Your browser is old and dusty. Try Google Chrome!

Details for slr1203

ORF slr1203
Accession NP_440704.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -196 -182 -0.590395 0.234
NP_441061.1_2 Reverse -189 -203 -2.55701 0.296
NP_441418.1_6 Forward -197 -178 -10.227 0.0328
NP_441453.1_4 Forward -197 -189 6.80426 0.121
NP_441453.1_4 Reverse -188 -196 6.11594 0.121
NP_441453.1_7 Forward -107 -100 11.6422 0.298
NP_440561.1_4 Reverse -269 -288 13.5023 0.229
NP_441818.1_9 Reverse -266 -285 -10.817 0.299
NP_442169.1_1 Reverse -356 -375 1.57275 0.261
NP_440259.1_4 Reverse -66 -80 20.8795 0.0716
NP_442744.1_8 Forward -293 -274 -5.21209 0.297
NP_443002.1_5 Forward -328 -310 9.16315 0.297
NP_442173.1_1 Reverse -189 -197 12.0158 0.0316
NP_442173.1_1 Forward -196 -188 4.83764 0.241
NP_442752.1_4 Forward -197 -190 13.8055 0.0199
NP_441812.1_3 Forward -321 -307 8.45605 0.252
NP_440784.1_7 Forward -196 -189 6.23397 0.241
NP_440784.1_7 Reverse -189 -196 6.13563 0.241
NP_442909.1_7 Reverse -183 -197 6.19383 0.255
NP_440878.1_9 Forward -290 -271 4.42435 0.174
NP_442268.1_3 Forward -328 -309 13.3716 0.284
NP_439918.1_3 Forward -200 -181 4.22769 0.264
NP_440132.1_1 Forward -199 -181 8.96727 0.255
NP_442110.1_7 Forward -396 -382 2.35953 0.222
NP_441083.1_5 Reverse -188 -198 8.82982 0.03
NP_441083.1_5 Forward -197 -187 7.05986 0.067
NP_442827.1_8 Forward -205 -186 -3.14789 0.298
NP_441738.1_2 Reverse -190 -197 15.28 0.0102
NP_441738.1_2 Forward -374 -367 6.72528 0.236
NP_441558.1_5 Reverse -186 -205 9.83255 0.112
NP_440209.1_1 Forward -197 -189 8.57422 0.0425
NP_440209.1_1 Reverse -188 -196 5.52596 0.0821
NP_441713.1_1 Reverse -111 -130 -7.76869 0.137
NP_442570.1_3 Forward -117 -98 -5.9004 0.25
NP_442111.1_4 Reverse -187 -201 16.2242 0.0166
NP_442111.1_4 Forward -397 -383 3.44117 0.244
NP_440906.1_5 Forward -196 -189 6.23397 0.234
NP_440906.1_5 Reverse -189 -196 6.13563 0.241
NP_441486.1_1 Forward -200 -186 -5.80194 0.26
NP_441014.1_10 Forward -174 -155 9.04509 0.125
NP_441014.1_10 Reverse -5 -24 -2.8529 0.289
NP_442848.1_9 Forward -286 -267 0.0977854 0.276
NP_441012.1_4 Forward -284 -271 7.98409 0.272
NP_443018.1_3 Reverse -189 -196 11.7405 0.0655
NP_443018.1_3 Forward -196 -189 5.44732 0.193
NP_440376.1_1 Forward -197 -188 5.99792 0.111
NP_440376.1_1 Reverse -271 -280 5.50626 0.131
NP_440376.1_1 Reverse -188 -197 -0.196935 0.285
NP_441588.1_4 Reverse -190 -200 14.238 0.0773
NP_442687.1_7 Reverse -187 -197 5.97822 0.179
NP_442687.1_7 Forward -198 -188 4.50326 0.245
NP_440667.1_2 Forward -191 -172 -2.0655 0.232
