_5 Forward -31 -12 1.57275 0.257
NP_442578.1_7 Forward -17 -10 14.5921 0.026
NP_442578.1_7 Reverse -10 -17 14.5921 0.026
NP_441462.1_2 Forward -18 -8 11.5831 0.00406
NP_441462.1_2 Reverse -9 -19 11.5831 0.00406
NP_441462.1_2 Reverse -368 -378 0.57002 0.144
NP_441621.1_7 Reverse -7 -21 -3.44199 0.188
NP_443062.1_1 Reverse -9 -27 12.0562 0.0869
NP_443062.1_6 Forward -385 -366 0.58944 0.292
NP_442204.1_1 Forward -22 -11 9.69511 0.0736
NP_440516.1_2 Forward -24 -6 3.3624 0.149
NP_440516.1_8 Forward -18 -9 16.9127 0.00442
NP_440516.1_8 Reverse -9 -18 16.9127 0.00442
NP_442428.1_5 Forward -17 -10 15.8704 0.0124
NP_442428.1_5 Reverse -10 -17 15.8704 0.0124
NP_442428.1_5 Forward -115 -108 4.66067 0.244
NP_441267.1_1 Forward -116 -97 1.76941 0.279
NP_440673.1_3 Forward -16 -9 12.4288 0.0426
NP_440673.1_3 Reverse -11 -18 12.4288 0.0426
NP_441052.1_2 Forward -18 -8 19.9412 0.00106
NP_441052.1_2 Reverse -9 -19 10.5014 0.0285
NP_441052.1_2 Forward -377 -367 8.23984 0.0482
NP_441052.1_2 Reverse -390 -400 0.963343 0.255
NP_440992.1_5 Reverse -295 -314 14.0308 0.272
NP_442219.1_8 Reverse -11 -30 13.0954 0.153
NP_442219.1_9 Forward -17 -8 17.7976 0.00718
NP_442219.1_9 Reverse -10 -19 8.35786 0.0681
NP_442219.1_9 Forward -376 -367 4.81794 0.196
NP_440436.1_4 Reverse -10 -19 18.1905 0.00233
NP_440436.1_4 Forward -17 -8 17.2072 0.00233
NP_440436.1_4 Forward -109 -100 9.04574 0.092
NP_440436.1_4 Forward -115 -106 5.0142 0.227
NP_440436.1_4 Forward -336 -327 4.42421 0.265
NP_441884.1_9 Forward -340 -321 -23.6 0.284
NP_442907.1_9 Forward -23 -4 9.83255 0.102
NP_441719.1_2 Reverse -6 -20 13.2523 0.286
NP_441719.1_4 Forward -17 -10 16.3621 0.0124
NP_441719.1_4 Reverse -10 -17 16.3621 0.0124
NP_441733.1_10 Reverse -6 -19 7.09911 0.156
NP_441004.1_1 Reverse -3 -22 -5.99873 0.18
NP_441004.1_1 Reverse -83 -102 -7.08038 0.194
NP_441004.1_1 Reverse -44 -63 -14.1602 0.265
NP_441231.1_3 Forward -189 -170 22.5164 0.055
NP_442366.1_3 Reverse -8 -26 9.65558 0.0543
NP_442366.1_3 Forward -19 -1 -4.40575 0.271
NP_442366.1_5 Reverse -6 -16 15.4175 0.0374
NP_440129.1_10 Forward -25 -11 15.8309 0.0373
NP_440296.1_10 Forward -300 -281 -13.2752 0.269
NP_442694.1_4 Forward -222 -213 13.8644 0.217
NP_442694.1_9 Forward -201 -182 7.7676 0.292
NP_442206.1_10 Reverse -9 -24 4.99478 0.178
NP_442206.1_10 Reverse -107 -122 2.5365 0.201
NP_443054.1_2 Reverse -308 -322 4.91614 0.24
