Your browser is old and dusty. Try Google Chrome!

Details for slr1205

ORF slr1205
Accession NP_440706.1
Symbol
Category Other
Definition similar to chlorobenzene dioxygenase, ferredoxin component
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -244 -258 14.0609 0.154
NP_442711.1_1 Reverse -234 -248 12.0943 0.222
NP_441061.1_2 Reverse -235 -249 1.27789 0.192
NP_441061.1_2 Forward -74 -60 1.08123 0.195
NP_441061.1_2 Forward -242 -228 -0.787057 0.239
NP_440557.1_1 Reverse -235 -254 0.392778 0.265
NP_440795.1_7 Forward -242 -235 14.6904 0.0123
NP_440795.1_7 Reverse -235 -242 14.6904 0.0123
NP_441418.1_6 Reverse -234 -253 -20.0601 0.103
NP_441418.1_6 Forward -243 -224 -27.9265 0.203
NP_442291.1_5 Forward -244 -228 1.43517 0.147
NP_440897.1_6 Reverse -234 -253 3.24359 0.149
NP_440897.1_6 Forward -243 -224 -1.47628 0.19
NP_441453.1_1 Forward -250 -232 6.40989 0.235
NP_441453.1_4 Reverse -234 -242 16.539 0.00633
NP_441453.1_4 Forward -243 -235 16.539 0.00633
NP_441453.1_7 Reverse -195 -202 11.9372 0.298
NP_442151.1_6 Reverse -234 -248 12.4876 0.0722
NP_442838.1_7 Forward -248 -229 0.491109 0.121
NP_440226.1_1 Reverse -234 -253 7.57094 0.103
NP_441630.1_3 Reverse -226 -245 3.6377 0.188
NP_440120.1_4 Forward -190 -176 19.3708 0.0521
NP_442173.1_1 Forward -242 -234 15.4574 0.00633
NP_442173.1_1 Reverse -235 -243 15.4574 0.00633
NP_442752.1_4 Forward -243 -236 13.8055 0.0199
NP_442752.1_4 Reverse -234 -241 13.8055 0.0199
NP_442752.1_4 Reverse -53 -60 9.47889 0.109
NP_443027.1_4 Forward -245 -235 13.943 0.0452
NP_442975.1_10 Forward -247 -233 21.6317 0.000774
NP_440784.1_7 Forward -242 -235 15.9687 0.0123
NP_440784.1_7 Reverse -235 -242 15.9687 0.0123
NP_440110.1_4 Reverse -223 -242 14.9458 0.0777
NP_441476.1_5 Forward -248 -229 -3.3438 0.235
NP_440878.1_9 Forward -253 -234 6.4893 0.174
NP_442062.1_8 Reverse -234 -244 19.4496 0.000558
NP_442062.1_8 Forward -243 -233 17.3846 0.00193
NP_441859.1_3 Reverse -233 -252 3.44025 0.241
NP_441859.1_3 Reverse -74 -93 2.55527 0.258
NP_440304.1_4 Forward -245 -235 9.91146 0.051
NP_440304.1_4 Reverse -58 -68 3.61828 0.295
NP_440304.1_4 Reverse -232 -242 1.84832 0.299
NP_442242.1_4 Forward -242 -235 14.3954 0.0124
NP_442242.1_4 Reverse -235 -242 14.3954 0.0124
NP_440044.1_8 Forward -242 -223 2.85105 0.143
NP_441781.1_7 Forward -306 -287 -2.36049 0.289
NP_441035.1_3 Forward -246 -227 -0.197208 0.287
NP_441619.1_8 Reverse -228 -242 10.6187 0.185
NP_441208.1_9 Reverse -95 -109 7.76774 0.219
NP_441208.1_9 Reverse -231 -245 7.47274 0.221
NP_441208.1_9 Forward -125 -111 4.71948 0.291
NP_442742.1_9 Forward -23 -4 -9.73531 0.269
NP_442110.1_7 Reverse -234 -248 10.226 0.0684
NP_442110.1_7 Reverse -177 -191 2.35953 0.222
NP_441925.1_4 Forward -73 -54 -14.1609 0.261
NP_441925.1_4 Forward -74 -55 -15.9309 0.275
NP_441925.1_4 Forward -61 -42 -17.4058 0.294
NP_441083.1_5 Forward -243 -233 20.3345 0.00053
NP_441083.1_5 Reverse -234 -244 11.3864 0.0159
NP_441434.1_7 Reverse -236 -250 5.40779 0.225
NP_441738.1_2 Forward -241 -234 15.28 0.0102
NP_441738.1_2 Reverse -236 -243 15.28 0.0102
NP_441738.1_2 Forward -321 -314 8.29857 0.176
NP_441738.1_2 Forward -167 -160 6.52862 0.261
NP_441558.1_5 Forward -149 -130 4.71934 0.271
NP_440209.1_1 Reverse -234 -242 18.1123 0.00295
NP_440209.1_1 Forward -243 -235 18.1123 0.00295
NP_442889.1_1 Forward -354 -335 -4.72043 0.156
NP_442889.1_8 Forward -246 -232 22.32 0.00155
NP_442889.1_8 Forward -65 -51 5.80051 0.213
NP_441713.1_1 Forward -249 -230 -5.99873 0.116
NP_441770.1_1 Forward -46 -27 12.1917 0.277
NP_440178.1_7 Reverse -233 -252 -21.83 0.241
NP_441716.1_1 Reverse -339 -353 4.12949 0.258
NP_441716.1_1 Forward -243 -229 4.03116 0.259
NP_442111.1_4 Reverse -233 -247 12.586 0.0422
NP_441495.1_2 Forward -147 -128 9.73422 0.299
NP_440343.1_3 Forward -73 -55 5.62325 0.252
NP_440906.1_5 Forward -242 -235 15.8704 0.0124
NP_440906.1_5 Reverse -235 -242 15.8704 0.0124
NP_440747.1_10 Reverse -231 -243 14.887 0.00223
NP_440747.1_10 Forward -246 -234 -2.02597 0.0196
NP_440747.1_10 Forward -72 -60 -2.51763 0.0509
NP_441130.1_10 Reverse -232 -246 8.55439 0.134
NP_441854.1_10 Reverse -58 -77 0.196116 0.286
NP_441486.1_1 Forward -246 -232 14.2576 0.00654
NP_441486.1_1 Reverse -231 -245 4.52282 0.0432
NP_441265.1_3 Forward -249 -235 1.67122 0.2
NP_440403.1_10 Reverse -51 -70 3.44104 0.273
NP_441014.1_8 Reverse -139 -158 5.211 0.19
NP_441014.1_8 Forward -58 -39 -6.09707 0.276
NP_441014.1_10 Reverse -296 -315 17.3048 0.0425
NP_442848.1_1 Reverse -228 -242 -2.75368 0.263
NP_442848.1_1 Forward -249 -235 -3.24533 0.263
NP_442848.1_5 Forward -70 -52 -1.55415 0.276
NP_443018.1_3 Forward -242 -235 14.8871 0.0123
NP_443018.1_3 Reverse -235 -242 14.8871 0.0123
NP_441634.1_8 Reverse -232 -246 14.9459 0.0248
NP_441634.1_8 Forward -149 -135 5.70279 0.114
