Your browser is old and dusty. Try Google Chrome!

Details for slr1206

ORF slr1206
Accession NP_440707.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -34 -48 0.982901 0.196
NP_441418.1_6 Reverse -39 -58 -21.9284 0.163
NP_441418.1_6 Forward -328 -309 -28.4182 0.205
NP_441480.1_5 Forward -375 -356 22.7139 0.0191
NP_441818.1_9 Forward -375 -356 -5.21209 0.251
NP_440150.1_6 Reverse -316 -335 3.14605 0.254
NP_442062.1_8 Forward -368 -358 8.33817 0.0769
NP_441900.1_2 Reverse -300 -318 -0.964891 0.27
NP_440304.1_4 Forward -50 -40 5.28991 0.218
NP_440304.1_4 Reverse -86 -96 4.0116 0.281
NP_440304.1_4 Forward -144 -134 3.71661 0.293
NP_440044.1_8 Forward -277 -258 -3.24547 0.281
NP_441781.1_7 Reverse -33 -52 12.7825 0.136
NP_439918.1_2 Reverse -9 -28 -5.01543 0.295
NP_442196.1_9 Forward -340 -327 18.9972 0.275
NP_442742.1_9 Reverse -349 -368 -12.4886 0.269
NP_441925.1_4 Reverse -357 -376 -16.8158 0.285
NP_441149.1_9 Forward -219 -200 0.490334 0.234
NP_441738.1_2 Reverse -187 -194 8.29857 0.176
NP_440407.1_6 Forward -362 -348 11.111 0.28
NP_442706.1_5 Forward -29 -10 13.3438 0.262
NP_442570.1_3 Reverse -64 -83 -6.68705 0.259
NP_441327.1_1 Reverse -95 -114 5.65501 0.25
NP_441163.1_1 Forward -351 -334 9.18288 0.226
NP_441163.1_1 Forward -363 -346 5.74131 0.27
NP_440747.1_10 Reverse -48 -60 -12.0557 0.199
NP_442634.1_4 Forward -268 -254 -3.54032 0.161
NP_442848.1_5 Reverse -313 -331 1.39578 0.276
NP_442848.1_9 Reverse -329 -348 5.40766 0.202
NP_441012.1_4 Forward -52 -39 5.52582 0.294
NP_440376.1_1 Reverse -33 -42 5.80125 0.119
NP_442687.1_7 Forward -279 -269 4.0116 0.271
NP_442687.1_7 Reverse -32 -42 3.91327 0.278
NP_440066.1_5 Reverse -328 -347 7.96345 0.256
NP_442485.1_3 Forward -348 -329 -5.80207 0.296
NP_441846.1_10 Reverse -51 -70 -5.21209 0.185
NP_441846.1_10 Reverse -53 -72 -23.305 0.282
NP_441846.1_10 Reverse -54 -73 -23.6 0.294
NP_441274.1_9 Reverse -44 -63 9.14423 0.231
NP_440360.1_5 Reverse -358 -377 -5.9004 0.297
NP_442658.1_1 Forward -50 -40 9.02601 0.169
NP_442161.1_7 Forward -80 -61 3.44104 0.26
NP_440141.1_8 Reverse -46 -65 7.07928 0.249
NP_440141.1_8 Forward -373 -354 6.88262 0.252
NP_442782.1_2 Reverse -329 -343 3.14618 0.267
NP_442782.1_2 Forward -48 -34 2.16287 0.277
NP_443061.1_4 Forward -86 -67 8.06259 0.205
NP_442321.1_4 Forward -27 -8 2.45773 0.255
NP_442836.1_10 Forward -151 -141 12.8614 0.237
NP_440203.1_5 Forward -94 -84 12.5659 0.146
NP_441097.1_2 Reverse -57 -74 8.7903 0.236
NP_441097.1_2 Reverse -5 -22 4.85706 0.276
NP_443055.1_6 Forward -345 -327 -2.73484 0.299
NP_441099.1_5 Reverse -41 -60 -11.5053 0.283
