Your browser is old and dusty. Try Google Chrome!

Details for slr1200

ORF slr1200
Accession NP_440701.1
Symbol
Category urea transport system permease protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -85 -71 0.196253 0.215
NP_441061.1_2 Reverse -381 -395 -1.5737 0.265
NP_440795.1_7 Forward -388 -381 14.6904 0.0123
NP_440795.1_7 Reverse -381 -388 14.6904 0.0123
NP_440795.1_7 Forward -149 -142 8.39725 0.213
NP_440694.1_7 Forward -177 -158 18.1907 0.247
NP_441418.1_6 Reverse -380 -399 -10.4236 0.035
NP_441418.1_6 Forward -389 -370 -29.5982 0.23
NP_441418.1_6 Reverse -271 -290 -29.5982 0.23
NP_442291.1_5 Forward -390 -374 5.86006 0.0727
NP_441453.1_1 Forward -396 -378 6.1149 0.241
NP_441453.1_4 Reverse -380 -388 16.539 0.00633
NP_441453.1_4 Forward -389 -381 16.539 0.00633
NP_441623.1_1 Forward -396 -378 -4.40575 0.274
NP_441960.1_3 Reverse -380 -399 17.7115 0.121
NP_442151.1_6 Reverse -380 -394 9.63603 0.142
NP_442838.1_7 Forward -394 -375 -9.047 0.232
NP_441818.1_1 Forward -388 -377 9.20294 0.25
NP_441818.1_9 Reverse -275 -294 -5.50708 0.254
NP_440226.1_1 Reverse -380 -399 15.4374 0.025
NP_440226.1_1 Forward -389 -370 15.2408 0.0258
NP_441630.1_3 Reverse -372 -391 9.3409 0.0975
NP_441630.1_3 Forward -397 -378 -0.4922 0.288
NP_442623.1_3 Reverse -381 -400 -18.2901 0.263
NP_442287.1_3 Reverse -372 -389 13.6078 0.294
NP_442655.1_1 Forward -394 -375 9.3409 0.0965
NP_442173.1_1 Forward -388 -380 15.4574 0.00633
NP_442173.1_1 Reverse -381 -389 15.4574 0.00633
NP_442173.1_1 Reverse -310 -318 4.93597 0.241
NP_442752.1_4 Forward -389 -382 13.8055 0.0199
NP_442752.1_4 Reverse -380 -387 13.8055 0.0199
NP_443027.1_4 Forward -391 -381 13.943 0.0452
NP_443027.1_4 Reverse -378 -388 13.2547 0.0521
NP_442975.1_10 Forward -393 -379 21.3367 0.00107
NP_440784.1_7 Forward -388 -381 15.9687 0.0123
NP_440784.1_7 Reverse -381 -388 15.9687 0.0123
NP_442861.1_4 Forward -234 -215 -0.29631 0.297
NP_441934.1_7 Reverse -377 -396 15.5357 0.296
NP_441250.1_4 Forward -167 -148 3.53937 0.298
NP_440110.1_7 Forward -287 -268 10.1275 0.297
NP_442062.1_8 Reverse -380 -390 19.4496 0.000558
NP_442062.1_8 Forward -389 -379 10.3048 0.0493
NP_442062.1_8 Reverse -179 -189 4.79825 0.198
NP_442062.1_8 Reverse -309 -319 2.83163 0.293
NP_441859.1_3 Reverse -379 -398 1.96529 0.269
NP_442972.1_1 Reverse -244 -262 6.52077 0.291
NP_440304.1_4 Reverse -378 -388 10.8948 0.051
NP_440304.1_4 Forward -391 -381 9.91146 0.051
NP_440304.1_10 Reverse -381 -399 14.0805 0.215
NP_442242.1_4 Forward -388 -381 14.3954 0.0124
NP_442242.1_4 Reverse -381 -388 14.3954 0.0124
NP_440044.1_8 Forward -388 -369 3.34271 0.132
NP_440044.1_8 Reverse -381 -400 -3.93378 0.295