NP_443054.1_2 Forward -20 -6 1.86788 0.245
NP_443054.1_2 Reverse -326 -340 1.27789 0.25
NP_441851.1_10 Forward -19 -9 16.008 0.00552
NP_441851.1_10 Reverse -8 -18 15.8113 0.00552
NP_441851.1_10 Reverse -367 -377 4.79825 0.247
NP_441157.1_1 Forward -69 -55 4.8172 0.27
NP_441542.1_4 Reverse -178 -192 13.7659 0.235
NP_442011.1_1 Reverse -8 -27 -1.7705 0.269
NP_442515.1_1 Reverse -367 -381 6.48943 0.0975
NP_442515.1_1 Forward -378 -364 -3.24533 0.289
NP_442515.1_1 Forward -19 -5 -4.4253 0.298
NP_442515.1_1 Reverse -8 -22 -4.81863 0.298
NP_440593.1_3 Reverse -4 -23 -7.08038 0.285
NP_441982.1_6 Reverse -249 -258 10.7665 0.292
NP_440463.1_6 Forward -21 -2 6.98095 0.295
NP_441046.1_2 Forward -323 -304 -1.86883 0.292
NP_441349.1_10 Forward -28 -9 2.75272 0.0731
NP_439960.1_4 Reverse -8 -27 13.175 0.264
NP_442450.1_5 Forward -20 -10 9.32148 0.115
NP_442450.1_5 Reverse -7 -17 7.55152 0.13
NP_442450.1_5 Forward -379 -369 5.78156 0.227
NP_442450.1_5 Reverse -105 -115 4.89658 0.278
NP_440588.1_2 Forward -27 -8 6.78429 0.0535
NP_440588.1_2 Forward -119 -100 -0.39387 0.15
NP_441031.1_1 Reverse -128 -147 8.84726 0.229
NP_440023.1_7 Forward -308 -289 8.94757 0.265
NP_441003.1_9 Forward -27 -8 10.0292 0.213
NP_441003.1_9 Forward -125 -106 6.98095 0.24
NP_441570.1_1 Reverse -9 -27 -6.76569 0.0818
NP_441570.1_1 Forward -377 -359 -13.0589 0.221
NP_441078.1_4 Forward -18 -9 19.6659 0.0007
NP_441078.1_4 Reverse -9 -18 19.6659 0.0007
NP_441078.1_4 Reverse -368 -377 0.786375 0.157
NP_441078.1_4 Forward -377 -368 0.589713 0.174
NP_441078.1_4 Reverse -101 -110 -1.57357 0.266
NP_441078.1_4 Forward -110 -101 -1.57357 0.266
NP_441078.1_4 Forward -116 -107 -1.96689 0.282
NP_442729.1_8 Forward -22 -9 8.08242 0.125
NP_441663.1_7 Reverse -85 -104 6.09597 0.229
NP_441663.1_8 Forward -24 -5 -3.73712 0.295
NP_442348.1_2 Forward -319 -310 7.86621 0.28
NP_442443.1_1 Reverse -248 -267 4.62101 0.157
NP_442443.1_1 Forward -305 -286 -4.32711 0.271
NP_442443.1_1 Forward -326 -307 -6.49039 0.294
NP_440526.1_3 Forward -17 -6 1.04151 0.267
NP_441432.1_8 Reverse -8 -17 16.8143 0.00595
NP_441432.1_8 Forward -19 -10 8.25953 0.0755
NP_441432.1_8 Reverse -327 -336 7.96454 0.0953
NP_441432.1_8 Forward -170 -161 5.21127 0.185
NP_441432.1_8 Reverse -367 -376 4.12963 0.237
NP_442320.1_8 Reverse -3 -17 6.98109 0.0223
NP_442320.1_8 Forward -24 -10 4.71948 0.0472