NP_440236.1_2 Reverse -163 -181 -4.30741 0.277
NP_442658.1_1 Forward -199 -189 6.17443 0.235
NP_442496.1_5 Forward -85 -67 4.24738 0.295
NP_442205.1_3 Forward -340 -321 15.1481 0.285
NP_440656.1_8 Forward -27 -8 -9.34199 0.282
NP_441414.1_9 Forward -197 -178 -8.65367 0.242
NP_441414.1_9 Reverse -188 -207 -10.522 0.287
NP_442937.1_5 Forward -202 -183 13.6675 0.0879
NP_441958.1_5 Reverse -187 -197 0.865012 0.12
NP_441958.1_5 Forward -198 -188 0.865012 0.12
NP_440203.1_5 Forward -374 -364 10.4026 0.225
NP_442816.1_7 Forward -183 -164 4.72643 0.269
NP_442816.1_7 Forward -162 -143 4.24897 0.279
NP_442911.1_2 Reverse -178 -197 -4.32711 0.132
NP_443055.1_6 Reverse -180 -198 1.5917 0.227
NP_440993.1_3 Forward -140 -121 3.44025 0.181
NP_441099.1_5 Reverse -178 -197 8.65258 0.0371
NP_441099.1_5 Forward -285 -266 -11.1119 0.271
NP_442002.1_9 Forward -198 -191 10.7572 0.185
NP_441654.1_7 Forward -80 -61 14.0822 0.212
NP_441000.1_6 Reverse -187 -201 -3.63866 0.225
NP_442771.1_1 Reverse -186 -204 -9.51896 0.227
NP_440147.1_4 Forward -199 -186 1.78924 0.22
NP_441175.1_7 Forward -197 -178 11.2092 0.15
NP_441550.1_8 Reverse -186 -196 10.796 0.0625
NP_441550.1_8 Forward -199 -189 7.0594 0.178
NP_441916.1_10 Reverse -156 -175 0.687771 0.278
NP_441041.1_7 Forward -200 -188 4.98816 0.282
NP_440569.1_6 Forward -117 -98 6.88262 0.228
NP_441725.1_5 Forward -196 -186 9.32148 0.0553
NP_439966.1_7 Reverse -186 -196 8.82935 0.13
NP_439966.1_9 Forward -199 -190 0.884706 0.253
NP_440289.1_2 Reverse -185 -198 -3.81562 0.271
NP_440289.1_2 Forward -200 -187 -5.09393 0.297
NP_441514.1_6 Reverse -366 -373 12.8221 0.252
NP_442281.1_1 Reverse -183 -197 2.26061 0.272
NP_440177.1_9 Forward -205 -186 13.1758 0.228
NP_440177.1_9 Reverse -263 -282 12.3892 0.238
NP_001035871.2_7 Reverse -102 -112 13.0581 0.231
NP_442500.1_8 Forward -78 -64 9.98557 0.272
NP_441644.1_6 Reverse -188 -198 7.15773 0.133
NP_443049.1_6 Forward -198 -188 11.6409 0.24
NP_442215.1_2 Reverse -269 -285 -6.23465 0.266
NP_442215.1_2 Forward -295 -279 -7.41462 0.294
NP_442029.1_6 Reverse -254 -273 6.19431 0.242
NP_442247.1_8 Forward -199 -185 8.35772 0.273
NP_440253.1_2 Forward -197 -179 2.0841 0.144
NP_440929.1_8 Reverse -188 -197 7.07956 0.0713
NP_442933.1_1 Reverse -65 -84 8.16414 0.253
NP_442554.1_8 Reverse -189 -199 3.42162 0.226
NP_442554.1_8 Forward -196 -186 2.92996 0.249
NP_441762.1_7 Reverse -187 -199 1.41561 0.0747
NP_441762.1_7 Forward -198 -186 -5.46756 0.212
NP_442142.1_4 Reverse -185 -198 2.57534 0.286