NP_441581.1_6 Forward -285 -266 9.29248 0.297
NP_439918.1_2 Forward -49 -30 1.47442 0.215
NP_441935.1_1 Forward -353 -334 4.916 0.293
NP_441208.1_9 Forward -392 -378 5.99778 0.254
NP_441208.1_9 Reverse -377 -391 5.30946 0.271
NP_442196.1_10 Reverse -378 -397 15.8307 0.149
NP_442110.1_1 Forward -319 -300 16.5175 0.235
NP_442110.1_7 Forward -389 -375 1.86788 0.222
NP_442110.1_7 Reverse -380 -394 0.392915 0.261
NP_441925.1_2 Forward -234 -215 9.0459 0.262
NP_440856.1_4 Reverse -373 -392 9.93088 0.0546
NP_441083.1_5 Reverse -380 -390 11.3864 0.0159
NP_441083.1_5 Forward -389 -379 11.2881 0.0159
NP_442827.1_8 Forward -397 -378 0.686995 0.199
NP_441434.1_7 Reverse -382 -396 12.586 0.108
NP_441738.1_2 Forward -387 -380 15.28 0.0102
NP_441738.1_2 Reverse -382 -389 15.28 0.0102
NP_441738.1_4 Forward -399 -380 5.01433 0.208
NP_441558.1_5 Reverse -378 -397 12.2908 0.069
NP_440209.1_1 Reverse -380 -388 18.1123 0.00295
NP_440209.1_1 Forward -389 -381 18.1123 0.00295
NP_442889.1_8 Forward -392 -378 3.73557 0.273
NP_441713.1_1 Forward -395 -376 -13.8652 0.257
NP_441770.1_10 Reverse -378 -397 16.4207 0.173
NP_440178.1_7 Reverse -379 -398 -3.14714 0.0437
NP_442111.1_4 Forward -390 -376 2.75286 0.266
NP_440906.1_5 Forward -388 -381 15.8704 0.0124
NP_440906.1_5 Reverse -381 -388 15.8704 0.0124
NP_440012.1_6 Reverse -281 -300 17.8957 0.0723
NP_440747.1_10 Reverse -377 -389 7.4138 0.00422
NP_440747.1_10 Forward -392 -380 -2.02597 0.0196
NP_441130.1_10 Forward -391 -377 18.2892 0.0142
NP_441130.1_10 Reverse -378 -392 8.94771 0.131
NP_442973.1_5 Reverse -371 -390 10.9142 0.259
NP_441486.1_1 Forward -392 -378 -3.34366 0.178
NP_441486.1_1 Reverse -377 -391 -4.4253 0.198
NP_441880.2_10 Reverse -381 -399 7.98396 0.284
NP_442634.1_4 Reverse -378 -392 5.80112 0.051
NP_442634.1_4 Forward -391 -377 -3.24533 0.161
NP_441265.1_3 Forward -395 -381 1.67122 0.2
NP_441014.1_10 Reverse -116 -135 -3.24622 0.297
NP_441012.1_4 Forward -281 -268 14.3756 0.202
NP_443018.1_3 Forward -388 -381 14.8871 0.0123
NP_443018.1_3 Reverse -381 -388 14.8871 0.0123
NP_443018.1_3 Reverse -310 -317 10.7572 0.0907
NP_443018.1_3 Forward -317 -310 4.56234 0.241
NP_441634.1_8 Reverse -378 -392 15.1426 0.0248
NP_440376.1_1 Forward -389 -380 19.4693 0.000692
NP_440376.1_1 Reverse -380 -389 19.4693 0.000692
NP_440376.1_1 Reverse -203 -212 3.44131 0.203
NP_441857.1_5 Forward -396 -378 7.29564 0.189
NP_441588.1_4 Reverse -382 -392 6.96153 0.178
NP_441588.1_4 Forward -387 -377 6.76487 0.185
NP_442687.1_7 Forward -390 -380 15.8113 0.0125
NP_442687.1_7 Reverse -379 -389 9.02648 0.0994
NP_442191.1_4 Forward -388 -374 12.7383 0.192
NP_442485.1_3 Reverse -81 -100 -4.03212 0.277