NP_442320.1_8 Reverse -322 -336 -5.01529 0.2
NP_442344.1_7 Reverse -329 -348 -5.9004 0.168
NP_441732.1_2 Forward -22 -6 2.02515 0.0253
NP_442797.1_7 Forward -19 -1 2.77242 0.238
NP_442797.1_7 Forward -338 -320 1.29745 0.262
NP_440199.1_10 Reverse -104 -114 8.92815 0.226
NP_442400.1_10 Reverse -185 -198 16.2954 0.152
NP_442489.1_7 Forward -18 -9 20.1576 0.000695
NP_442489.1_7 Reverse -9 -18 20.1576 0.000695
NP_442489.1_7 Reverse -368 -377 7.86621 0.0448
NP_442489.1_7 Forward -377 -368 0.589713 0.17
NP_442489.1_7 Forward -116 -107 -1.47524 0.203
NP_442489.1_7 Reverse -101 -110 -1.57357 0.213
NP_442489.1_7 Forward -337 -328 -1.96689 0.28
NP_442489.1_7 Forward -110 -101 -2.06522 0.288
NP_442079.1_7 Reverse -10 -29 5.211 0.178
NP_440559.1_1 Forward -17 -8 17.4043 0.00658
NP_440559.1_1 Reverse -10 -19 8.75118 0.0586
NP_440559.1_1 Forward -336 -327 4.81794 0.193
NP_440559.1_1 Forward -376 -367 4.32629 0.288
NP_441659.2_8 Forward -18 -8 18.1713 0.00133
NP_441659.2_8 Reverse -9 -19 11.9764 0.0147
NP_441659.2_8 Reverse -107 -117 3.42162 0.161
NP_441659.2_8 Reverse -368 -378 -0.216628 0.292
NP_441040.1_2 Reverse -7 -26 -12.6852 0.26
NP_442346.1_5 Reverse -8 -18 16.6963 0.00248
NP_442346.1_5 Forward -378 -368 10.7964 0.0854
NP_442346.1_5 Forward -19 -9 9.02648 0.118
NP_442346.1_5 Reverse -106 -116 4.89658 0.269
NP_442346.1_5 Reverse -367 -377 4.20827 0.296
NP_440545.1_3 Reverse -5 -22 11.6419 0.0247
NP_441629.1_3 Forward -31 -12 2.55527 0.218
NP_441923.1_6 Reverse -84 -98 10.1277 0.275
NP_440486.1_6 Reverse -94 -113 11.8975 0.207
NP_440486.1_6 Reverse -8 -27 5.89931 0.287
NP_440486.1_9 Reverse -289 -303 13.8643 0.228
NP_440459.1_2 Reverse -92 -109 11.0519 0.183
NP_442551.1_4 Reverse -366 -381 -3.26502 0.287
NP_442311.1_5 Forward -196 -177 7.47261 0.24
NP_442603.1_7 Reverse -9 -23 8.3571 0.176
NP_441888.1_7 Forward -23 -9 13.3726 0.0743
NP_441050.1_5 Forward -306 -288 -2.93078 0.285
NP_440170.1_5 Forward -28 -9 7.96426 0.142
NP_441833.1_4 Forward -17 -10 15.9687 0.0124
NP_441833.1_4 Reverse -10 -17 15.9687 0.0124
NP_441895.1_10 Reverse -249 -268 -18.3884 0.282
NP_442162.1_9 Forward -17 -10 16.2637 0.0124
NP_442162.1_9 Reverse -10 -17 16.2637 0.0124
NP_442162.1_9 Forward -336 -329 9.28223 0.0694
NP_440671.1_4 Forward -24 -10 22.6157 0.00197
NP_440671.1_4 Reverse -362 -376 8.55439 0.195
NP_440671.1_4 Reverse -35 -49 7.86607 0.207
NP_442140.1_3 Forward -17 -7 12.2714 0.0632