NP_442292.1_1 Reverse -189 -198 -0.196935 0.239
NP_440775.1_6 Forward -83 -64 21.915 0.0338
NP_443009.1_5 Reverse -36 -47 7.43299 0.129
NP_441198.1_8 Reverse -35 -45 12.5877 0.12
NP_441198.1_8 Forward -48 -38 11.3181 0.211
NP_440379.1_5 Forward -118 -99 -10.817 0.285
NP_441468.1_1 Forward -196 -189 6.13563 0.209
NP_441468.1_1 Reverse -189 -196 6.0373 0.223
NP_441020.2_6 Forward -199 -182 15.4768 0.0401
NP_441020.2_6 Reverse -186 -203 8.00365 0.212
NP_441020.2_6 Reverse -269 -286 6.52869 0.262
NP_441673.1_1 Forward -197 -188 1.37636 0.114
NP_441673.1_1 Reverse -188 -197 1.1797 0.163
NP_441673.1_1 Reverse -271 -280 -7.86675 0.187
NP_441673.1_1 Forward -280 -271 -7.96508 0.206
NP_442811.1_3 Forward -164 -145 18.9773 0.0388
NP_441637.1_9 Forward -180 -162 -3.02911 0.293
NP_442490.1_9 Forward -209 -190 -0.787193 0.179
NP_441612.1_2 Reverse -170 -180 6.32259 0.294
NP_442227.1_2 Forward -375 -356 3.24438 0.219
NP_442361.1_3 Forward -203 -190 8.27909 0.285
NP_442808.1_1 Reverse -187 -197 9.71433 0.0481
NP_442808.1_1 Forward -116 -106 6.37109 0.116
NP_441101.1_4 Forward -185 -166 6.19431 0.295
NP_442820.1_3 Forward -283 -273 12.5659 0.289
NP_442542.1_2 Forward -199 -186 8.9674 0.142
NP_442050.1_5 Reverse -186 -196 12.6642 0.0534
NP_442903.1_2 Reverse -159 -178 4.05798 0.24
NP_442342.1_9 Reverse -186 -202 3.40179 0.26
NP_440558.1_2 Reverse -274 -293 -3.44213 0.236
NP_441878.1_6 Reverse -187 -197 0.57002 0.14
NP_441878.1_6 Forward -281 -271 -7.98478 0.285
NP_441036.1_8 Forward -198 -188 6.8632 0.213
NP_441557.1_5 Forward -197 -188 1.08137 0.0794
NP_441557.1_5 Reverse -188 -197 0.589713 0.134
NP_442066.2_9 Reverse -267 -280 8.18076 0.19
NP_441739.1_2 Forward -46 -30 4.38442 0.245
NP_440101.1_3 Forward -101 -82 3.04771 0.239
NP_442183.1_1 Forward -197 -183 16.5192 0.0143
NP_440440.1_2 Forward -283 -264 14.7483 0.256
NP_441574.1_1 Forward -209 -190 1.67108 0.172
NP_440276.1_2 Forward -23 -4 12.9031 0.22
NP_441549.1_9 Reverse -267 -285 -10.1089 0.269
NP_442347.1_2 Reverse -189 -198 8.94785 0.0718
NP_442888.1_8 Reverse -101 -120 10.7175 0.221
NP_441633.1_3 Forward -199 -186 -6.66722 0.265
NP_440136.1_1 Reverse -64 -80 10.0876 0.238
NP_440136.1_2 Forward -196 -189 6.23397 0.171
NP_440136.1_2 Reverse -189 -196 6.13563 0.193
NP_442590.1_10 Reverse -271 -290 5.60432 0.258
NP_442998.1_5 Forward -72 -62 14.533 0.149
NP_442998.1_10 Reverse -190 -197 15.5754 0.0102
NP_440299.1_1 Forward -201 -188 2.47701 0.288
NP_441007.1_10 Reverse -266 -279 2.37923 0.19
NP_442201.1_10 Forward -208 -189 -9.24366 0.241