NP_441846.1_10 Reverse -270 -289 -22.8133 0.266
NP_440642.1_10 Forward -247 -233 1.5723 0.29
NP_441422.1_7 Reverse -47 -64 -3.40274 0.235
NP_442296.1_9 Forward -388 -369 -1.08219 0.197
NP_442296.1_9 Forward -337 -318 -3.63879 0.256
NP_442658.1_1 Forward -391 -381 18.7607 0.00222
NP_442658.1_1 Reverse -378 -388 14.2375 0.0237
NP_442658.1_1 Forward -320 -310 11.4843 0.082
NP_442782.1_2 Reverse -271 -285 13.1759 0.173
NP_442782.1_2 Reverse -17 -31 2.06454 0.278
NP_442782.1_2 Forward -389 -375 0.88457 0.282
NP_440656.1_8 Forward -400 -381 -2.36049 0.187
NP_440656.1_8 Reverse -155 -174 -3.54046 0.198
NP_441414.1_9 Reverse -380 -399 -10.3253 0.28
NP_442321.1_4 Reverse -51 -70 -7.17871 0.284
NP_441958.1_5 Reverse -379 -389 21.2195 0.000805
NP_441958.1_5 Forward -390 -380 12.2714 0.00183
NP_440651.1_10 Forward -214 -200 20.1568 0.223
NP_442836.1_5 Forward -395 -376 5.99764 0.185
NP_440203.1_5 Forward -185 -175 10.796 0.213
NP_440984.1_7 Forward -394 -380 16.6175 0.0384
NP_440984.1_7 Reverse -375 -389 9.83269 0.127
NP_442911.1_2 Forward -399 -380 -7.96535 0.223
NP_441580.1_6 Forward -400 -381 5.30933 0.117
NP_440153.1_5 Forward -388 -374 5.21113 0.191
NP_440153.1_5 Reverse -381 -395 3.63784 0.206
NP_441591.1_10 Reverse -378 -397 6.78429 0.279
NP_443055.1_6 Reverse -380 -398 5.32826 0.179
NP_443055.1_6 Forward -397 -379 3.45998 0.196
NP_443055.1_6 Forward -309 -291 -2.73484 0.299
NP_440993.1_2 Reverse -375 -391 14.0215 0.0656
NP_440993.1_2 Forward -394 -378 2.61514 0.263
NP_440138.1_6 Forward -317 -298 5.70185 0.227
NP_441099.1_5 Forward -399 -380 -3.63879 0.137
NP_442002.1_9 Forward -390 -383 10.7572 0.185
NP_441294.1_7 Forward -393 -379 13.7621 0.0568
NP_441294.1_7 Reverse -376 -390 9.92255 0.219
NP_442438.1_10 Forward -394 -380 11.2093 0.0463
NP_442438.1_10 Reverse -375 -389 2.16287 0.185
NP_441000.1_6 Forward -390 -376 13.5693 0.0396
NP_441000.1_6 Reverse -379 -393 5.1128 0.0933
NP_442771.1_1 Reverse -293 -311 -10.9939 0.294
NP_440147.1_4 Reverse -378 -391 18.4072 0.00407
NP_440147.1_4 Forward -391 -378 10.4424 0.0355
NP_441550.1_8 Reverse -378 -388 15.8108 0.0132
NP_441550.1_8 Forward -391 -381 10.501 0.066
NP_441916.1_7 Forward -389 -379 18.9579 0.00144
NP_441916.1_7 Reverse -380 -390 18.4663 0.00144
NP_441041.1_4 Reverse -380 -399 -10.4236 0.232
NP_441041.1_4 Forward -382 -363 -10.817 0.237
NP_441041.1_4 Forward -349 -330 -11.7019 0.251
NP_441041.1_7 Forward -392 -380 19.5648 0.00277
NP_441041.1_7 Reverse -377 -389 16.6495 0.0131
NP_440703.1_9 Reverse -147 -160 9.26181 0.221
NP_441725.1_5 Reverse -381 -391 9.02648 0.0553
NP_441725.1_5 Forward -388 -378 1.94665 0.115
NP_439966.1_7 Forward -391 -381 17.4824 0.00636