NP_440376.1_1 Forward -243 -234 19.4693 0.000692
NP_440376.1_1 Reverse -234 -243 19.4693 0.000692
NP_440376.1_1 Reverse -60 -69 3.24465 0.206
NP_440376.1_1 Reverse -53 -62 0.688044 0.262
NP_440376.1_1 Forward -221 -212 0.0980582 0.285
NP_441857.1_5 Forward -250 -232 2.0841 0.277
NP_441588.1_4 Forward -241 -231 15.9097 0.0369
NP_441588.1_4 Reverse -236 -246 6.96153 0.178
NP_442687.1_7 Forward -244 -234 15.8113 0.0125
NP_442687.1_7 Reverse -233 -243 8.92815 0.0994
NP_442687.1_7 Reverse -338 -348 4.89658 0.23
NP_441077.1_7 Reverse -163 -182 13.5691 0.248
NP_441846.1_10 Reverse -54 -73 -20.1584 0.256
NP_441846.1_10 Forward -141 -122 -22.5183 0.261
NP_441846.1_10 Reverse -42 -61 -22.5183 0.261
NP_442658.1_1 Forward -245 -235 18.7607 0.00222
NP_442658.1_1 Reverse -232 -242 6.76441 0.214
NP_442658.1_1 Forward -171 -161 6.66608 0.219
NP_442658.1_1 Reverse -58 -68 4.7978 0.297
NP_440141.1_8 Reverse -240 -259 9.63589 0.214
NP_441855.2_4 Reverse -226 -245 12.7045 0.182
NP_442782.1_7 Forward -251 -232 0.491109 0.223
NP_441414.1_9 Forward -243 -224 5.99764 0.0435
NP_441414.1_9 Reverse -234 -253 -3.54046 0.138
NP_441487.1_9 Reverse -137 -156 0.196116 0.237
NP_442937.1_5 Reverse -379 -398 8.65258 0.216
NP_442937.1_5 Forward -152 -133 8.35759 0.225
NP_442937.1_5 Reverse -229 -248 7.96426 0.237
NP_441958.1_5 Forward -244 -234 12.2714 0.00183
NP_441958.1_5 Reverse -233 -243 12.2714 0.00183
NP_441958.1_5 Reverse -59 -69 -1.00328 0.227
NP_441127.1_1 Forward -147 -133 8.94771 0.284
NP_440950.1_6 Reverse -202 -221 12.1925 0.205
NP_443001.1_4 Reverse -188 -207 11.6025 0.245
NP_440984.1_7 Forward -248 -234 10.6193 0.122
NP_442911.1_2 Forward -253 -234 4.22769 0.0392
NP_442911.1_2 Reverse -224 -243 0.982764 0.0628
NP_441580.1_6 Forward -254 -235 5.99764 0.117
NP_440153.1_5 Reverse -235 -249 3.93283 0.199
NP_443055.1_6 Forward -83 -65 3.75497 0.193
NP_443055.1_6 Reverse -226 -244 -0.276578 0.256
NP_440993.1_2 Reverse -229 -245 3.00846 0.262
NP_440993.1_2 Forward -248 -232 2.91013 0.262
NP_440993.1_3 Forward -253 -234 9.63507 0.122
NP_439975.1_2 Forward -151 -133 4.24738 0.3
NP_441099.1_5 Forward -253 -234 -10.6203 0.258
NP_441099.1_5 Forward -79 -60 -11.1119 0.271
NP_442002.1_9 Forward -156 -149 12.2322 0.185
NP_442002.1_9 Forward -244 -237 10.7572 0.185
NP_441654.1_7 Forward -99 -80 14.2758 0.208
NP_441294.1_7 Forward -247 -233 17.2177 0.0101
NP_441294.1_7 Reverse -134 -148 11.9383 0.12
NP_441646.1_1 Reverse -227 -246 2.85105 0.211
NP_442438.1_10 Forward -248 -234 17.7975 0.0179
NP_441292.1_2 Forward -166 -147 -11.0136 0.292
NP_441000.1_6 Reverse -233 -247 -3.44199 0.221
NP_441000.1_6 Forward -244 -230 -4.91696 0.254
NP_440147.1_4 Reverse -232 -245 19.4888 0.00276
NP_440147.1_4 Forward -124 -111 5.91914 0.109
NP_440147.1_4 Forward -245 -232 3.46087 0.187
NP_440147.1_4 Reverse -367 -380 0.314277 0.257
NP_441550.1_8 Reverse -232 -242 14.6309 0.0132
NP_441550.1_8 Forward -245 -235 10.501 0.066
NP_441916.1_7 Reverse -234 -244 18.4663 0.00144
NP_441916.1_7 Forward -243 -233 10.3048 0.0261
NP_441916.1_10 Forward -386 -367 2.26107 0.25
NP_441041.1_4 Reverse -98 -117 -5.99873 0.162
NP_441041.1_4 Forward -147 -128 -6.58872 0.169
NP_441041.1_7 Forward -246 -234 19.5648 0.00277
NP_441041.1_7 Forward -172 -160 7.80631 0.159
NP_440016.1_9 Forward -75 -56 10.3242 0.262
NP_442396.1_5 Reverse -230 -243 20.1771 0.00762
NP_441725.1_5 Reverse -235 -245 9.02648 0.0553
NP_441725.1_5 Forward -242 -232 2.04498 0.115
NP_439966.1_7 Forward -245 -235 17.4824 0.00636
NP_439966.1_7 Reverse -232 -242 7.25606 0.15
NP_439966.1_7 Forward -71 -61 7.25606 0.15
NP_439966.1_7 Forward -64 -54 6.86274 0.163
NP_439966.1_9 Forward -245 -236 10.7178 0.0863
NP_442941.1_3 Forward -242 -232 11.0914 0.0116
NP_442941.1_3 Reverse -235 -245 2.53664 0.14
NP_440289.1_2 Forward -246 -233 19.6855 0.00426
NP_440289.1_2 Reverse -57 -70 -0.570702 0.202
NP_440983.1_5 Forward -119 -100 0.884433 0.214
NP_440260.1_8 Reverse -225 -243 4.14905 0.154
NP_440260.1_8 Forward -78 -60 -1.75081 0.237
NP_439908.1_10 Reverse -306 -325 15.2408 0.259
NP_442281.1_1 Forward -248 -234 17.6985 0.00542
NP_442281.1_1 Forward -127 -113 4.71887 0.184
NP_442281.1_1 Reverse -229 -243 1.5723 0.296
NP_440437.1_1 Forward -99 -80 0.0977854 0.172
NP_440437.1_1 Forward -71 -52 -0.983855 0.192
NP_442012.1_1 Reverse -228 -247 0.58944 0.235
NP_441087.1_6 Reverse -138 -156 -1.84987 0.273
NP_441556.1_10 Reverse -99 -113 14.9913 0.154
NP_442982.1_5 Forward -231 -212 15.4374 0.0748
NP_441644.1_6 Forward -243 -233 17.3841 0.00127
NP_441644.1_6 Reverse -234 -244 10.1076 0.0628
NP_441644.1_6 Forward -69 -59 4.20782 0.245
NP_442215.1_2 Reverse -232 -248 10.0883 0.0514
NP_442215.1_2 Forward -245 -229 2.02515 0.123
NP_442215.1_2 Forward -92 -76 -7.41462 0.294