NP_440915.1_6 Forward -201 -187 11.5043 0.0256
NP_442866.1_1 Forward -202 -183 -1.7705 0.204
NP_442866.1_1 Reverse -266 -285 -8.06369 0.275
NP_441464.1_8 Forward -280 -266 5.30946 0.259
NP_441939.1_3 Reverse -107 -126 11.7008 0.111
NP_441199.1_3 Forward -110 -92 7.00065 0.179
NP_441199.1_6 Forward -284 -265 2.0644 0.201
NP_442386.1_9 Forward -198 -189 5.9975 0.23
NP_442386.1_9 Reverse -187 -196 4.52254 0.297
NP_441750.1_4 Forward -284 -265 1.96607 0.272
NP_441340.1_5 Forward -196 -189 13.5105 0.0314
NP_441340.1_5 Reverse -189 -196 5.84064 0.208
NP_442714.1_5 Reverse -312 -331 1.67108 0.238
NP_440586.1_8 Reverse -189 -196 9.47853 0.146
NP_440586.1_8 Forward -196 -189 5.74197 0.283
NP_441262.1_3 Forward -197 -190 14.7888 0.0223
NP_443051.1_1 Forward -198 -189 7.47288 0.0571
NP_443051.1_1 Reverse -187 -196 -1.18024 0.297
NP_439984.1_2 Reverse -107 -120 12.0157 0.252
NP_439937.1_9 Forward -330 -313 -12.8431 0.276
NP_442294.1_3 Forward -343 -329 13.7653 0.252
NP_442239.1_8 Reverse -265 -284 19.5673 0.146
NP_439943.1_1 Reverse -62 -81 -6.68705 0.237
NP_440372.1_2 Forward -196 -189 13.8055 0.0214
NP_440372.1_2 Reverse -189 -196 6.52896 0.188
NP_440316.1_10 Forward -198 -188 11.1898 0.214
NP_439977.1_5 Forward -203 -184 -1.67217 0.257
NP_440139.1_1 Forward -203 -184 7.76679 0.126
NP_441572.1_7 Reverse -381 -400 -3.14714 0.207
NP_442384.1_10 Reverse -188 -201 3.95252 0.172
NP_441018.1_3 Forward -362 -343 12.6833 0.286
NP_441018.1_7 Reverse -259 -278 7.37428 0.272
NP_442262.1_10 Reverse -189 -196 13.2155 0.0213
NP_442165.1_1 Reverse -317 -336 14.9449 0.244
NP_440344.1_10 Reverse -181 -198 -3.30441 0.0812
NP_440282.1_5 Reverse -191 -210 14.6508 0.215
NP_440234.1_1 Reverse -367 -386 20.8447 0.0715
NP_440531.1_6 Forward -116 -97 8.06259 0.0892
NP_440531.1_6 Reverse -98 -117 2.16274 0.161
NP_440297.1_9 Forward -114 -104 4.89658 0.217
NP_440297.1_9 Forward -196 -186 0.865012 0.282
NP_440350.1_5 Forward -181 -162 5.211 0.158
NP_441679.1_1 Reverse -23 -42 -2.75381 0.228
NP_440999.1_9 Forward -134 -120 -3.147 0.287
NP_440888.1_2 Reverse -188 -202 6.78381 0.22
NP_442147.1_2 Reverse -263 -282 11.7992 0.198
NP_440052.1_5 Forward -208 -189 7.86593 0.095
NP_442225.1_10 Forward -207 -188 6.98015 0.281
NP_441543.1_2 Reverse -189 -198 8.65285 0.0968
NP_442845.1_2 Reverse -271 -285 4.12949 0.267
NP_441834.1_7 Forward -209 -190 14.1591 0.267
NP_440739.1_2 Reverse -299 -318 12.7825 0.145
NP_441469.1_8 Forward -198 -189 6.39124 0.227
NP_442578.1_7 Forward -196 -189 6.0373 0.18
NP_441462.1_2 Forward -197 -187 16.1063 0.00406