NP_442002.1_9 Reverse -268 -275 11.6422 0.185
NP_442438.1_10 Reverse -314 -328 0.982901 0.21
NP_441110.1_1 Forward -60 -41 2.3594 0.297
NP_440147.1_4 Reverse -267 -280 4.93583 0.142
NP_441550.1_8 Forward -280 -270 10.9926 0.0578
NP_441550.1_8 Reverse -267 -277 6.46942 0.206
NP_440206.1_4 Forward -74 -55 -1.47628 0.291
NP_441041.1_4 Forward -379 -360 -11.0136 0.239
NP_441041.1_7 Reverse -130 -142 5.6684 0.245
NP_442396.1_6 Forward -114 -100 18.728 0.254
NP_441725.1_5 Reverse -40 -50 7.05986 0.106
NP_440736.1_3 Forward -340 -321 -1.86883 0.294
NP_440260.1_8 Forward -332 -314 -6.76569 0.295
NP_440802.1_8 Forward -57 -38 18.7807 0.184
NP_441678.1_9 Reverse -54 -73 -0.39387 0.23
NP_442256.1_2 Forward -280 -262 -9.32229 0.261
NP_440437.1_1 Reverse -313 -332 -0.787193 0.187
NP_441087.1_6 Reverse -340 -358 7.78652 0.233
NP_441644.1_6 Reverse -39 -49 3.32285 0.288
NP_441795.1_4 Reverse -220 -233 17.8996 0.211
NP_442177.1_5 Reverse -63 -77 11.111 0.22
NP_442029.1_6 Reverse -4 -23 4.12936 0.273
NP_442863.1_10 Reverse -34 -53 11.7992 0.28
NP_442075.1_1 Forward -384 -365 9.24257 0.222
NP_442970.1_3 Forward -108 -90 12.3956 0.241
NP_442142.1_4 Forward -51 -38 4.34528 0.223
NP_443009.1_5 Forward -143 -132 3.69644 0.282
NP_442301.1_1 Forward -119 -100 6.4893 0.297
NP_440881.1_4 Reverse -22 -41 10.0292 0.184
NP_440730.1_4 Forward -357 -338 -3.73712 0.298
NP_441198.1_4 Forward -376 -357 9.3409 0.276
NP_440379.1_5 Forward -346 -327 -9.53865 0.264
NP_441015.1_10 Reverse -49 -68 -10.522 0.284
NP_441015.1_10 Forward -375 -356 -11.0136 0.29
NP_441673.1_1 Reverse -33 -42 -8.06341 0.254
NP_442253.1_7 Reverse -333 -347 14.6509 0.226
NP_441826.1_5 Reverse -317 -336 0.58944 0.3
NP_442063.1_5 Forward -300 -281 9.14423 0.245
NP_442719.1_2 Forward -90 -72 -10.208 0.271
NP_442719.1_2 Forward -338 -320 -11.1913 0.29
NP_442719.1_2 Forward -111 -93 -11.9779 0.299
NP_441612.1_2 Reverse -33 -43 13.874 0.21
NP_441612.1_2 Forward -303 -293 6.32259 0.294
NP_442559.1_3 Forward -59 -40 8.45592 0.285
NP_442808.1_1 Reverse -32 -42 3.32285 0.244
NP_440558.1_2 Forward -347 -328 2.16274 0.17
NP_442789.1_4 Forward -375 -356 -7.76869 0.299
NP_441878.1_6 Reverse -32 -42 -7.0998 0.204
NP_441878.1_6 Forward -49 -39 -7.49312 0.231
NP_441433.1_8 Forward -260 -241 3.04771 0.208
NP_441739.1_2 Reverse -184 -200 9.7926 0.174
NP_440101.1_3 Forward -333 -314 1.0811 0.284
NP_442830.1_1 Forward -374 -355 15.0441 0.227
NP_442830.1_5 Forward -344 -330 6.29216 0.216
NP_441564.1_2 Forward -369 -350 0.491109 0.214
NP_442397.1_9 Reverse -33 -52 5.211 0.247