NP_440253.1_2 Forward -243 -225 -1.55415 0.244
NP_440253.1_2 Reverse -234 -252 -2.53746 0.268
NP_440929.1_8 Forward -243 -234 19.2726 0.000701
NP_440929.1_8 Reverse -234 -243 19.2726 0.000701
NP_440929.1_8 Forward -378 -369 5.50626 0.132
NP_442933.1_10 Forward -243 -234 17.601 0.00325
NP_442933.1_10 Reverse -234 -243 17.601 0.00325
NP_441751.2_8 Forward -242 -228 -0.787057 0.129
NP_442554.1_8 Reverse -235 -245 16.008 0.0065
NP_442554.1_8 Forward -242 -232 15.3197 0.00882
NP_442554.1_8 Reverse -61 -71 3.22496 0.235
NP_441762.1_7 Reverse -233 -245 12.4287 0.0142
NP_441762.1_7 Forward -244 -232 9.57708 0.0142
NP_442142.1_4 Forward -246 -233 13.8833 0.0324
NP_442142.1_4 Reverse -231 -244 5.52525 0.188
NP_442142.1_4 Forward -87 -74 4.05029 0.234
NP_442292.1_1 Forward -242 -233 18.486 0.00229
NP_442292.1_1 Reverse -235 -244 9.63616 0.0183
NP_440122.1_2 Reverse -58 -77 1.27776 0.259
NP_441525.1_1 Reverse -71 -84 14.5723 0.212
NP_442476.1_6 Reverse -235 -249 7.57108 0.112
NP_442381.1_8 Forward -246 -227 3.34271 0.0717
NP_443009.1_5 Reverse -233 -244 18.3477 0.00265
NP_440397.1_3 Reverse -311 -330 16.3224 0.154
NP_441715.1_4 Reverse -235 -245 9.32148 0.097
NP_441715.1_4 Forward -242 -232 7.94484 0.107
NP_440730.1_4 Reverse -145 -164 -0.197208 0.26
NP_441448.1_1 Forward -164 -145 12.5858 0.165
NP_441448.1_1 Reverse -306 -325 5.70265 0.261
NP_441198.1_5 Forward -241 -228 14.67 0.206
NP_440379.1_5 Reverse -56 -75 -11.4069 0.296
NP_440464.1_10 Forward -242 -232 13.0082 0.169
NP_441758.1_3 Forward -63 -45 18.9962 0.188
NP_441468.1_1 Forward -242 -235 15.8704 0.0124
NP_441468.1_1 Reverse -235 -242 15.8704 0.0124
NP_441020.2_6 Forward -245 -228 13.8052 0.0663
NP_441673.1_1 Forward -243 -234 20.8459 0.000698
NP_441673.1_1 Reverse -234 -243 20.8459 0.000698
NP_441673.1_1 Forward -378 -369 -7.86675 0.187
NP_441673.1_1 Reverse -369 -378 -7.96508 0.206
NP_441826.1_2 Forward -249 -235 13.9626 0.0213
NP_441826.1_2 Forward -90 -76 -3.73699 0.286
NP_441330.1_1 Reverse -348 -367 -15.7335 0.294
NP_442063.1_5 Forward -140 -121 8.35759 0.245
NP_441764.1_8 Forward -102 -92 14.469 0.284
NP_442868.1_6 Reverse -232 -242 9.81313 0.038
NP_442868.1_6 Forward -245 -235 8.53483 0.0555
NP_442719.1_2 Forward -265 -247 -8.83133 0.257
NP_441612.1_2 Reverse -13 -23 8.83972 0.21
NP_441612.1_2 Forward -243 -233 8.54929 0.21
NP_442427.1_5 Forward -69 -50 8.35759 0.179
NP_442808.1_1 Forward -244 -234 18.4657 0.00201
NP_442808.1_1 Reverse -233 -243 8.63269 0.0481
NP_442808.1_1 Forward -63 -53 4.40448 0.199
NP_441101.1_10 Forward -73 -54 -6.1954 0.289
NP_440145.1_3 Forward -157 -138 0.392778 0.136
NP_440145.1_3 Forward -79 -60 -2.36049 0.168
NP_442820.1_3 Forward -81 -71 13.4509 0.277
NP_442542.1_2 Forward -245 -232 11.9173 0.114
NP_442542.1_2 Reverse -58 -71 9.85238 0.131
NP_442542.1_9 Forward -250 -236 12.3887 0.11
NP_442050.1_1 Reverse -53 -72 8.94757 0.25
NP_442050.1_5 Forward -245 -235 8.23937 0.234
NP_442050.1_5 Reverse -232 -242 7.64939 0.243
NP_442342.1_9 Reverse -369 -385 4.48343 0.249
NP_440342.1_1 Reverse -56 -75 11.2092 0.279
NP_440558.1_2 Forward -78 -59 2.16274 0.17
NP_441518.1_3 Forward -253 -234 -13.5702 0.264
NP_441878.1_6 Reverse -59 -69 10.7964 0.0176
NP_441878.1_6 Forward -244 -234 10.4031 0.0176
NP_441878.1_6 Reverse -233 -243 10.4031 0.0176
NP_441878.1_6 Reverse -338 -348 0.57002 0.14
NP_441878.1_6 Forward -76 -66 -0.118297 0.167
NP_441036.1_8 Forward -244 -234 17.7779 0.000554
NP_441036.1_8 Reverse -233 -243 8.33817 0.174
NP_441557.1_5 Forward -243 -234 19.9609 0.000699
NP_441557.1_5 Reverse -234 -243 19.9609 0.000699
NP_442066.2_4 Reverse -234 -253 -9.24366 0.296
NP_442066.2_9 Forward -247 -234 8.37742 0.185
NP_442066.2_9 Reverse -109 -122 7.00078 0.253
NP_441308.1_8 Forward -245 -235 9.22315 0.226
NP_440101.1_3 Reverse -55 -74 4.62101 0.212
NP_440101.1_3 Reverse -42 -61 0.491109 0.298
NP_440101.1_5 Reverse -332 -351 6.78429 0.183
NP_441458.1_10 Reverse -225 -244 2.75272 0.266
NP_442183.1_1 Reverse -234 -248 11.406 0.0702
NP_442183.1_1 Reverse -160 -174 3.73617 0.299
NP_442183.1_9 Forward -150 -140 9.12481 0.296
NP_442397.1_9 Forward -243 -224 2.55606 0.273
NP_441116.1_10 Forward -20 -1 6.88262 0.257
NP_442135.1_3 Forward -255 -236 17.3057 0.0894
NP_441574.1_1 Forward -288 -269 -5.01543 0.259
NP_441574.1_1 Reverse -101 -120 -6.09707 0.273
NP_441574.1_1 Reverse -190 -209 -6.98204 0.283
NP_441549.1_9 Forward -73 -55 -2.63579 0.198
NP_442347.1_2 Forward -242 -233 12.4878 0.056
NP_442347.1_2 Reverse -235 -244 11.1111 0.056
NP_442645.1_2 Reverse -226 -245 -12.2919 0.144
NP_441037.1_4 Forward -245 -235 16.2838 0.0168
NP_441037.1_4 Reverse -232 -242 7.9999 0.237
NP_442594.1_8 Forward -149 -130 2.75272 0.293
NP_441633.1_3 Reverse -232 -245 18.3088 0.00715
NP_441633.1_3 Forward -245 -232 -3.71729 0.177