NP_441462.1_2 Reverse -271 -281 -0.511621 0.236
NP_441462.1_2 Forward -280 -270 -0.511621 0.236
NP_441410.1_4 Forward -386 -367 6.78348 0.297
NP_440544.1_5 Reverse -16 -23 13.8024 0.28
NP_440516.1_6 Forward -377 -363 8.06211 0.255
NP_440516.1_8 Forward -197 -188 18.9776 0.00442
NP_440516.1_8 Reverse -188 -197 5.01461 0.118
NP_442428.1_5 Forward -196 -189 6.13563 0.209
NP_442428.1_5 Reverse -189 -196 6.0373 0.212
NP_440673.1_3 Reverse -190 -197 12.4288 0.0426
NP_441052.1_2 Reverse -188 -198 1.25834 0.249
NP_440436.1_4 Reverse -189 -198 8.55409 0.0997
NP_441893.1_10 Forward -269 -250 10.6192 0.254
NP_441719.1_4 Forward -196 -189 6.82395 0.0855
NP_441719.1_4 Reverse -189 -196 6.52896 0.188
NP_441733.1_10 Forward -200 -187 6.31247 0.192
NP_441004.1_1 Reverse -254 -273 -18.0934 0.297
NP_442813.1_4 Reverse -97 -116 -6.39206 0.299
NP_442366.1_3 Reverse -187 -205 -4.30741 0.268
NP_442366.1_5 Forward -200 -190 13.3526 0.0775
NP_440129.1_4 Reverse -191 -209 13.4897 0.28
NP_442873.1_3 Reverse -178 -197 4.91521 0.262
NP_443054.1_2 Reverse -186 -200 2.06454 0.245
NP_441966.1_7 Reverse -298 -317 5.99684 0.192
NP_441195.1_1 Forward -89 -70 -2.85214 0.242
NP_442515.1_1 Forward -281 -267 -2.85201 0.281
NP_440593.1_3 Reverse -183 -202 -7.27704 0.291
NP_440463.1_8 Forward -284 -265 7.01583 0.267
NP_442450.1_5 Reverse -186 -196 10.0098 0.115
NP_442006.1_2 Reverse -311 -328 -19.0374 0.297
NP_440078.1_4 Forward -208 -189 17.3057 0.133
NP_441078.1_4 Forward -197 -188 0.196389 0.205
NP_441078.1_4 Reverse -188 -197 -0.000272808 0.205
NP_441078.1_4 Forward -280 -271 -1.86856 0.272
NP_442348.1_2 Forward -232 -223 9.34117 0.28
NP_440707.1_9 Reverse -255 -274 5.89931 0.235
NP_441432.1_8 Forward -198 -189 5.50626 0.151
NP_441432.1_9 Reverse -64 -77 16.8397 0.0931
NP_441333.1_1 Forward -169 -159 13.0198 0.217
NP_442320.1_8 Forward -203 -189 -2.26202 0.0871
NP_441732.1_2 Reverse -383 -399 -16.6577 0.186
NP_440760.1_1 Reverse -188 -207 -13.1769 0.0989
NP_442797.1_7 Forward -287 -269 -1.25915 0.294
NP_441072.1_2 Forward -137 -118 5.30933 0.3
NP_442010.1_1 Forward -181 -163 9.35981 0.241
NP_442400.1_10 Reverse -165 -178 9.03802 0.277
NP_442489.1_7 Forward -197 -188 0.688044 0.152
NP_442489.1_7 Reverse -188 -197 0.688044 0.152
NP_440559.1_1 Forward -196 -187 6.39124 0.134
NP_441659.2_8 Forward -197 -187 0.275027 0.27
NP_441022.1_1 Reverse -304 -313 14.7117 0.183
NP_440363.1_9 Reverse -269 -287 14.9655 0.208
NP_442849.1_6 Reverse -381 -395 20.7474 0.099
NP_440708.1_6 Forward -291 -272 -7.4737 0.248