NP_442347.1_2 Forward -59 -50 8.35786 0.0927
NP_442594.1_8 Forward -376 -357 2.75272 0.293
NP_442508.1_8 Reverse -58 -75 10.1669 0.276
NP_442998.1_5 Forward -359 -349 13.353 0.158
NP_442998.1_5 Forward -358 -348 9.32148 0.243
NP_441743.1_6 Reverse -66 -85 13.5691 0.225
NP_442333.2_5 Forward -59 -40 -6.78538 0.227
NP_440256.1_1 Forward -341 -322 -9.53865 0.281
NP_440456.1_9 Forward -91 -72 11.7992 0.145
NP_441559.1_8 Forward -348 -334 -4.81863 0.238
NP_441559.1_8 Forward -333 -319 -5.80194 0.27
NP_441559.1_8 Reverse -354 -368 -6.58858 0.279
NP_441559.1_8 Forward -65 -51 -6.68692 0.279
NP_442158.1_4 Reverse -43 -53 11.9764 0.26
NP_441866.1_6 Forward -119 -100 6.78348 0.285
NP_442452.1_3 Forward -59 -40 0.392778 0.294
NP_442866.1_1 Reverse -34 -53 6.68596 0.121
NP_442866.1_1 Reverse -49 -68 -4.91709 0.237
NP_440695.1_5 Reverse -257 -276 3.93269 0.214
NP_440695.1_5 Reverse -39 -58 -2.36049 0.299
NP_442993.1_1 Forward -48 -32 -11.2495 0.24
NP_440327.1_6 Forward -386 -367 4.916 0.266
NP_441254.1_1 Reverse -182 -195 21.7498 0.0059
NP_440586.1_8 Reverse -356 -363 7.02027 0.279
NP_439984.1_8 Forward -242 -224 16.9321 0.265
NP_439937.1_9 Reverse -333 -350 3.87303 0.0798
NP_439937.1_9 Forward -143 -126 -0.650168 0.122
NP_442294.1_3 Reverse -344 -358 12.487 0.283
NP_440926.1_1 Forward -266 -247 5.50599 0.266
NP_443039.1_7 Forward -23 -9 4.91554 0.248
NP_440372.1_2 Reverse -270 -277 4.07068 0.262
NP_441789.1_7 Forward -69 -50 0.883656 0.245
NP_439977.1_5 Reverse -127 -146 -2.85214 0.29
NP_440139.1_1 Reverse -33 -52 2.85027 0.222
NP_442384.1_10 Reverse -319 -332 2.77255 0.213
NP_441018.1_7 Forward -374 -355 10.4225 0.205
NP_440531.1_6 Forward -336 -317 -3.54046 0.268
NP_440297.1_9 Reverse -40 -50 6.96153 0.161
NP_440350.1_2 Forward -377 -358 8.45592 0.248
NP_439926.1_7 Reverse -24 -42 8.47561 0.204
NP_441896.1_3 Forward -151 -132 -1.86883 0.268
NP_443036.1_1 Reverse -1 -20 9.04509 0.287
NP_440888.1_2 Reverse -334 -348 9.43874 0.127
NP_440888.1_2 Forward -328 -314 7.17714 0.205
NP_440888.1_2 Forward -18 -4 6.48882 0.232
NP_442033.1_10 Reverse -131 -150 -10.522 0.239
NP_440575.1_1 Forward -224 -205 6.98015 0.216
NP_441543.1_3 Reverse -356 -370 10.717 0.212
NP_442637.1_1 Forward -20 -1 -3.04881 0.16
NP_441462.1_5 Forward -315 -296 1.27776 0.291
NP_440936.1_10 Forward -225 -206 3.29405 0.196
NP_442204.1_1 Reverse -5 -16 -0.0396598 0.285
NP_440516.1_8 Reverse -269 -278 -0.491928 0.262
NP_440783.1_5 Reverse -55 -74 -6.29373 0.29
NP_442120.1_10 Reverse -34 -53 -13.3736 0.284
NP_442120.1_10 Reverse -329 -348 -16.1268 0.296
NP_441835.1_2 Reverse -125 -144 10.2259 0.195