NP_441633.1_3 Forward -71 -58 -5.78224 0.236
NP_440136.1_2 Forward -242 -235 15.9687 0.0123
NP_440136.1_2 Reverse -235 -242 15.9687 0.0123
NP_442590.1_9 Forward -163 -144 7.37428 0.25
NP_442998.1_10 Forward -241 -234 15.5754 0.0102
NP_442998.1_10 Reverse -236 -243 15.5754 0.0102
NP_440299.1_1 Reverse -230 -243 18.9965 0.00298
NP_440299.1_1 Forward -247 -234 11.4251 0.0489
NP_441799.1_1 Reverse -230 -244 17.4035 0.011
NP_441799.1_1 Forward -126 -112 4.32555 0.255
NP_441007.1_10 Forward -248 -235 3.46087 0.182
NP_440256.1_1 Reverse -231 -250 8.94757 0.0219
NP_440256.1_1 Forward -246 -227 -9.53865 0.281
NP_442961.1_7 Reverse -235 -254 10.3242 0.263
NP_441559.1_8 Forward -248 -234 -6.29359 0.276
NP_440915.1_6 Forward -247 -233 15.9292 0.0183
NP_440915.1_6 Reverse -56 -70 2.94952 0.11
NP_440915.1_6 Reverse -230 -244 0.687908 0.155
NP_442158.1_4 Reverse -95 -105 10.6981 0.283
NP_441296.1_9 Reverse -128 -141 16.8333 0.133
NP_440717.1_1 Reverse -235 -254 13.1758 0.172
NP_440717.1_1 Reverse -54 -73 11.7992 0.199
NP_440748.1_5 Forward -49 -30 -0.688862 0.26
NP_441464.1_10 Reverse -51 -65 9.2427 0.262
NP_441939.1_3 Reverse -235 -254 12.7825 0.0979
NP_439985.1_7 Reverse -54 -73 7.66927 0.188
NP_440677.1_6 Forward -230 -211 16.2241 0.131
NP_442386.1_9 Forward -244 -235 15.7322 0.0144
NP_442386.1_9 Reverse -233 -242 13.8639 0.0289
NP_441750.1_7 Forward -147 -137 14.7297 0.254
NP_441340.1_5 Forward -242 -235 15.6737 0.0124
NP_441340.1_5 Reverse -235 -242 15.6737 0.0124
NP_442484.1_2 Reverse -25 -44 -1.08219 0.284
NP_440327.1_6 Reverse -86 -105 15.3391 0.13
NP_439976.1_5 Reverse -317 -331 14.0603 0.257
NP_440161.1_3 Forward -245 -226 9.63589 0.238
NP_440586.1_8 Forward -242 -235 13.2151 0.026
NP_440586.1_8 Reverse -235 -242 13.2151 0.026
NP_442251.1_6 Forward -242 -235 15.2804 0.0124
NP_442251.1_6 Reverse -235 -242 15.2804 0.0124
NP_440684.1_9 Reverse -228 -242 9.5377 0.218
NP_441262.1_3 Reverse -234 -241 14.7888 0.0223
NP_441262.1_3 Forward -243 -236 14.7888 0.0223
NP_443051.1_1 Reverse -233 -242 10.4228 0.00754
NP_443051.1_1 Forward -244 -235 10.4228 0.00754
NP_441232.1_10 Reverse -223 -242 4.42435 0.197
NP_439937.1_8 Reverse -334 -353 0.294447 0.235
NP_439937.1_9 Reverse -233 -250 -8.31994 0.176
NP_439937.1_9 Forward -26 -9 -10.5815 0.231
NP_441740.2_10 Reverse -228 -247 7.37428 0.286
NP_440439.1_1 Forward -246 -233 2.47756 0.133
NP_440439.1_1 Forward -72 -59 -1.65234 0.275
NP_440372.1_2 Forward -242 -235 16.3621 0.0124
NP_440372.1_2 Reverse -235 -242 16.3621 0.0124
NP_442783.1_8 Forward -20 -1 14.8466 0.266
NP_441181.1_6 Reverse -99 -117 2.67408 0.293
NP_442511.1_6 Reverse -317 -336 3.73603 0.229
NP_441789.1_7 Forward -61 -42 0.686995 0.245
NP_440991.1_8 Forward -241 -222 19.2984 0.268
NP_440316.1_10 Reverse -59 -69 8.04317 0.24
NP_441803.1_2 Reverse -229 -248 5.99764 0.159
NP_439977.1_5 Forward -75 -56 1.86774 0.184
NP_439977.1_5 Forward -249 -230 -1.08219 0.241
NP_440139.1_1 Reverse -228 -247 4.42355 0.184
NP_441572.1_7 Forward -249 -230 15.6341 0.026
NP_442384.1_10 Forward -243 -230 16.7355 0.00732
NP_442384.1_10 Reverse -234 -247 2.2809 0.23
NP_442384.1_10 Reverse -60 -73 0.805932 0.278
NP_442114.1_4 Reverse -234 -245 12.1534 0.107
NP_442790.1_4 Forward -252 -233 -15.8318 0.297
NP_442262.1_6 Forward -185 -167 14.8671 0.272
NP_442262.1_10 Forward -242 -235 14.1988 0.0123
NP_442262.1_10 Reverse -235 -242 14.1988 0.0123
NP_441689.1_5 Reverse -232 -242 5.78111 0.197
NP_440344.1_10 Forward -250 -233 19.8034 0.00187
NP_440344.1_10 Reverse -227 -244 -5.46769 0.106
NP_440344.1_10 Forward -114 -97 -10.4826 0.182
NP_440531.1_6 Forward -251 -232 1.86774 0.166
NP_440531.1_8 Reverse -55 -74 3.83436 0.269
NP_441060.1_7 Forward -81 -62 9.3409 0.244
NP_442910.1_1 Forward -250 -231 -7.27704 0.254
NP_440189.1_10 Reverse -223 -242 5.89931 0.279
NP_440487.1_1 Forward -156 -137 -6.58872 0.261
NP_440562.1_10 Reverse -225 -243 6.90232 0.284
NP_441965.1_3 Reverse -224 -243 -0.4922 0.264
NP_441965.1_10 Forward -246 -230 3.89344 0.253
NP_440297.1_9 Forward -242 -232 -0.118297 0.282
NP_440297.1_9 Reverse -235 -245 -0.216628 0.282
NP_442280.1_10 Forward -79 -61 6.62323 0.27
NP_441592.1_4 Reverse -60 -79 4.81767 0.144
NP_441592.1_4 Forward -69 -50 0.491109 0.23
NP_441592.1_4 Forward -243 -224 -2.65548 0.268
NP_441896.1_3 Reverse -104 -123 3.34271 0.175
NP_442067.1_4 Forward -254 -235 2.75272 0.289
NP_440999.1_9 Forward -247 -233 23.6974 0.0055
NP_440999.1_9 Forward -56 -42 -0.492064 0.209
NP_440999.1_9 Reverse -134 -148 -0.983719 0.223
NP_440999.1_9 Forward -117 -103 -0.983719 0.223
NP_440888.1_2 Reverse -234 -248 20.9434 0.000502
NP_440888.1_2 Forward -243 -229 9.93039 0.11
NP_440888.1_2 Reverse -369 -383 8.65209 0.152
NP_440179.1_6 Forward -121 -102 5.50599 0.238
NP_440052.1_5 Forward -254 -235 -0.295539 0.189