NP_439966.1_7 Reverse -378 -388 14.3359 0.0203
NP_439966.1_9 Forward -391 -382 10.7178 0.0863
NP_442941.1_3 Forward -388 -378 19.2529 0.00262
NP_442941.1_3 Reverse -381 -391 2.53664 0.14
NP_440289.1_2 Forward -392 -379 12.9006 0.0132
NP_440289.1_2 Reverse -377 -390 6.01747 0.0605
NP_440983.1_5 Forward -301 -282 -2.65548 0.231
NP_440260.1_8 Forward -386 -368 -7.749 0.3
NP_442281.1_1 Forward -394 -380 18.0918 0.00503
NP_442281.1_1 Reverse -375 -389 8.45543 0.0808
NP_442281.1_1 Forward -323 -309 5.60385 0.152
NP_442281.1_1 Reverse -148 -162 3.8339 0.217
NP_441334.1_7 Forward -391 -372 -11.2103 0.12
NP_441334.1_7 Reverse -378 -397 -11.3086 0.122
NP_442575.1_8 Reverse -275 -294 -1.96717 0.233
NP_442256.1_2 Forward -391 -373 -8.43732 0.224
NP_440437.1_1 Reverse -374 -393 19.469 0.0125
NP_439983.1_7 Reverse -281 -299 10.0489 0.287
NP_441087.1_6 Reverse -110 -128 -3.12816 0.296
NP_441457.1_7 Reverse -378 -397 11.6025 0.113
NP_440498.1_1 Forward -398 -380 -2.0458 0.235
NP_442068.1_2 Forward -102 -83 5.40766 0.3
NP_441644.1_6 Forward -389 -379 19.0557 0.000803
NP_441644.1_6 Reverse -380 -390 10.1076 0.0628
NP_442215.1_2 Forward -391 -375 4.3851 0.0845
NP_442215.1_2 Forward -164 -148 -0.728113 0.171
NP_442215.1_2 Reverse -68 -84 -6.62797 0.277
NP_442215.1_2 Reverse -307 -323 -7.41462 0.294
NP_440253.1_2 Reverse -380 -398 11.1305 0.0343
NP_440253.1_2 Forward -58 -40 4.34571 0.104
NP_440929.1_8 Forward -389 -380 19.2726 0.000701
NP_440929.1_8 Reverse -380 -389 19.2726 0.000701
NP_442933.1_10 Forward -389 -380 17.601 0.00325
NP_442933.1_10 Reverse -380 -389 17.601 0.00325
NP_441751.2_8 Forward -388 -374 5.01447 0.0448
NP_441751.2_8 Forward -348 -334 -5.70361 0.231
NP_442554.1_8 Forward -388 -378 17.2863 0.00543
NP_442554.1_8 Reverse -381 -391 16.008 0.0065
NP_442554.1_8 Forward -317 -307 4.50326 0.184
NP_442863.1_5 Forward -400 -381 17.8957 0.169
NP_441762.1_7 Reverse -379 -391 12.527 0.0142
NP_441762.1_7 Forward -390 -378 2.30059 0.0676
NP_442142.1_4 Forward -392 -379 14.4733 0.0311
NP_442142.1_4 Reverse -377 -390 14.1783 0.0311
NP_442292.1_1 Forward -388 -379 17.5026 0.00435
NP_442292.1_1 Reverse -381 -390 9.63616 0.0183
NP_442476.1_5 Forward -218 -199 13.0775 0.256
NP_440895.1_10 Forward -281 -264 -4.97604 0.267
NP_442381.1_8 Forward -392 -373 -11.5053 0.263
NP_443009.1_5 Reverse -379 -390 19.626 0.00102
NP_443009.1_5 Forward -390 -379 7.82632 0.118
NP_443009.1_5 Reverse -178 -189 3.40144 0.296
NP_442741.1_7 Reverse -380 -399 12.2908 0.24
NP_441715.1_4 Forward -388 -378 16.7946 0.0106
NP_441715.1_4 Reverse -381 -391 9.32148 0.097
NP_440357.1_6 Forward -295 -276 2.75272 0.296
NP_441198.1_8 Forward -320 -310 10.1462 0.296