NP_442346.1_5 Reverse -283 -293 5.5849 0.238
NP_442346.1_5 Reverse -187 -197 4.3066 0.291
NP_440545.1_3 Forward -400 -383 6.72535 0.0541
NP_441856.1_3 Forward -399 -380 -1.37718 0.237
NP_442603.1_7 Forward -197 -183 17.6002 0.0211
NP_440034.1_3 Reverse -171 -190 17.0418 0.234
NP_441833.1_4 Reverse -189 -196 6.52896 0.0924
NP_441833.1_4 Forward -196 -189 6.23397 0.163
NP_443040.1_1 Reverse -155 -169 12.02 0.276
NP_441329.1_6 Forward -80 -61 6.73176 0.179
NP_441329.1_6 Reverse -161 -180 4.63094 0.201
NP_441329.1_6 Forward -23 -4 2.81659 0.217
NP_442162.1_9 Forward -196 -189 12.9205 0.0282
NP_442162.1_9 Reverse -189 -196 12.9205 0.0282
NP_443026.1_5 Forward -190 -171 -5.60541 0.293
NP_441915.1_4 Reverse -96 -115 7.57013 0.293
NP_442140.1_3 Reverse -189 -199 14.1397 0.0501
NP_441813.1_5 Reverse -186 -196 12.9597 0.0182
NP_441813.1_5 Forward -199 -189 0.176696 0.215
NP_440590.1_4 Reverse -189 -202 8.67241 0.0431
NP_440567.1_1 Reverse -189 -203 4.52282 0.118
NP_440567.1_1 Forward -196 -182 1.86788 0.191
NP_442497.1_10 Forward -196 -187 1.08137 0.115
NP_442497.1_10 Reverse -189 -198 0.589713 0.153
NP_440821.1_4 Reverse -186 -196 7.64985 0.0679
NP_440821.1_4 Forward -199 -189 0.471689 0.174
NP_440821.1_7 Reverse -50 -69 14.3558 0.274
NP_441239.1_9 Reverse -186 -198 12.7237 0.0433
NP_441239.1_9 Reverse -275 -287 4.5622 0.251
NP_441951.1_4 Forward -203 -184 1.96607 0.283
NP_442568.1_8 Reverse -324 -338 7.76774 0.296
NP_440624.1_5 Forward -151 -133 7.95661 0.285
NP_441892.1_1 Reverse -275 -292 -5.27103 0.276
NP_441541.1_1 Reverse -144 -162 -3.43572 0.264
NP_442216.1_4 Forward -44 -36 8.1805 0.255
NP_440354.1_7 Forward -203 -185 13.3922 0.199
NP_440354.1_7 Forward -115 -97 10.0489 0.224
NP_442052.1_7 Reverse -107 -121 12.8809 0.253
NP_442284.1_3 Forward -133 -115 18.997 0.141
NP_440546.1_4 Forward -197 -187 14.9908 0.0459
NP_440546.1_4 Reverse -188 -198 6.55553 0.291
NP_440546.1_4 Reverse -277 -287 6.45857 0.296
NP_440462.1_6 Reverse -186 -196 3.91327 0.224
NP_442340.1_3 Forward -327 -308 -11.2103 0.299
NP_440868.1_4 Forward -201 -189 -0.944332 0.284
NP_441249.1_3 Reverse -186 -205 11.3075 0.208
NP_442402.1_4 Reverse -379 -398 3.14526 0.154
NP_442402.1_4 Forward -53 -34 -2.75457 0.203
NP_441848.1_4 Forward -17 -1 9.26952 0.287
NP_441848.1_4 Reverse -148 -164 7.1687 0.295
NP_442039.1_4 Forward -196 -189 11.6422 0.0747
NP_442039.1_7 Forward -106 -96 11.4848 0.257
NP_442837.1_3 Forward -196 -189 6.0373 0.25
NP_442837.1_3 Reverse -189 -196 6.0373 0.25
NP_442053.1_1 Reverse -188 -197 14.4544 0.0114