NP_439969.1_3 Forward -248 -229 -0.983855 0.271
NP_442948.1_2 Reverse -233 -252 3.14605 0.294
NP_442033.1_10 Reverse -58 -77 -12.6852 0.274
NP_441543.1_2 Reverse -235 -244 18.486 0.00236
NP_441543.1_2 Forward -242 -233 16.9127 0.00359
NP_442845.1_2 Reverse -228 -242 5.40779 0.233
NP_442845.1_2 Reverse -54 -68 5.21113 0.24
NP_442845.1_2 Forward -249 -235 3.44117 0.29
NP_441178.1_6 Reverse -128 -147 7.07848 0.266
NP_441178.1_6 Forward -212 -193 1.57197 0.28
NP_441469.1_8 Forward -244 -235 16.126 0.00797
NP_441469.1_8 Reverse -233 -242 6.48957 0.227
NP_443064.1_6 Forward -243 -233 12.5669 0.0796
NP_442337.1_8 Reverse -183 -202 -1.27885 0.28
NP_442578.1_7 Forward -242 -235 14.5921 0.026
NP_442578.1_7 Reverse -235 -242 14.5921 0.026
NP_440710.1_1 Reverse -226 -244 -7.94566 0.249
NP_440071.1_1 Forward -114 -97 16.1643 0.216
NP_440148.1_1 Reverse -3 -22 -6.58872 0.265
NP_441462.1_2 Forward -243 -233 11.5831 0.00406
NP_441462.1_2 Reverse -234 -244 11.5831 0.00406
NP_441621.1_7 Forward -245 -231 -3.147 0.188
NP_441621.1_7 Reverse -232 -246 -3.44199 0.188
NP_442736.1_5 Reverse -238 -257 16.2241 0.113
NP_443062.1_1 Reverse -234 -252 6.59578 0.195
NP_443062.1_6 Reverse -226 -245 8.25926 0.148
NP_442204.1_5 Forward -253 -234 8.55425 0.115
NP_440544.1_5 Forward -20 -13 14.5681 0.264
NP_440516.1_2 Forward -86 -68 -0.0791831 0.243
NP_440516.1_8 Forward -243 -234 16.9127 0.00442
NP_440516.1_8 Reverse -234 -243 16.9127 0.00442
NP_442428.1_5 Forward -242 -235 15.8704 0.0124
NP_442428.1_5 Reverse -235 -242 15.8704 0.0124
NP_441443.1_7 Forward -159 -140 9.24257 0.111
NP_441790.1_3 Reverse -235 -254 -4.91709 0.291
NP_441267.1_2 Reverse -342 -361 10.8159 0.155
NP_442823.1_8 Forward -197 -178 13.2741 0.259
NP_440673.1_2 Reverse -224 -243 14.6819 0.0979
NP_440673.1_2 Reverse -103 -122 13.3161 0.121
NP_440673.1_3 Forward -241 -234 12.4288 0.0426
NP_440673.1_3 Reverse -236 -243 12.4288 0.0426
NP_440673.1_3 Reverse -106 -113 6.92228 0.277
NP_441052.1_2 Forward -243 -233 19.9412 0.00106
NP_441052.1_2 Reverse -234 -244 10.5014 0.0285
NP_441052.1_2 Forward -264 -254 9.41981 0.0314
NP_441052.1_2 Reverse -339 -349 1.84832 0.225
NP_441052.1_2 Reverse -281 -291 -0.0199663 0.265
NP_442219.1_8 Forward -388 -369 6.62097 0.292
NP_442219.1_9 Forward -242 -233 17.7976 0.00718
NP_442219.1_9 Reverse -235 -244 8.35786 0.0681
NP_440436.1_4 Reverse -235 -244 18.1905 0.00233
NP_440436.1_4 Forward -242 -233 17.2072 0.00233
NP_441884.1_9 Forward -246 -227 5.211 0.0236
NP_441884.1_9 Reverse -231 -250 -22.42 0.278
NP_442412.1_3 Reverse -172 -191 12.8808 0.248
NP_441893.1_5 Forward -66 -52 19.3701 0.166
NP_442864.1_7 Forward -161 -143 6.50899 0.274
NP_441719.1_4 Forward -242 -235 16.3621 0.0124
NP_441719.1_4 Reverse -235 -242 16.3621 0.0124
NP_441733.1_10 Forward -246 -233 10.639 0.106
NP_441733.1_10 Reverse -231 -244 7.09911 0.156
NP_441004.1_1 Forward -159 -140 -12.0953 0.244
NP_441004.1_1 Reverse -54 -73 -16.6185 0.286
NP_442366.1_3 Reverse -112 -130 1.39578 0.151
NP_442366.1_3 Forward -244 -226 -1.75081 0.217
NP_442366.1_5 Reverse -231 -241 15.4175 0.0374
NP_442873.1_3 Forward -85 -66 6.58682 0.223
NP_440296.1_10 Forward -246 -227 -7.96535 0.246
NP_442206.1_1 Reverse -66 -85 -13.1769 0.247
NP_443054.1_2 Reverse -232 -246 12.4876 0.0722
NP_443054.1_2 Forward -71 -57 6.58777 0.187
NP_441851.1_10 Forward -244 -234 16.008 0.00552
NP_441851.1_10 Reverse -233 -243 15.8113 0.00552
NP_441501.1_6 Reverse -65 -84 12.7825 0.288
NP_442898.1_2 Forward -106 -87 18.0915 0.287
NP_442856.1_7 Forward -252 -233 4.42435 0.137
NP_441273.1_8 Reverse -67 -86 -1.47551 0.214
NP_442515.1_1 Reverse -233 -247 -2.36035 0.273
NP_442515.1_1 Forward -107 -93 -3.04867 0.285
NP_442515.1_1 Forward -244 -230 -4.4253 0.298
NP_440593.1_3 Forward -248 -229 -1.47551 0.211
NP_440593.1_3 Forward -353 -334 -6.58872 0.278
NP_440165.1_3 Forward -123 -109 20.4518 0.0858
NP_440940.1_7 Forward -179 -161 3.06666 0.282
NP_441349.1_10 Reverse -224 -243 3.6377 0.0652
NP_440432.1_9 Reverse -235 -250 6.76473 0.0455
NP_440432.1_9 Forward -242 -227 0.176559 0.159
NP_442843.1_1 Reverse -37 -56 -10.7186 0.28
NP_440474.1_8 Reverse -235 -249 8.45543 0.186
NP_441477.1_10 Reverse -338 -356 6.11567 0.184
NP_442450.1_5 Reverse -232 -242 7.55152 0.13
NP_440588.1_2 Reverse -95 -114 4.62101 0.0798
NP_440588.1_2 Reverse -225 -244 0.0977854 0.149
NP_440195.1_5 Forward -249 -230 3.6377 0.273
NP_442006.1_2 Forward -156 -139 -15.1041 0.215
NP_442006.1_2 Reverse -66 -83 -17.9557 0.285
NP_442006.1_2 Forward -393 -376 -18.8407 0.296
NP_442243.1_1 Forward -249 -231 6.40989 0.178
NP_441570.1_1 Forward -243 -225 -6.66736 0.0813
NP_441570.1_1 Reverse -234 -252 -7.84733 0.0968
NP_441570.1_1 Forward -378 -360 -16.5988 0.249
NP_441078.1_4 Forward -243 -234 19.6659 0.0007
NP_441078.1_4 Reverse -234 -243 19.6659 0.0007