NP_440379.1_5 Reverse -380 -399 -9.24366 0.262
NP_441468.1_1 Forward -388 -381 15.8704 0.0124
NP_441468.1_1 Reverse -381 -388 15.8704 0.0124
NP_441468.1_1 Forward -317 -310 4.07068 0.263
NP_441020.2_6 Forward -391 -374 14.1002 0.0613
NP_441020.2_6 Reverse -378 -395 7.80699 0.218
NP_441015.1_10 Reverse -269 -288 -9.24366 0.281
NP_441673.1_1 Forward -389 -380 20.8459 0.000698
NP_441673.1_1 Reverse -380 -389 20.8459 0.000698
NP_441826.1_2 Forward -395 -381 4.62115 0.101
NP_441826.1_2 Reverse -374 -388 -3.24533 0.284
NP_442490.1_10 Reverse -379 -397 7.78729 0.286
NP_442868.1_6 Reverse -378 -388 10.4031 0.038
NP_442868.1_6 Forward -391 -381 8.53483 0.0555
NP_441612.1_2 Reverse -83 -93 13.5836 0.21
NP_441612.1_2 Reverse -203 -213 6.61303 0.283
NP_442427.1_8 Forward -327 -308 15.2408 0.0918
NP_442808.1_1 Forward -390 -380 18.4657 0.00201
NP_442808.1_1 Reverse -379 -389 8.73102 0.0481
NP_442808.1_1 Reverse -91 -101 3.91283 0.218
NP_442820.1_4 Forward -228 -211 12.4285 0.265
NP_442542.1_2 Forward -391 -378 10.344 0.126
NP_442542.1_9 Forward -396 -382 21.73 0.00646
NP_442050.1_1 Reverse -270 -289 15.5357 0.187
NP_442050.1_5 Reverse -378 -388 15.9091 0.0091
NP_442050.1_5 Forward -391 -381 8.23937 0.234
NP_441114.1_3 Reverse -311 -320 15.831 0.193
NP_440558.1_2 Forward -347 -328 1.76941 0.176
NP_440558.1_2 Reverse -331 -350 -5.60541 0.262
NP_442789.1_4 Reverse -293 -312 -0.885524 0.209
NP_441518.1_3 Forward -399 -380 5.40766 0.05
NP_441878.1_6 Reverse -379 -389 10.5014 0.0176
NP_441878.1_6 Forward -390 -380 10.4031 0.0176
NP_441878.1_6 Forward -319 -309 -7.39479 0.222
NP_441036.1_8 Forward -390 -380 17.7779 0.000554
NP_441036.1_8 Reverse -379 -389 15.713 0.00724
NP_441036.1_8 Forward -281 -271 11.0914 0.138
NP_441557.1_5 Forward -389 -380 19.9609 0.000699
NP_441557.1_5 Reverse -380 -389 19.9609 0.000699
NP_442066.2_4 Forward -389 -370 -3.04881 0.215
NP_442066.2_9 Reverse -376 -389 10.2457 0.154
NP_442066.2_9 Forward -393 -380 8.47575 0.185
NP_441308.1_8 Forward -391 -381 9.22315 0.226
NP_441458.1_10 Forward -238 -219 4.03102 0.236
NP_442183.1_1 Reverse -380 -394 9.63603 0.0954
NP_442166.1_7 Reverse -384 -398 11.701 0.19
NP_442166.1_7 Forward -388 -374 7.57108 0.283
NP_442397.1_9 Reverse -140 -159 4.42435 0.254
NP_442397.1_9 Reverse -21 -40 1.47442 0.283
NP_441116.1_10 Forward -210 -191 2.3594 0.292
NP_442135.1_5 Reverse -40 -58 15.653 0.251
NP_440540.1_8 Forward -395 -376 9.63589 0.249
NP_442347.1_2 Reverse -381 -390 11.1111 0.056
NP_442347.1_2 Reverse -142 -151 5.89959 0.21
NP_442347.1_2 Forward -211 -202 3.93297 0.284
NP_442347.1_2 Forward -388 -379 3.34298 0.284
NP_442645.1_2 Reverse -372 -391 -21.535 0.29