NP_442053.1_1 Forward -197 -188 7.86621 0.0863
NP_440505.1_3 Forward -199 -189 5.19158 0.241
NP_441203.1_1 Reverse -272 -291 -10.817 0.137
NP_441576.1_10 Reverse -60 -79 9.93088 0.291
NP_440914.1_7 Reverse -142 -161 5.1084 0.29
NP_441011.1_8 Forward -196 -187 9.24284 0.131
NP_441011.1_8 Reverse -189 -198 7.07956 0.179
NP_440068.1_1 Reverse -311 -330 -1.57384 0.249
NP_442533.1_6 Forward -280 -271 4.52295 0.179
NP_442533.1_6 Reverse -188 -197 4.42462 0.179
NP_442533.1_6 Forward -281 -272 1.76968 0.289
NP_442541.1_10 Forward -287 -273 1.86729 0.273
NP_442322.1_4 Forward -117 -100 -1.24015 0.226
NP_442322.1_4 Forward -275 -258 -8.51661 0.286
NP_441482.1_7 Reverse -182 -196 4.32615 0.0503
NP_441482.1_7 Forward -286 -272 -9.24352 0.196
NP_441482.1_7 Forward -203 -189 -10.7185 0.213
NP_440116.1_4 Reverse -54 -73 5.89931 0.296
NP_440116.1_5 Forward -200 -183 12.9202 0.09
NP_441527.1_4 Reverse -156 -175 2.43462 0.13
NP_441527.1_4 Forward -22 -3 -3.1994 0.164
NP_441527.1_4 Reverse -164 -183 -4.72727 0.188
NP_441527.1_4 Forward -77 -58 -11.4117 0.282
NP_441527.1_4 Reverse -158 -177 -12.5576 0.291
NP_441602.1_3 Forward -202 -183 -4.72043 0.272
NP_441106.1_1 Forward -198 -189 8.45619 0.0548
NP_441286.1_1 Forward -198 -186 3.97222 0.0397
NP_440670.1_8 Forward -197 -188 8.75118 0.0606
NP_440670.1_8 Reverse -188 -197 6.19458 0.124
NP_441705.1_3 Forward -115 -96 -6.88371 0.299
NP_440886.1_7 Forward -198 -188 6.86274 0.113
NP_440886.1_7 Reverse -187 -197 6.76441 0.114
NP_440886.1_7 Forward -39 -29 3.32285 0.287
NP_442614.1_2 Reverse -271 -285 6.6861 0.287
NP_440404.1_9 Forward -26 -7 8.54611 0.242
NP_442717.1_2 Forward -76 -57 -9.34199 0.29
NP_440907.2_8 Reverse -189 -199 12.4676 0.0624
NP_440841.1_4 Reverse -186 -205 -10.1286 0.271
NP_441626.1_2 Forward -196 -189 12.2322 0.0511
NP_441626.1_2 Reverse -189 -196 5.93897 0.231
NP_442794.1_1 Reverse -184 -196 6.43049 0.18
NP_442794.1_1 Reverse -44 -56 2.20226 0.299
NP_442615.1_1 Forward -206 -188 -3.02911 0.154
NP_440387.1_1 Reverse -188 -204 3.89344 0.0503
NP_440387.1_1 Forward -280 -264 2.32015 0.0827
NP_440387.1_1 Forward -197 -181 -2.49807 0.148
NP_441431.1_2 Reverse -274 -288 10.9137 0.15
NP_441488.1_8 Forward -202 -188 9.93039 0.146
NP_441425.1_4 Reverse -153 -167 14.6509 0.282
NP_442090.1_10 Reverse -107 -120 10.344 0.288
NP_441858.1_2 Reverse -170 -189 17.6346 0.137
NP_442323.1_7 Reverse -196 -215 8.94676 0.163
NP_440293.1_9 Reverse -105 -119 11.8274 0.257
NP_440766.1_4 Forward -201 -187 2.5562 0.179
NP_440766.1_5 Forward -103 -91 6.79636 0.292