NP_441078.1_4 Forward -264 -255 3.44131 0.14
NP_441078.1_4 Reverse -60 -69 -1.86856 0.272
NP_442729.1_8 Forward -247 -234 8.47575 0.125
NP_442348.1_2 Forward -26 -17 7.76787 0.28
NP_440707.1_9 Forward -146 -127 4.52268 0.255
NP_441094.1_6 Forward -250 -233 8.69123 0.261
NP_440526.1_3 Reverse -235 -246 11.7595 0.0646
NP_440526.1_3 Forward -68 -57 1.6315 0.267
NP_440526.1_3 Forward -242 -231 1.04151 0.267
NP_441432.1_8 Reverse -233 -242 16.8143 0.00595
NP_441432.1_8 Forward -244 -235 8.25953 0.0755
NP_441432.1_8 Forward -123 -114 5.40793 0.158
NP_442320.1_8 Forward -249 -235 24.2873 0.00275
NP_442320.1_8 Reverse -228 -242 -4.81863 0.188
NP_441732.1_2 Forward -247 -231 -15.1828 0.145
NP_441732.1_2 Reverse -230 -246 -16.3627 0.165
NP_441732.1_2 Reverse -365 -381 -17.346 0.253
NP_440760.1_1 Reverse -234 -253 -5.9004 0.053
NP_440760.1_1 Forward -243 -224 -16.3235 0.172
NP_440578.1_7 Forward -55 -36 17.7965 0.198
NP_441945.1_10 Reverse -97 -116 9.83255 0.258
NP_441805.1_2 Forward -254 -235 -4.42544 0.275
NP_442353.1_4 Forward -249 -230 3.14526 0.22
NP_442353.1_4 Forward -119 -100 0.785326 0.265
NP_442400.1_10 Forward -322 -309 10.2794 0.261
NP_442489.1_2 Forward -118 -99 2.85105 0.254
NP_442489.1_7 Forward -243 -234 20.1576 0.000695
NP_442489.1_7 Reverse -234 -243 20.1576 0.000695
NP_442489.1_7 Reverse -60 -69 -1.37691 0.195
NP_442489.1_7 Reverse -113 -122 -1.57357 0.213
NP_440757.1_6 Forward -262 -243 8.55425 0.293
NP_441706.1_10 Reverse -231 -250 10.8159 0.212
NP_440386.1_3 Reverse -201 -220 -7.37537 0.274
NP_440386.1_3 Reverse -4 -23 -11.8003 0.287
NP_440559.1_1 Forward -242 -233 17.4043 0.00658
NP_440559.1_1 Reverse -235 -244 8.75118 0.0586
NP_441659.2_8 Forward -243 -233 18.1713 0.00133
NP_441659.2_8 Reverse -234 -244 11.9764 0.0147
NP_441659.2_8 Forward -69 -59 4.79825 0.125
NP_441659.2_8 Reverse -138 -148 0.471689 0.264
NP_441022.1_1 Forward -13 -4 11.5462 0.274
NP_442913.1_10 Forward -252 -233 3.93269 0.0964
NP_441040.1_2 Reverse -96 -115 -8.35868 0.236
NP_440779.1_5 Reverse -234 -251 -5.46769 0.149
NP_442346.1_1 Reverse -54 -73 10.2259 0.27
NP_442346.1_5 Reverse -233 -243 16.6963 0.00248
NP_442346.1_5 Reverse -338 -348 10.2065 0.103
NP_442346.1_5 Forward -244 -234 9.02648 0.118
NP_442346.1_5 Reverse -80 -90 5.78156 0.229
NP_440352.1_5 Forward -111 -92 15.9652 0.111
NP_440545.1_3 Reverse -230 -247 5.54538 0.0608
NP_440545.1_3 Reverse -251 -268 -5.46769 0.25
NP_440545.1_3 Forward -352 -335 -5.66436 0.256
NP_440545.1_3 Reverse -335 -352 -5.76269 0.259
NP_440545.1_5 Reverse -230 -247 11.7402 0.21
NP_440545.1_5 Reverse -49 -66 11.5436 0.21
NP_441856.1_7 Forward -156 -137 11.6025 0.246
NP_440486.1_6 Forward -120 -101 7.07928 0.278
NP_440459.1_2 Reverse -232 -249 10.8552 0.189
NP_440459.1_2 Forward -252 -235 8.29864 0.266
NP_441653.1_2 Forward -254 -235 4.10942 0.261
NP_440010.1_3 Reverse -191 -210 -4.52377 0.25
NP_440847.1_3 Reverse -377 -391 11.7003 0.261
NP_442828.1_7 Forward -157 -138 -5.11376 0.277
NP_441888.1_7 Forward -248 -234 2.5562 0.225
NP_440449.1_6 Forward -251 -233 5.72699 0.271
NP_441948.1_4 Reverse -227 -245 9.65558 0.0565
NP_441833.1_4 Forward -242 -235 15.9687 0.0124
NP_441833.1_4 Reverse -235 -242 15.9687 0.0124
NP_441895.1_10 Forward -160 -141 -27.5332 0.282
NP_442162.1_9 Forward -242 -235 16.2637 0.0124
NP_442162.1_9 Reverse -235 -242 16.2637 0.0124
NP_440671.1_4 Forward -249 -235 8.06273 0.204
NP_442073.1_6 Forward -252 -233 -1.7705 0.283
NP_442140.1_3 Reverse -235 -245 17.4829 0.0159
NP_442140.1_3 Forward -242 -232 12.2714 0.0632
NP_440875.1_9 Reverse -236 -246 17.619 0.0104
NP_441813.1_5 Forward -245 -235 10.0098 0.0208
NP_441813.1_5 Reverse -232 -242 8.63316 0.0367
NP_440590.1_4 Reverse -235 -248 21.7504 0.00377
NP_440590.1_4 Reverse -54 -67 0.904263 0.14
NP_440590.1_4 Forward -242 -229 0.707601 0.144
NP_440567.1_1 Reverse -235 -249 18.8791 0.0136
NP_440567.1_1 Forward -242 -228 13.0776 0.0213
NP_442497.1_4 Reverse -199 -218 10.8379 0.271
NP_442497.1_10 Forward -242 -233 10.4228 0.0087
NP_442497.1_10 Reverse -235 -244 10.4228 0.0087
NP_440821.1_4 Forward -245 -235 18.7612 0.00422
NP_440821.1_4 Reverse -232 -242 9.41981 0.0286
NP_441239.1_9 Forward -245 -233 16.0669 0.0175
NP_441239.1_9 Reverse -232 -244 5.93884 0.202
NP_441239.1_9 Forward -64 -52 4.5622 0.251
NP_441239.1_9 Forward -77 -65 3.77555 0.276
NP_441239.1_9 Reverse -58 -70 3.2839 0.289
NP_441951.1_4 Reverse -228 -247 5.01433 0.273
NP_441951.1_9 Reverse -139 -158 4.42435 0.254
NP_441951.1_9 Forward -251 -232 -1.7705 0.299
NP_440706.1_2 Forward -174 -156 27.0593 0.00615
NP_440706.1_3 Forward -337 -318 23.5974 0.0153
NP_441727.1_10 Reverse -93 -112 14.6499 0.25
NP_441892.1_1 Forward -252 -235 -3.69774 0.247
NP_441892.1_4 Forward -91 -72 0.294447 0.28
NP_442044.1_1 Reverse -60 -79 -14.7502 0.299