NP_442140.1_3 Reverse -10 -20 8.33817 0.119
NP_442140.1_3 Reverse -329 -339 5.48657 0.207
NP_442021.1_3 Reverse -3 -22 1.57275 0.176
NP_440875.1_9 Reverse -11 -21 9.05339 0.233
NP_441813.1_5 Forward -20 -10 17.188 0.00979
NP_441813.1_5 Reverse -7 -17 8.63316 0.0367
NP_440590.1_4 Forward -336 -323 11.1307 0.0221
NP_440590.1_4 Forward -17 -4 7.78743 0.0494
NP_440590.1_4 Reverse -102 -115 0.60927 0.148
NP_440590.1_4 Reverse -10 -23 -2.24233 0.239
NP_440567.1_1 Forward -17 -3 17.5025 0.0153
NP_440567.1_1 Reverse -10 -24 11.5043 0.0285
NP_440567.1_1 Forward -336 -322 -0.393733 0.281
NP_442497.1_10 Forward -17 -8 10.4228 0.0087
NP_442497.1_10 Reverse -10 -19 10.4228 0.0087
NP_442497.1_10 Reverse -369 -378 0.29472 0.199
NP_440821.1_4 Forward -20 -10 19.0562 0.00399
NP_440821.1_4 Reverse -7 -17 9.41981 0.0286
NP_441239.1_9 Forward -20 -8 13.3137 0.037
NP_441239.1_9 Reverse -99 -111 6.1355 0.2
NP_441239.1_9 Reverse -7 -19 5.93884 0.202
NP_442897.1_5 Forward -128 -109 16.8715 0.225
NP_441892.1_1 Forward -27 -10 0.628827 0.165
NP_440604.1_6 Reverse -9 -28 -3.44213 0.225
NP_442643.1_1 Reverse -3 -22 -0.295539 0.143
NP_441874.1_1 Forward -28 -14 9.63603 0.277
NP_442216.1_4 Forward -36 -28 8.08217 0.255
NP_440949.1_7 Forward -26 -7 10.0284 0.25
NP_442138.1_10 Forward -377 -358 -3.04881 0.225
NP_442138.1_10 Reverse -9 -28 -4.91709 0.266
NP_442809.1_6 Reverse -101 -120 14.1591 0.109
NP_440546.1_4 Reverse -9 -19 11.8882 0.0679
NP_440546.1_4 Forward -18 -8 10.046 0.109
NP_440675.1_1 Reverse -6 -25 4.916 0.23
NP_440675.1_1 Reverse -157 -176 4.42435 0.235
NP_440462.1_6 Forward -20 -10 15.418 0.0142
NP_440462.1_6 Reverse -7 -17 1.35667 0.294
NP_440868.1_4 Forward -22 -10 8.6921 0.0582
NP_440868.1_4 Reverse -5 -17 6.1355 0.0878
NP_441249.1_8 Forward -297 -278 1.86774 0.284
NP_442402.1_2 Forward -263 -249 11.9953 0.272
NP_442402.1_4 Forward -268 -249 -8.55607 0.283
NP_442882.1_8 Forward -301 -282 10.2259 0.194
NP_442039.1_4 Forward -17 -10 15.1821 0.0124
NP_442039.1_4 Reverse -10 -17 15.1821 0.0124
NP_442039.1_4 Forward -336 -329 10.8555 0.109
NP_441811.1_4 Forward -20 -1 8.55425 0.156
NP_442625.1_6 Reverse -359 -378 11.7008 0.223
NP_441926.1_3 Forward -377 -361 2.61514 0.263
NP_440825.1_7 Forward -17 -7 12.9096 0.152
NP_442837.1_3 Forward -17 -10 15.7721 0.0124
NP_442837.1_3 Reverse -10 -17 15.7721 0.0124
NP_442837.1_4 Reverse -311 -330 11.6025 0.233