NP_440673.1_3 Forward -276 -269 11.7405 0.0653
NP_440436.1_4 Reverse -40 -49 6.48915 0.157
NP_440314.1_9 Reverse -134 -153 -3.04881 0.173
NP_441004.1_1 Reverse -15 -34 -8.94866 0.206
NP_441004.1_1 Forward -361 -342 -10.817 0.226
NP_442813.1_4 Forward -384 -365 -6.39206 0.299
NP_442206.1_10 Forward -373 -358 -0.413427 0.292
NP_443054.1_2 Reverse -31 -45 -0.590395 0.299
NP_440864.1_9 Forward -386 -367 0.0977854 0.147
NP_441851.1_10 Reverse -32 -42 4.69992 0.254
NP_441396.1_5 Forward -375 -366 8.65285 0.21
NP_441683.1_7 Forward -310 -291 -10.817 0.284
NP_441046.1_2 Forward -357 -338 2.45773 0.24
NP_442689.1_8 Forward -235 -218 -6.05768 0.28
NP_441394.1_10 Reverse -357 -375 9.45814 0.263
NP_442843.1_1 Forward -363 -344 -11.7019 0.291
NP_440588.1_2 Forward -287 -268 -6.1954 0.273
NP_440588.1_10 Reverse -372 -391 5.01433 0.239
NP_442006.1_2 Reverse -371 -388 -17.0707 0.269
NP_441003.1_9 Forward -72 -53 4.71934 0.277
NP_440483.1_1 Forward -381 -362 0.982764 0.187
NP_441078.1_4 Forward -42 -33 5.99792 0.0932
NP_441078.1_4 Reverse -33 -42 -2.06522 0.295
NP_442388.1_4 Reverse -185 -204 9.43841 0.296
NP_442348.1_2 Reverse -333 -342 12.0944 0.218
NP_442348.1_2 Forward -194 -185 7.76787 0.28
NP_440707.1_6 Forward -336 -317 17.2065 0.143
NP_440707.1_9 Forward -375 -356 21.5339 0.0245
NP_440526.1_3 Forward -141 -130 5.36805 0.249
NP_441432.1_8 Forward -43 -34 3.14632 0.259
NP_441432.1_8 Reverse -87 -96 2.65466 0.292
NP_441432.1_8 Reverse -8 -17 2.55633 0.298
NP_440685.1_5 Forward -263 -244 8.94757 0.298
NP_442797.1_1 Reverse -309 -328 -4.22878 0.286
NP_441057.1_3 Reverse -340 -359 -11.8003 0.24
NP_441057.1_4 Forward -332 -314 17.5221 0.0572
NP_440713.1_4 Reverse -247 -266 5.60432 0.205
NP_441659.2_8 Reverse -39 -49 1.84832 0.224
NP_441092.1_1 Forward -349 -330 15.5357 0.189
NP_441040.1_2 Reverse -339 -358 -5.21209 0.176
NP_439956.1_7 Reverse -3 -22 6.88262 0.257
NP_442776.1_1 Reverse -40 -59 5.211 0.256
NP_442346.1_5 Forward -49 -39 4.20827 0.296
NP_441629.1_3 Reverse -356 -375 1.08032 0.231
NP_441923.1_8 Forward -44 -30 13.3726 0.286
NP_441653.1_3 Reverse -42 -56 14.7492 0.254
NP_440010.1_10 Forward -60 -41 2.75272 0.272
NP_441888.1_7 Reverse -324 -338 0.982901 0.272
NP_441050.1_5 Forward -376 -358 4.73903 0.194
NP_441948.1_4 Reverse -312 -330 -4.20908 0.22
NP_441329.1_4 Forward -116 -98 10.8881 0.258
NP_441895.1_10 Forward -316 -297 -27.5332 0.282
NP_440671.1_1 Reverse -102 -121 8.23655 0.204
NP_442199.1_4 Forward -41 -22 9.14423 0.169
NP_442723.1_5 Reverse -308 -327 21.828 0.104
NP_441813.1_5 Forward -280 -270 5.38824 0.13