NP_442270.1_6 Forward -244 -226 15.2604 0.279
NP_440949.1_7 Reverse -67 -86 17.3048 0.144
NP_441617.1_6 Reverse -91 -110 4.42435 0.155
NP_440546.1_4 Reverse -234 -244 11.8882 0.0679
NP_440546.1_4 Forward -243 -233 10.046 0.109
NP_440546.1_4 Forward -221 -211 7.04032 0.264
NP_440462.1_6 Forward -245 -235 17.9746 0.00578
NP_440462.1_6 Reverse -232 -242 1.35667 0.294
NP_442611.1_1 Reverse -234 -253 1.76941 0.234
NP_442611.1_1 Reverse -60 -79 -2.95047 0.295
NP_440868.1_4 Reverse -230 -242 6.1355 0.0878
NP_440868.1_4 Forward -247 -235 2.98891 0.142
NP_441269.1_10 Forward -152 -135 18.6234 0.173
NP_442402.1_4 Forward -272 -253 9.93006 0.11
NP_442402.1_6 Forward -293 -284 13.7661 0.276
NP_442402.1_10 Forward -253 -243 10.796 0.282
NP_442039.1_4 Forward -242 -235 15.1821 0.0124
NP_442039.1_4 Reverse -235 -242 15.1821 0.0124
NP_442039.1_4 Reverse -203 -210 7.02061 0.269
NP_442039.1_10 Forward -61 -43 15.4563 0.227
NP_441811.1_4 Reverse -61 -80 -0.4922 0.295
NP_442679.1_1 Forward -199 -180 -2.0655 0.24
NP_440825.1_7 Forward -242 -232 12.9096 0.152
NP_442696.1_2 Forward -123 -105 11.6222 0.157
NP_442696.1_2 Reverse -368 -386 9.65558 0.244
NP_442837.1_3 Forward -242 -235 15.7721 0.0124
NP_442837.1_3 Reverse -235 -242 15.7721 0.0124
NP_442053.1_1 Forward -243 -234 18.3876 0.0007
NP_442053.1_1 Reverse -234 -243 18.3876 0.0007
NP_442053.1_1 Reverse -369 -378 10.3245 0.0537
NP_442053.1_1 Forward -69 -60 5.70292 0.172
NP_440505.1_3 Forward -245 -235 14.1397 0.0235
NP_440505.1_3 Reverse -232 -242 9.22315 0.122
NP_440505.1_3 Forward -149 -139 4.69992 0.272
NP_442971.1_5 Reverse -181 -200 14.7491 0.2
NP_440914.1_1 Forward -243 -233 17.5935 0.000537
NP_440914.1_1 Reverse -234 -244 8.6151 0.186
NP_441011.1_8 Reverse -235 -244 16.9127 0.00602
NP_441011.1_8 Forward -242 -233 8.25953 0.144
NP_442101.1_2 Forward -149 -130 17.5024 0.184
NP_442533.1_1 Forward -162 -143 -17.1101 0.281
NP_442533.1_1 Reverse -50 -69 -17.6018 0.291
NP_442533.1_6 Forward -243 -234 17.2076 0.00137
NP_442533.1_6 Reverse -234 -243 17.2076 0.00137
NP_442533.1_6 Forward -69 -60 11.8978 0.0362
NP_442533.1_6 Forward -62 -53 4.52295 0.179
NP_442533.1_6 Forward -348 -339 4.42462 0.179
NP_442533.1_6 Reverse -212 -221 4.12963 0.191
NP_442541.1_10 Forward -75 -61 5.60385 0.248
NP_442232.1_3 Reverse -52 -71 -14.6519 0.288
NP_442229.1_1 Reverse -232 -246 8.25877 0.184
NP_443016.1_1 Reverse -228 -247 -0.39387 0.219
NP_441482.1_7 Forward -75 -61 -12.0951 0.29
NP_439944.1_9 Forward -242 -232 10.5014 0.0887
NP_439944.1_9 Reverse -235 -245 10.4031 0.0887
NP_440816.1_7 Forward -247 -228 16.5191 0.181
NP_441527.1_4 Reverse -2 -21 -12.2711 0.285
NP_441961.1_4 Reverse -52 -71 3.34271 0.279
NP_441602.1_3 Reverse -229 -248 0.0977854 0.219
NP_441972.1_5 Reverse -235 -254 7.66927 0.0748
NP_441106.1_1 Forward -244 -235 18.191 0.0028
NP_441106.1_1 Reverse -233 -242 9.63616 0.0311
NP_441815.1_6 Reverse -127 -146 -0.197979 0.291
NP_440444.1_3 Forward -216 -197 0.491109 0.278
NP_441286.1_1 Reverse -233 -245 14.7886 0.00418
NP_441286.1_1 Forward -244 -232 3.38223 0.0467
NP_441286.1_1 Forward -70 -58 -4.87757 0.18
NP_440670.1_8 Forward -243 -234 18.3876 0.000699
NP_440670.1_8 Reverse -234 -243 18.3876 0.000699
NP_440886.1_7 Forward -244 -234 17.7774 0.0011
NP_440886.1_7 Forward -372 -362 11.7793 0.0805
NP_440886.1_7 Reverse -233 -243 7.94438 0.0805
NP_440886.1_7 Reverse -137 -147 6.37109 0.13
NP_440886.1_7 Forward -114 -104 4.50281 0.232
NP_440886.1_7 Forward -63 -53 4.01116 0.255
NP_440828.1_1 Reverse -137 -156 4.52188 0.214
NP_440828.1_4 Forward -123 -104 -5.70449 0.258
NP_441001.1_10 Reverse -103 -122 4.42435 0.295
NP_442614.1_2 Reverse -384 -398 7.37441 0.275
NP_441784.1_4 Forward -23 -4 6.78429 0.204
NP_442072.1_9 Reverse -233 -251 -3.52077 0.0363
NP_441753.1_10 Reverse -66 -85 10.3242 0.15
NP_442022.1_4 Reverse -54 -73 6.39097 0.271
NP_442022.1_4 Reverse -43 -62 5.211 0.293
NP_440907.2_8 Reverse -235 -245 17.4824 0.00685
NP_440907.2_8 Forward -242 -232 7.64939 0.117
NP_441626.1_2 Forward -242 -235 15.7721 0.0124
NP_441626.1_2 Reverse -235 -242 15.7721 0.0124
NP_441988.1_2 Forward -116 -97 13.9625 0.239
NP_442365.1_7 Forward -73 -54 -4.81876 0.25
NP_442365.1_7 Forward -247 -228 -5.9004 0.282
NP_440107.1_5 Reverse -227 -246 -7.08038 0.278
NP_442794.1_1 Reverse -230 -242 9.38042 0.0795
NP_442615.1_1 Reverse -225 -243 8.37728 0.0284
NP_442615.1_1 Forward -252 -234 -5.19239 0.206
NP_441962.1_4 Reverse -229 -248 -3.83545 0.152
NP_441962.1_4 Reverse -61 -80 -5.01543 0.163
NP_441962.1_4 Forward -248 -229 -8.65367 0.203
NP_441962.1_4 Reverse -334 -353 -13.5702 0.275
NP_440387.1_1 Forward -243 -227 15.0048 0.00592
NP_440387.1_5 Reverse -299 -318 14.4981 0.26
NP_441431.1_2 Forward -246 -232 18.1901 0.0199
NP_441488.1_7 Reverse -228 -247 0.687771 0.296