NP_442053.1_1 Forward -18 -9 18.3876 0.0007
NP_442053.1_1 Reverse -9 -18 18.3876 0.0007
NP_440505.1_3 Forward -20 -10 13.8447 0.0247
NP_440505.1_3 Reverse -7 -17 9.22315 0.122
NP_440505.1_3 Reverse -326 -336 5.09324 0.246
NP_441102.1_1 Reverse -10 -29 9.43923 0.154
NP_441252.1_6 Reverse -179 -186 14.3954 0.168
NP_442532.1_4 Reverse -255 -273 7.5771 0.296
NP_442532.1_4 Reverse -185 -203 7.5771 0.296
NP_440914.1_1 Forward -18 -8 17.5935 0.000537
NP_440914.1_1 Reverse -101 -111 10.2742 0.147
NP_440914.1_1 Reverse -9 -19 8.6151 0.186
NP_441011.1_8 Reverse -10 -19 16.9127 0.00602
NP_441011.1_8 Forward -17 -8 8.25953 0.144
NP_442533.1_1 Forward -294 -275 -8.85033 0.214
NP_442533.1_1 Reverse -85 -104 -17.7985 0.295
NP_442533.1_6 Forward -18 -9 17.2076 0.00137
NP_442533.1_6 Reverse -9 -18 17.2076 0.00137
NP_442533.1_6 Forward -110 -101 7.57121 0.0898
NP_442533.1_6 Reverse -107 -116 5.50626 0.14
NP_442533.1_6 Reverse -368 -377 5.40793 0.14
NP_440263.1_5 Forward -199 -185 8.06273 0.294
NP_442322.1_4 Reverse -286 -303 -1.83013 0.228
NP_442322.1_4 Reverse -279 -296 -9.89323 0.297
NP_442229.1_1 Reverse -7 -21 7.27547 0.196
NP_442229.1_1 Reverse -326 -340 6.98048 0.2
NP_441482.1_7 Forward -24 -10 8.25939 0.0181
NP_441482.1_7 Forward -175 -161 -5.40861 0.182
NP_441482.1_7 Reverse -3 -17 -10.7185 0.213
NP_439944.1_9 Forward -17 -7 10.5014 0.0887
NP_439944.1_9 Reverse -10 -20 10.3048 0.0887
NP_439944.1_9 Forward -115 -105 7.25653 0.149
NP_441028.1_6 Reverse -239 -249 4.40448 0.278
NP_441028.1_6 Reverse -283 -293 4.10949 0.278
NP_440116.1_5 Reverse -6 -23 7.512 0.155
NP_440116.1_8 Forward -336 -317 -2.36049 0.13
NP_440115.1_6 Reverse -325 -335 6.07655 0.204
NP_440115.1_6 Forward -246 -236 5.09324 0.271
NP_440007.1_9 Forward -22 -8 3.73617 0.267
NP_440007.1_9 Reverse -115 -129 1.17956 0.29
NP_443045.1_9 Reverse -280 -298 14.9646 0.152
NP_441602.1_3 Forward -115 -96 5.50599 0.141
NP_441602.1_3 Forward -336 -317 1.96607 0.206
NP_441602.1_3 Reverse -4 -23 -3.63879 0.251
NP_441972.1_5 Forward -29 -10 4.42435 0.103
NP_441972.1_5 Forward -115 -96 -6.29373 0.229
NP_441106.1_1 Forward -19 -10 18.191 0.0028
NP_441106.1_1 Reverse -8 -17 9.63616 0.0311
NP_441825.1_4 Forward -299 -289 14.0414 0.249
NP_439903.1_6 Forward -125 -106 7.27514 0.161
NP_440797.1_2 Forward -29 -10 15.9788 0.163
NP_441286.1_1 Reverse -8 -20 14.4936 0.00418