NP_442643.1_5 Reverse -248 -267 -5.70374 0.293
NP_441017.1_8 Reverse -36 -51 11.7796 0.188
NP_440546.1_6 Forward -363 -344 6.88262 0.283
NP_440546.1_7 Forward -337 -327 17.2863 0.231
NP_442340.1_3 Forward -62 -43 -3.14714 0.205
NP_441249.1_8 Reverse -61 -80 5.11266 0.247
NP_441474.1_1 Forward -70 -51 -1.77127 0.264
NP_440812.1_10 Forward -362 -349 11.3273 0.28
NP_442402.1_4 Reverse -341 -360 -9.14605 0.285
NP_442882.1_8 Forward -371 -352 6.68596 0.295
NP_441811.1_1 Forward -64 -45 9.14423 0.269
NP_441811.1_8 Forward -370 -356 6.3911 0.273
NP_440825.1_7 Forward -277 -267 12.2265 0.177
NP_440160.1_1 Reverse -12 -31 9.57641 0.26
NP_440160.1_2 Reverse -33 -52 -8.85033 0.291
NP_442360.1_5 Forward -200 -190 14.6313 0.201
NP_442255.1_5 Forward -363 -344 10.4225 0.232
NP_442533.1_1 Reverse -36 -55 -17.5035 0.289
NP_442541.1_10 Forward -389 -375 8.94708 0.218
NP_442322.1_4 Forward -78 -61 -7.82829 0.286
NP_442322.1_4 Reverse -356 -373 -8.90993 0.286
NP_442322.1_4 Forward -63 -46 -9.89323 0.297
NP_443016.1_1 Reverse -349 -368 -5.80207 0.251
NP_440816.1_8 Reverse -188 -202 17.0102 0.282
NP_441028.1_6 Forward -59 -49 13.2542 0.159
NP_441028.1_6 Forward -39 -29 12.9592 0.166
NP_441028.1_6 Forward -40 -30 5.97777 0.234
NP_441527.1_2 Forward -256 -237 6.58763 0.289
NP_440115.1_6 Reverse -266 -276 5.48657 0.244
NP_442728.1_7 Forward -55 -41 10.7177 0.297
NP_441680.1_4 Reverse -365 -384 9.24257 0.153
NP_440429.1_9 Forward -389 -370 3.44104 0.264
NP_439903.1_6 Forward -21 -2 1.57197 0.243
NP_442588.1_6 Reverse -325 -344 1.47442 0.239
NP_441286.1_1 Forward -43 -31 -5.27089 0.194
NP_440886.1_7 Reverse -366 -376 5.38779 0.185
NP_442382.1_6 Reverse -316 -329 18.9813 0.0759
NP_442717.1_2 Forward -308 -289 -2.16383 0.217
NP_442072.1_9 Reverse -32 -50 -23.482 0.297
NP_441463.1_6 Reverse -37 -51 12.6005 0.224
NP_442794.1_1 Reverse -5 -17 3.87389 0.283
NP_442794.1_1 Forward -52 -40 3.87389 0.283
NP_442615.1_1 Reverse -260 -278 -4.8974 0.197
NP_441962.1_1 Forward -55 -36 1.37609 0.16
NP_441962.1_5 Forward -41 -22 5.70265 0.29
NP_440387.1_1 Reverse -33 -49 -4.56302 0.19
NP_441488.1_2 Reverse -21 -40 15.8307 0.26
NP_442352.1_8 Reverse -352 -366 14.8469 0.294
NP_440114.1_10 Forward -48 -34 9.43936 0.172
NP_442323.1_7 Forward -54 -35 12.6833 0.103
NP_441720.1_2 Forward -393 -374 4.12856 0.236
NP_440293.1_3 Reverse -327 -346 2.65439 0.195
NP_442680.1_5 Forward -370 -351 0.560681 0.263
NP_441436.1_8 Reverse -54 -73 8.94757 0.275
NP_442509.1_9 Reverse -185 -195 6.96107 0.244
NP_441253.1_1 Forward -347 -328 7.96426 0.205
NP_442862.1_1 Forward -66 -47 11.0125 0.248