NP_441037.1_4 Forward -391 -381 16.2838 0.0168
NP_441037.1_4 Reverse -269 -279 11.8007 0.13
NP_441037.1_4 Reverse -378 -388 7.22024 0.237
NP_442508.1_8 Reverse -279 -296 10.7569 0.267
NP_441633.1_3 Reverse -378 -391 13.3923 0.018
NP_441633.1_3 Forward -391 -378 -3.81562 0.177
NP_440136.1_2 Forward -388 -381 15.9687 0.0123
NP_440136.1_2 Reverse -381 -388 15.9687 0.0123
NP_442998.1_5 Reverse -82 -92 13.648 0.157
NP_442998.1_10 Forward -387 -380 15.5754 0.0102
NP_442998.1_10 Reverse -382 -389 15.5754 0.0102
NP_440899.1_2 Reverse -369 -388 5.60352 0.278
NP_441799.1_1 Reverse -376 -390 16.3219 0.0152
NP_441799.1_1 Forward -393 -379 10.0287 0.0797
NP_441007.1_10 Forward -394 -381 3.5592 0.182
NP_441007.1_10 Reverse -375 -388 2.67422 0.183
NP_442201.1_10 Reverse -369 -388 -13.6686 0.274
NP_442333.2_5 Reverse -369 -388 -8.16202 0.238
NP_440256.1_1 Reverse -377 -396 18.584 0.0045
NP_440256.1_1 Forward -392 -373 6.78429 0.0288
NP_441512.1_4 Reverse -376 -395 15.6341 0.125
NP_441559.1_8 Reverse -375 -389 -0.0987402 0.172
NP_441559.1_8 Forward -217 -203 -7.08024 0.283
NP_440915.1_6 Forward -393 -379 15.4376 0.0183
NP_440915.1_6 Reverse -376 -390 8.55439 0.0533
NP_442158.1_4 Forward -232 -222 11.1898 0.28
NP_441113.1_3 Reverse -157 -171 16.4202 0.23
NP_441939.1_3 Reverse -381 -400 12.1925 0.103
NP_441939.1_3 Forward -388 -369 6.88262 0.22
NP_441199.1_6 Forward -284 -265 0.392778 0.243
NP_442993.1_1 Reverse -380 -396 -7.70961 0.146
NP_442386.1_9 Forward -390 -381 15.7322 0.0144
NP_442386.1_9 Reverse -379 -388 6.39082 0.219
NP_442386.1_10 Reverse -387 -400 3.46087 0.273
NP_441340.1_5 Forward -388 -381 15.6737 0.0124
NP_441340.1_5 Reverse -381 -388 15.6737 0.0124
NP_441340.1_5 Reverse -310 -317 3.97235 0.274
NP_441132.1_5 Reverse -378 -397 20.5506 0.0977
NP_442240.1_2 Forward -388 -369 -19.8634 0.295
NP_440161.1_3 Forward -391 -372 8.06259 0.278
NP_441160.1_6 Forward -294 -275 13.4708 0.0788
NP_441134.1_10 Forward -400 -382 10.4422 0.238
NP_440586.1_8 Forward -388 -381 13.2151 0.026
NP_440586.1_8 Reverse -381 -388 13.2151 0.026
NP_442251.1_6 Forward -388 -381 15.2804 0.0124
NP_442251.1_6 Reverse -381 -388 15.2804 0.0124
NP_441262.1_3 Reverse -380 -387 14.7888 0.0223
NP_441262.1_3 Forward -389 -382 14.7888 0.0223
NP_443051.1_1 Reverse -379 -388 19.5676 0.00335
NP_443051.1_1 Forward -390 -381 10.4228 0.00754
NP_439937.1_9 Reverse -57 -74 -15.4981 0.287
NP_439937.1_9 Forward -390 -373 -16.4814 0.287
NP_439937.1_9 Forward -216 -199 -17.1697 0.294
NP_442294.1_3 Forward -171 -157 13.4703 0.269
NP_440439.1_1 Reverse -377 -390 10.934 0.0339
NP_440439.1_1 Forward -392 -379 9.36073 0.0465
NP_439943.1_1 Forward -91 -72 -9.24366 0.28