NP_441286.1_1 Forward -19 -7 3.38223 0.0467
NP_441286.1_1 Forward -117 -105 0.825626 0.107
NP_441286.1_1 Reverse -367 -379 -4.09092 0.149
NP_442674.1_3 Forward -26 -7 10.52 0.174
NP_440670.1_8 Forward -18 -9 18.3876 0.000699
NP_440670.1_8 Reverse -9 -18 18.3876 0.000699
NP_440670.1_8 Forward -337 -328 11.6028 0.0325
NP_440670.1_8 Reverse -368 -377 5.60459 0.149
NP_440670.1_8 Reverse -328 -337 4.0313 0.207
NP_441930.1_1 Reverse -5 -24 12.5858 0.194
NP_440886.1_7 Forward -19 -9 17.7774 0.0011
NP_440886.1_7 Reverse -275 -285 8.3377 0.0805
NP_440886.1_7 Reverse -8 -18 7.94438 0.0805
NP_442072.1_9 Reverse -8 -26 -23.482 0.297
NP_440907.2_8 Reverse -10 -20 7.84605 0.117
NP_440907.2_8 Forward -17 -7 7.64939 0.117
NP_440841.1_4 Forward -20 -1 2.75272 0.0964
NP_441463.1_3 Forward -28 -9 -0.590531 0.133
NP_441463.1_6 Reverse -7 -21 5.54623 0.287
NP_441626.1_2 Forward -17 -10 15.7721 0.0124
NP_441626.1_2 Reverse -10 -17 15.7721 0.0124
NP_442365.1_7 Forward -22 -3 -2.55715 0.201
NP_442794.1_1 Forward -22 -10 10.1671 0.0721
NP_442794.1_1 Reverse -5 -17 9.38042 0.0795
NP_442615.1_1 Forward -386 -368 -3.91409 0.171
NP_441962.1_4 Reverse -4 -23 4.81767 0.0974
NP_441962.1_4 Reverse -323 -342 -8.06369 0.195
NP_441962.1_4 Reverse -102 -121 -12.3902 0.256
NP_440387.1_1 Reverse -9 -25 15.5948 0.00527
NP_440387.1_1 Forward -18 -2 15.0048 0.00592
NP_441431.1_2 Forward -21 -7 11.5037 0.136
NP_441836.1_2 Reverse -3 -22 -5.11376 0.272
NP_441993.1_1 Reverse -3 -22 2.53143 0.257
NP_441993.1_1 Reverse -9 -28 2.33652 0.26
NP_440114.1_10 Forward -18 -4 6.6861 0.26
NP_440114.1_10 Reverse -328 -342 5.80112 0.292
NP_442090.1_10 Forward -296 -283 12.9006 0.179
NP_441817.1_2 Reverse -241 -260 18.289 0.14
NP_441510.2_2 Reverse -275 -294 1.96529 0.29
NP_441510.2_7 Forward -24 -10 12.192 0.28
NP_441272.1_7 Forward -297 -287 13.353 0.257
NP_440766.1_4 Forward -22 -8 8.25939 0.0871
NP_441237.1_9 Forward -17 -7 14.828 0.0242
NP_442743.1_1 Forward -101 -82 6.1935 0.268
NP_442743.1_5 Forward -115 -96 8.06259 0.159
NP_442103.1_2 Reverse -109 -127 8.57317 0.246
NP_440457.1_1 Forward -22 -10 8.29878 0.101
NP_440457.1_1 Reverse -5 -17 0.825626 0.25
NP_441332.1_6 Reverse -287 -297 12.034 0.236
NP_441332.1_6 Reverse -288 -298 11.9372 0.239
NP_441889.1_4 Reverse -359 -378 3.04771 0.244
NP_441436.1_8 Reverse -8 -27 14.0608 0.215
NP_442509.1_9 Reverse -9 -19 16.2041 0.00739
NP_442509.1_9 Forward -18 -8 8.14104 0.192