NP_439988.1_7 Reverse -190 -204 11.9953 0.292
NP_440457.1_1 Forward -201 -189 0.530633 0.25
NP_440457.1_1 Reverse -113 -125 -0.354346 0.262
NP_442509.1_9 Forward -197 -187 13.1559 0.061
NP_442509.1_9 Reverse -188 -198 9.71433 0.192
NP_442509.1_9 Forward -238 -228 8.53436 0.192
NP_440734.1_9 Forward -278 -259 10.6192 0.281
NP_441159.1_8 Forward -163 -144 1.47364 0.236
NP_440554.1_4 Reverse -189 -199 4.40493 0.19
NP_441885.1_5 Forward -197 -187 -0.0199663 0.186
NP_442341.1_7 Reverse -187 -201 6.98109 0.113
NP_442341.1_7 Forward -198 -184 2.94952 0.239
NP_442341.1_9 Forward -199 -185 9.73373 0.144
NP_441842.1_10 Forward -204 -190 9.34103 0.192
NP_440275.1_3 Forward -199 -189 5.78156 0.131
NP_440275.1_3 Reverse -125 -135 1.55333 0.289
NP_440679.1_10 Reverse -259 -278 -18.6834 0.279
NP_441207.1_7 Forward -80 -66 9.54584 0.275
NP_439962.1_4 Forward -117 -98 -3.83545 0.259
NP_441105.1_3 Forward -208 -189 -9.83364 0.297
NP_440216.1_1 Reverse -106 -120 -11.3085 0.178
NP_440172.1_1 Forward -197 -187 7.55152 0.0761
NP_442371.1_1 Forward -82 -72 14.6309 0.185
NP_442015.1_10 Reverse -184 -197 1.49425 0.204
NP_441226.1_7 Forward -196 -189 12.7234 0.0312
NP_441226.1_7 Reverse -189 -196 11.5435 0.0757
NP_441111.1_7 Reverse -189 -197 8.86921 0.0589
NP_441766.1_2 Reverse -188 -197 14.7494 0.00772
NP_442417.1_5 Reverse -188 -202 10.3243 0.12
NP_440416.1_9 Forward -204 -185 -15.1435 0.186
NP_442403.1_8 Forward -236 -217 0.982764 0.241
NP_442046.1_8 Reverse -183 -202 14.0608 0.293
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTTGGCGACAACATTGGGATATTACCATTCCCCTCATGCGGCCCTATTGTTTCTTAGTAGGAGTTTTATCTTCCATTTCCGCCCTCAAAGTTTTTGAAGAGGTGTATATCATGACCCAGGGCGGCCCCCTCAACGCTTCCAAAACGGTAGTTTATTATGTCTATGAACGGGCTTTTCAAGACCTCGAAATGAATTACGCTTCGGCGATCGGGCTAGTGTTATTTTTGGTCATTTTCATTTTTTCAGTGATTAATTTAAAACTTTCCGGTGGTAACCTACCGGCCCGCTAAAGCCCTTGGGGGACATATTGACCCTGACTGAAAAAAATGGACAAATCCAGAAGGACATTATGATGGAATTCCCCCATATCGTAGTGGAAGAAAAGGAAGTGCAAAAAGT

CDS

ATGACAACACTGTATGAAACGGACTTCAACCTGTGGATAGAGCAGACCGTCAACCAACTCAAAAGTGGTGACATCAAGGGCTTGGACCTGGACAACCTCATTGAAGAAATAGAATCCATGGGACGGAATAACAAAAGGGAAGTACGAAGCCGGTTAATTGTCCTCATGGCTCACCTACTGAAATGGCAACACCAACCCGAAAAACAGAGCAATAGCTGGATCTACACCATCAAAGAGCAACGCTTACAACTCAAGCTAATCCTGCAAGACAGCCCTAGCCTGAAGCCCTTTTTGCAACAGGTCTTAGACGATTGTTACCAAGATGCCCGAAAGGATGCAGCCCAGGAAACAAAACTAACCCCCGACAACTTCCCCAAAGAATCCCCCTACACCCAAGCTCAGATCCTAGACCCCGACTTTTTTCCAAAATCAGAATAA

Protein

MTTLYETDFNLWIEQTVNQLKSGDIKGLDLDNLIEEIESMGRNNKREVRSRLIVLMAHLLKWQHQPEKQSNSWIYTIKEQRLQLKLILQDSPSLKPFLQQVLDDCYQDARKDAAQETKLTPDNFPKESPYTQAQILDPDFFPKSE