NP_440372.1_2 Forward -388 -381 16.3621 0.0124
NP_440372.1_2 Reverse -381 -388 16.3621 0.0124
NP_440819.1_5 Reverse -225 -233 7.68924 0.266
NP_440316.1_10 Reverse -273 -283 10.7964 0.219
NP_440139.1_1 Reverse -374 -393 3.63691 0.201
NP_441572.1_7 Forward -395 -376 -0.4922 0.182
NP_440267.1_2 Reverse -375 -389 19.6651 0.0168
NP_442384.1_10 Forward -389 -376 10.5407 0.0439
NP_442035.1_7 Reverse -308 -327 16.0795 0.276
NP_442114.1_4 Reverse -380 -391 12.1534 0.107
NP_442262.1_10 Forward -388 -381 14.1988 0.0123
NP_442262.1_10 Reverse -381 -388 14.1988 0.0123
NP_442262.1_10 Reverse -310 -317 9.87221 0.164
NP_441689.1_5 Reverse -378 -388 8.3377 0.132
NP_441689.1_5 Forward -351 -341 5.97777 0.197
NP_440344.1_10 Forward -396 -379 -0.944468 0.048
NP_440344.1_10 Reverse -373 -390 -8.61428 0.13
NP_440531.1_6 Reverse -372 -391 0.0977854 0.199
NP_442123.1_3 Reverse -380 -399 18.289 0.0676
NP_442123.1_3 Forward -389 -370 10.9142 0.265
NP_440189.1_10 Forward -96 -77 3.6377 0.279
NP_441640.1_8 Forward -376 -357 -3.44213 0.257
NP_442529.1_4 Forward -398 -379 7.66927 0.289
NP_440297.1_9 Forward -388 -378 -0.216628 0.282
NP_440297.1_9 Reverse -381 -391 -0.216628 0.282
NP_441896.1_3 Forward -398 -379 1.27776 0.218
NP_440999.1_9 Forward -393 -379 11.6026 0.0438
NP_440888.1_2 Reverse -380 -394 18.2885 0.00261
NP_440888.1_2 Forward -389 -375 17.4035 0.00402
NP_440888.1_2 Reverse -112 -126 5.1122 0.293
NP_440600.1_4 Reverse -372 -390 -7.84733 0.294
NP_440491.1_1 Forward -392 -373 10.8153 0.18
NP_440052.1_5 Forward -400 -381 1.27776 0.165
NP_439969.1_3 Forward -394 -375 8.16093 0.127
NP_439969.1_3 Forward -95 -76 1.37609 0.257
NP_442277.1_4 Reverse -371 -390 11.11 0.0832
NP_442277.1_4 Forward -398 -379 5.01354 0.181
NP_441543.1_2 Reverse -381 -390 18.486 0.00236
NP_441543.1_2 Forward -388 -379 15.9293 0.00518
NP_441551.1_5 Forward -393 -377 7.13767 0.249
NP_440982.1_1 Forward -296 -277 4.22689 0.294
NP_441469.1_8 Forward -390 -381 16.126 0.00797
NP_441469.1_8 Reverse -379 -388 6.5879 0.227
NP_442315.1_5 Reverse -278 -288 16.4013 0.3
NP_443064.1_6 Forward -389 -379 10.8217 0.13
NP_442578.1_7 Forward -388 -381 14.5921 0.026
NP_442578.1_7 Reverse -381 -388 14.5921 0.026
NP_442578.1_7 Reverse -341 -348 5.25066 0.251
NP_440710.1_1 Reverse -372 -390 3.85406 0.113
NP_441462.1_2 Forward -389 -379 20.2362 0.000805
NP_441462.1_2 Reverse -380 -390 11.5831 0.00406
NP_441621.1_7 Forward -391 -377 4.22782 0.0934
NP_441621.1_7 Reverse -378 -392 -3.34366 0.188
NP_441621.1_7 Forward -400 -386 -4.52363 0.232
NP_441621.1_7 Reverse -269 -283 -5.01529 0.248
NP_443062.1_1 Forward -389 -371 9.81352 0.127
NP_443062.1_1 Reverse -380 -398 9.521 0.133