NP_442509.1_9 Reverse -328 -338 6.66608 0.259
NP_441253.1_1 Reverse -109 -128 14.8474 0.162
NP_440524.1_7 Reverse -287 -305 15.6538 0.208
NP_440554.1_4 Reverse -10 -20 14.6313 0.02
NP_441885.1_5 Forward -18 -8 20.9245 0.000538
NP_441885.1_5 Reverse -9 -19 11.4848 0.00668
NP_441885.1_5 Forward -377 -367 1.94665 0.0935
NP_441885.1_5 Forward -337 -327 -1.00328 0.248
NP_441614.1_7 Forward -52 -33 10.5209 0.232
NP_442341.1_7 Reverse -8 -22 17.7975 0.0111
NP_442341.1_7 Forward -19 -5 7.66941 0.0994
NP_442341.1_7 Reverse -327 -341 4.71948 0.181
NP_442341.1_7 Reverse -367 -381 1.76955 0.281
NP_442341.1_9 Forward -20 -6 7.07881 0.204
NP_441173.1_9 Forward -188 -180 12.1137 0.21
NP_442395.2_4 Reverse -288 -307 6.68515 0.144
NP_442395.2_4 Reverse -8 -27 4.22689 0.186
NP_443000.1_7 Reverse -7 -17 10.3048 0.0345
NP_443000.1_7 Forward -20 -10 8.73149 0.0437
NP_443000.1_7 Reverse -366 -376 4.40493 0.199
NP_440507.2_3 Forward -27 -8 12.88 0.145
NP_441561.1_7 Reverse -285 -304 6.39016 0.274
NP_441842.1_10 Reverse -2 -16 9.73436 0.182
NP_440275.1_3 Forward -20 -10 8.4365 0.0602
NP_440275.1_3 Reverse -7 -17 8.04317 0.0602
NP_440091.1_1 Forward -22 -10 1.41561 0.197
NP_440091.1_1 Reverse -5 -17 1.41561 0.197
NP_440091.1_1 Reverse -103 -115 -0.944332 0.3
NP_443060.1_5 Reverse -1 -20 14.4533 0.109
NP_439962.1_4 Reverse -284 -303 -8.16202 0.292
NP_440149.1_8 Reverse -9 -28 -5.11376 0.219
NP_441105.1_3 Forward -121 -102 9.0459 0.0472
NP_441105.1_3 Forward -29 -10 3.73603 0.0873
NP_440216.1_1 Forward -18 -4 -1.47537 0.0328
NP_440216.1_1 Reverse -9 -23 -2.26202 0.0484
NP_440216.1_1 Forward -377 -363 -12.2918 0.256
NP_440216.1_9 Reverse -109 -118 5.70292 0.29
NP_440172.1_1 Forward -18 -8 15.0247 0.00945
NP_440172.1_1 Reverse -368 -378 10.4031 0.0511
NP_440172.1_1 Reverse -9 -19 8.73149 0.0586
NP_440172.1_1 Forward -377 -367 1.94665 0.29
NP_442371.1_1 Reverse -251 -261 17.0891 0.086
NP_442015.1_10 Forward -22 -9 19.1938 0.00444
NP_442015.1_10 Reverse -5 -18 1.49425 0.204
NP_442015.1_10 Forward -120 -107 0.314277 0.231
NP_441226.1_7 Forward -17 -10 14.4934 0.0123
NP_441226.1_7 Reverse -10 -17 14.4934 0.0123
NP_441111.1_7 Forward -17 -9 18.7023 0.00294
NP_441111.1_7 Reverse -10 -18 18.7023 0.00294
NP_441111.1_7 Forward -115 -107 -0.570565 0.233
NP_440244.1_1 Forward -298 -279 -7.08038 0.287
NP_441766.1_2 Forward -18 -9 17.5026 0.00297