NP_441885.1_5 Forward -42 -32 -1.69159 0.277
NP_441275.1_6 Reverse -50 -63 12.8023 0.293
NP_442341.1_7 Reverse -32 -46 1.08123 0.299
NP_441756.1_5 Forward -333 -314 -3.3438 0.29
NP_441173.1_9 Reverse -351 -359 12.1137 0.21
NP_442395.2_4 Reverse -358 -377 2.6536 0.22
NP_440191.1_6 Forward -236 -222 13.8579 0.294
NP_440423.1_8 Reverse -354 -373 15.7316 0.154
NP_443059.1_10 Reverse -308 -327 -0.591301 0.285
NP_441561.1_4 Forward -340 -321 5.80098 0.254
NP_440880.1_5 Reverse -62 -80 14.0805 0.207
NP_442214.1_1 Forward -321 -302 7.37428 0.298
NP_440172.1_1 Forward -48 -38 4.3066 0.194
NP_441226.1_7 Forward -74 -67 5.34865 0.289
NP_440198.1_2 Forward -345 -326 18.3104 0.206
NP_442834.1_9 Reverse -43 -62 15.7324 0.0851
NP_441766.1_2 Forward -278 -269 5.3096 0.131
NP_440416.1_9 Reverse -312 -331 -15.3402 0.189
NP_440416.1_9 Reverse -262 -281 -21.83 0.297
NP_443052.1_9 Reverse -357 -376 -0.983855 0.219
NP_442116.1_6 Forward -237 -220 5.3042 0.299
NP_442403.1_8 Forward -374 -355 5.01433 0.226
NP_442154.1_1 Forward -375 -357 -7.06068 0.141
NP_442154.1_1 Forward -330 -312 -16.3038 0.238
NP_442564.1_6 Reverse -174 -193 11.0125 0.3
NP_442564.1_9 Forward -48 -34 13.7354 0.275
NP_440261.1_5 Forward -62 -49 -4.7006 0.165
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GCAGGAATGGAGTCCCTTTCCACCTGTGGTGGGGGGTTTGATGGGCAAAATGTCGGCGGAAAAGCCCCTGCCGGTGTTCCCTGTGCGGGTGGAAAATGGAGAAGTACAGGTGGATTTAGGCGCCTGATCGCTCAGTTGAACCCTTTGCAGAGCAGACAAGACTATATTTTTGATCTAAATGGTTTTTCTTAATCCCTCAAACTTTGGGGGATTTTGATTAATCTGTCTAGTGTCTAGAATCAAATAGCTAGGTTCTGGGACAATCTCACCTGAAATCCTGGTTCACAATAGTTTTTATTGAATTCACATTGCCTTGACCCATAATTCCCAACCCCTACCCGTTGACCCCCAGGACAATGGCTTTCCCCCTGTACATTTCCAAACCCATTTCCAGGGCAGA

CDS

ATGGAAATGTTTGCCCCCGGTCAAGAAGTGGACGACTATCTACAGGCCCACCAAGGTTGGTTCCGTCGCTGTGCCCAGCCTATGCAAGCCGATCCTTTGGGGGACCATGGATATGTGTTGACCATTGGTAAGTTTGGTGCTTTGGGTTTTGATGTGGAGCCCAAAATTGCGGTGGTGCTGGAACCGCCCCAGGATGGCAATTACCTGATGCATACGGTTCCTTTGCCCGATACCCCCAATCTGGGTTATGAAGTGGATTTTCTTTCTAACATGACTCTGCATCAAGTCAATGGCGATCGCCTGACGGAGAAAAGTTTAAAACAGTTTGCCCAGGCGGAAATCCCCTGGCCGGAAACCATTACCCAGGTGGAATGGGACTTGAAAATGGATGTGGCGGTGCAGTTCCCTGGCTATATCTACAAACTGCCCATGAAGTTGATTCAATCCACTGGCGATCGCCTGTTGACAGAAATTGTCCGCCAAGTGTCCCCCCGTTTAACTTATAAAGTACAGCAGGATTTTCATCAGGAAAAAGGCCTACCCCTACCGCCCAAAAGTGGCCGTTATTTCCAGCGGATCAGGCCAGCGGGGGAAGAACAATCTGAGTCAGAGACGGAAACGGAAGTCGAATCTTAA

Protein

MEMFAPGQEVDDYLQAHQGWFRRCAQPMQADPLGDHGYVLTIGKFGALGFDVEPKIAVVLEPPQDGNYLMHTVPLPDTPNLGYEVDFLSNMTLHQVNGDRLTEKSLKQFAQAEIPWPETITQVEWDLKMDVAVQFPGYIYKLPMKLIQSTGDRLLTEIVRQVSPRLTYKVQQDFHQEKGLPLPPKSGRYFQRIRPAGEEQSESETETEVES