NP_441836.1_1 Reverse -223 -242 17.5381 0.073
NP_441836.1_2 Reverse -231 -250 -1.37718 0.217
NP_441836.1_2 Reverse -54 -73 -4.42544 0.255
NP_440634.1_1 Forward -71 -52 19.469 0.17
NP_441993.1_1 Reverse -54 -73 11.4975 0.113
NP_440114.1_10 Reverse -234 -248 6.88276 0.253
NP_440293.1_3 Reverse -58 -77 -1.86883 0.239
NP_440766.1_4 Forward -247 -233 8.45605 0.0871
NP_441237.1_9 Forward -242 -232 14.828 0.0242
NP_442743.1_4 Reverse -235 -254 -0.295539 0.174
NP_442743.1_5 Reverse -229 -248 2.94938 0.279
NP_439910.1_2 Forward -251 -234 -21.9873 0.202
NP_442867.1_8 Reverse -139 -158 9.83255 0.215
NP_440457.1_1 Reverse -56 -68 8.10212 0.101
NP_440457.1_1 Forward -247 -235 5.34885 0.141
NP_440457.1_1 Reverse -230 -242 0.825626 0.25
NP_440987.1_4 Reverse -200 -219 6.58763 0.181
NP_440798.1_6 Reverse -235 -248 3.85419 0.147
NP_441801.1_4 Forward -207 -197 2.53664 0.292
NP_440801.1_8 Forward -244 -225 1.17943 0.246
NP_442040.1_4 Forward -261 -242 11.6025 0.11
NP_442509.1_9 Reverse -234 -244 16.2041 0.00739
NP_442509.1_9 Reverse -16 -26 10.3043 0.184
NP_442509.1_9 Forward -33 -23 8.43603 0.192
NP_442509.1_9 Forward -243 -233 8.14104 0.192
NP_440554.1_4 Reverse -235 -245 13.943 0.0218
NP_442862.1_3 Reverse -307 -324 4.46374 0.29
NP_441885.1_5 Forward -243 -233 20.9245 0.000538
NP_441885.1_5 Reverse -234 -244 11.4848 0.00668
NP_441885.1_5 Reverse -60 -70 -0.609952 0.215
NP_442228.1_10 Reverse -239 -258 12.8808 0.231
NP_440478.1_10 Forward -245 -231 8.25939 0.257
NP_442341.1_7 Reverse -233 -247 22.0257 0.00401
NP_442341.1_7 Forward -244 -230 7.66941 0.0994
NP_442395.2_4 Reverse -233 -252 2.55527 0.221
NP_440423.1_6 Reverse -52 -71 -12.4886 0.195
NP_443000.1_7 Reverse -232 -242 10.3048 0.0345
NP_443000.1_7 Forward -245 -235 2.04498 0.226
NP_441842.1_10 Forward -250 -236 15.7325 0.0381
NP_441842.1_10 Reverse -195 -209 13.3726 0.0776
NP_441842.1_10 Reverse -227 -241 10.6193 0.157
NP_440275.1_3 Forward -245 -235 17.9746 0.0082
NP_440275.1_3 Reverse -232 -242 8.04317 0.0602
NP_440091.1_1 Forward -247 -235 12.6253 0.0353
NP_440091.1_1 Reverse -230 -242 1.41561 0.197
NP_443010.1_10 Forward -246 -229 8.76209 0.16
NP_442451.1_2 Forward -251 -232 -2.85214 0.187
NP_439962.1_4 Reverse -194 -213 0.982764 0.197
NP_439962.1_6 Forward -151 -133 6.90232 0.288
NP_439962.1_8 Reverse -207 -226 7.66927 0.21
NP_442495.1_9 Forward -122 -103 21.3364 0.167
NP_440149.1_8 Forward -243 -224 -3.3438 0.187
NP_441105.1_3 Forward -254 -235 -1.08219 0.145
NP_440216.1_1 Reverse -234 -248 8.25939 0.0061
NP_440216.1_1 Forward -243 -229 -1.47537 0.0328
NP_440216.1_6 Forward -250 -234 5.6634 0.189
NP_440172.1_1 Forward -243 -233 15.0247 0.00945
NP_440172.1_1 Reverse -234 -244 8.73149 0.0586
NP_442371.1_1 Reverse -198 -208 12.7626 0.24
NP_442015.1_10 Forward -247 -234 3.95252 0.178
NP_442015.1_10 Reverse -230 -243 1.49425 0.204
NP_442015.1_10 Reverse -134 -147 1.10092 0.213
NP_442015.1_10 Forward -73 -60 -0.472371 0.268
NP_441226.1_7 Forward -242 -235 14.4934 0.0123
NP_441226.1_7 Reverse -235 -242 14.4934 0.0123
NP_442834.1_9 Forward -239 -220 4.81767 0.275
NP_441111.1_7 Forward -242 -234 18.7023 0.00294
NP_441111.1_7 Reverse -235 -243 18.7023 0.00294
NP_441766.1_2 Forward -243 -234 17.5026 0.00297
NP_441766.1_2 Reverse -234 -243 17.5026 0.00297
NP_442252.1_4 Reverse -55 -74 12.9791 0.278
NP_440416.1_9 Reverse -227 -246 -18.7818 0.264
NP_443052.1_8 Forward -253 -234 -9.34199 0.189
NP_443052.1_9 Reverse -128 -147 -4.52377 0.258
NP_443052.1_9 Reverse -185 -204 -6.58872 0.285
NP_442154.1_1 Reverse -96 -114 -14.1405 0.217
NP_442154.1_1 Forward -155 -137 -16.9921 0.247
NP_440261.1_5 Reverse -235 -248 -1.06236 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGTTAATTGCTACGGGCAAAGTGGAGCACGCCTACCTCGGCATTCAAATGGTGACCATGACCCCGGAACTACAAAGCCAAATTCGCCAAGAAACGGGTATGAACATTCCTGTGGATAAGGGTGTAGTGATTATGCAGGTTATGCCCAACTCTCCAGCGGCGATCGCCAAACTGGAACAAGGGGATGTGCTCCAATCTCTCCAGGGACAACCAGTGGAAAATGCTGAACAGGTACAATCCCTAGTGGGCAAACTGGCGGTGGGAGACGAAGTGGAACTAGGCATTCTCCGCAACGGCCAACAGCAAAATTTAACCGTCACCATTGGTGCCCTGCCCAGCGCCCCTCCCCAATAAACGCCCATTACTAGGACAAACGGGGGTTTTTCTCCTAAACTTTTAGG

CDS

ATGTTGGATCAGGGCCCGTTGGCAAAAATTCAAGTTGCCCCTCACCCTCCCCAAGGAAGCTCTGGCCAACCTGGGGGGTTTGTAGGTGTAAACCGGTTCCCAATCCTTTTTAACTTTGATTTTTTAGATTTAACTAAAATTATGGTTTGGACCAAAGCCCTCGCCCAAAGTGAGCTTCCCCCCGGTAGTCGTCAAGTGGTTAAGGTAAACCAACAGGCTATTCTGTTGCTGAATGAAGGGGGTACTATCCACGCAGTTAGTAACCAGTGCCCCCATCTCAAATTACCGATGAAAAGCGGCAAAATTAAGGACGGGGCGATTGTTTGTCCTTTCCACCGCAGTGCCTTCGATCTTTGTTCCGGTGCTGTGCAGGAATGGAGTCCCTTTCCACCTGTGGTGGGGGGTTTGATGGGCAAAATGTCGGCGGAAAAGCCCCTGCCGGTGTTCCCTGTGCGGGTGGAAAATGGAGAAGTACAGGTGGATTTAGGCGCCTGA

Protein

MLDQGPLAKIQVAPHPPQGSSGQPGGFVGVNRFPILFNFDFLDLTKIMVWTKALAQSELPPGSRQVVKVNQQAILLLNEGGTIHAVSNQCPHLKLPMKSGKIKDGAIVCPFHRSAFDLCSGAVQEWSPFPPVVGGLMGKMSAEKPLPVFPVRVENGEVQVDLGA