NP_441766.1_2 Reverse -9 -18 17.5026 0.00297
NP_442417.1_5 Reverse -9 -23 21.3374 0.00922
NP_440416.1_9 Forward -117 -98 -11.2103 0.149
NP_440416.1_9 Reverse -2 -21 -11.3086 0.149
NP_440416.1_9 Forward -25 -6 -12.2919 0.156
NP_440416.1_9 Forward -32 -13 -18.6834 0.262
NP_440072.1_5 Forward -297 -279 0.805796 0.236
NP_442116.1_2 Forward -182 -163 10.9134 0.289
NP_442116.1_6 Reverse -173 -190 10.7472 0.215
NP_440845.1_1 Reverse -49 -68 -5.31042 0.255
NP_440261.1_5 Reverse -10 -23 -10.5021 0.201
NP_440261.1_5 Forward -336 -323 -12.3704 0.284
NP_440261.1_7 Reverse -174 -193 -2.55715 0.19
NP_440988.1_10 Reverse -105 -119 9.2554 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGTTGAAGGCCGCCTATCATTTGGGTAATCGCCATGTGCCCCTAGAAGTGAACTTGGATTATCTGCGATTGGCACCGGATCCGGTATTGGCTGATATGCTCCGGGGTTTGGGGGTCAGGGTAGCGGAAATAACTGCGCCATTTTTTCCAGAACGGGGGGCATTCCACAGTCACTAGGATGGCTTTTTGCCCTTAAATAAGCATTCCTAGCAATTTTGCCCAAGAAAATCAAGCCATTCGCTACAATGTTTTCATGAAGTAAAGTAAACTGACTGGCAACAACTTTGCGCTGGCCATTCCCGACTCCGTTCCCAATGCTTTCTGTAACGTAATTAATCAAACCTCAATCCTCCCAACCTCAGTTTTAACTCCCCTCTGACCACGGCGATCGCCAAACCACA

CDS

ATGACCATTGATAACATCCGTCTTAGAAACGAATTTATTAACACCGAAGTTATTACCCGCAGCAGCGGCAAAAAACTGGGGGTAGTCAAAGAAGTGCTAGTCGATGTCGATCAGCGAGAAATTGTCGCCCTGGGACTGCGGGACAACTTTTTGTCTTTAACCGGGATGCCCCAATATCTTTACCTGAACAGTATTGTCCAAACCGGGGACGTGGTCTTAGTAGAAAACGATGATGTTTTTGAATTGGTGGAAGTGGACCTCTATTCCCCTCTGGTCAATAGCGAAGTGGTTACTGAAACGGGAGAACCCCTGGGTAGGGTAAGGGATTTTCAGTTTGACCTCGCCACTGGCAAAGTTTCCTCCATTATCATCGCTTCCTTGGGATTACCCCAAATTCCTGACCAACTTATCAGCACCTACGAGCTTTCCATTGACGAGGTGGTGAGCAGTGGTCCCAACCGTTTGATCGTTTTTGAAGGAGCAGAGGAAAGATTAAATCAACTCAGTGTGGGATTACTGGAACGCCTTGGCATTGGCCGTCCTTCTTGGGAACGGATGGAAGAGGATTTGTATTATCCCCCCACTACCCGCCCTGAAAATCAATTGGGCAGTGGCATCCCCGTGCGGCCACCGGTACAAGTCCGTCAACCGGAGCCCGTGTTGGAAGAGCGTTGGAACGAGGACGATTGGCAAGATACCCGCCCTGCGCCGCCCCCTCGTCGGGAAGTGGCCCCTCTGCGTTATCCAGAGCCGGAATATGAAGATGATTATGAAGTGGATAATTGGGGGGAAGCGTCTTCCCGTTCTTCTGCTCCAGAACCGGATTATGATTATGAAGATGGAGTGGCTGGCGATGTCTGGGACGACGATGAGGCCCCTGCTCCCTACAGCCCTCCCCGGGTGAATATTCCGGAAACCCGCCGGGAAAAAATGCCTGAATATTATGAAGAATAG

Protein

MTIDNIRLRNEFINTEVITRSSGKKLGVVKEVLVDVDQREIVALGLRDNFLSLTGMPQYLYLNSIVQTGDVVLVENDDVFELVEVDLYSPLVNSEVVTETGEPLGRVRDFQFDLATGKVSSIIIASLGLPQIPDQLISTYELSIDEVVSSGPNRLIVFEGAEERLNQLSVGLLERLGIGRPSWERMEEDLYYPPTTRPENQLGSGIPVRPPVQVRQPEPVLEERWNEDDWQDTRPAPPPRREVAPLRYPEPEYEDDYEVDNWGEASSRSSAPEPDYDYEDGVAGDVWDDDEAPAPYSPPRVNIPETRREKMPEYYEE