NP_441410.1_3 Reverse -371 -390 5.11266 0.252
NP_442204.1_1 Reverse -259 -270 5.8602 0.186
NP_442204.1_1 Reverse -376 -387 2.02529 0.266
NP_440516.1_8 Forward -389 -380 16.9127 0.00442
NP_440516.1_8 Reverse -380 -389 16.9127 0.00442
NP_440516.1_8 Reverse -271 -280 6.09625 0.0949
NP_441033.1_2 Reverse -82 -101 -5.50708 0.293
NP_441033.1_2 Reverse -39 -58 -5.99873 0.293
NP_441033.1_2 Forward -399 -380 -10.6203 0.293
NP_442428.1_5 Forward -388 -381 15.8704 0.0124
NP_442428.1_5 Reverse -381 -388 15.8704 0.0124
NP_442428.1_5 Forward -317 -310 4.46401 0.267
NP_441790.1_3 Reverse -381 -400 -4.72043 0.291
NP_440673.1_3 Forward -387 -380 12.4288 0.0426
NP_440673.1_3 Reverse -382 -389 12.4288 0.0426
NP_440673.1_3 Reverse -311 -318 10.5605 0.123
NP_440673.1_7 Forward -400 -381 4.42435 0.185
NP_441052.1_2 Reverse -380 -390 10.5014 0.0285
NP_441052.1_2 Forward -389 -379 10.4031 0.0285
NP_441052.1_2 Forward -212 -202 3.12662 0.184
NP_442219.1_9 Reverse -381 -390 8.35786 0.0681
NP_442219.1_9 Forward -388 -379 8.25953 0.0681
NP_440436.1_4 Reverse -381 -390 18.1905 0.00233
NP_440436.1_4 Forward -388 -379 9.24241 0.0871
NP_440436.1_4 Reverse -310 -319 8.45576 0.105
NP_441884.1_8 Forward -390 -371 -12.2919 0.271
NP_441884.1_9 Reverse -377 -396 -12.2919 0.138
NP_441884.1_9 Forward -392 -373 -12.8819 0.138
NP_442907.1_2 Reverse -381 -399 7.39397 0.286
NP_441719.1_4 Forward -388 -381 16.3621 0.0124
NP_441719.1_4 Reverse -381 -388 16.3621 0.0124
NP_441719.1_6 Forward -276 -257 9.34008 0.269
NP_441733.1_10 Forward -392 -379 10.5407 0.106
NP_441733.1_10 Reverse -377 -390 8.27909 0.14
NP_441004.1_1 Reverse -265 -284 -8.16202 0.2
NP_442813.1_4 Reverse -350 -369 -5.99873 0.299
NP_442813.1_4 Forward -231 -212 -9.047 0.299
NP_442366.1_3 Forward -390 -372 -4.11075 0.264
NP_440296.1_10 Forward -392 -373 -13.6686 0.269
NP_441115.1_4 Forward -390 -372 20.0778 0.00637
NP_442694.1_9 Reverse -327 -346 9.43923 0.244
NP_443054.1_2 Reverse -378 -392 19.7641 0.0121
NP_441851.1_10 Forward -390 -380 16.008 0.00552
NP_441851.1_10 Reverse -379 -389 8.53483 0.114
NP_441851.1_10 Reverse -308 -318 3.91327 0.296
NP_442622.1_1 Reverse -379 -398 8.16093 0.0623
NP_442011.1_1 Forward -390 -371 -2.85214 0.283
NP_442856.1_7 Forward -398 -379 -5.99873 0.291
NP_442515.1_1 Forward -319 -305 -0.590395 0.228
NP_442515.1_1 Reverse -379 -393 -3.34366 0.29
NP_441982.1_6 Reverse -223 -232 10.7665 0.292
NP_440165.1_5 Forward -390 -371 9.0459 0.0617
NP_442689.1_8 Reverse -2 -19 -7.82764 0.292
NP_441349.1_10 Reverse -370 -389 0.687771 0.0867
NP_440432.1_9 Reverse -381 -396 18.4661 0.00961
NP_440432.1_9 Forward -388 -373 5.3881 0.0555
NP_440432.1_9 Reverse -310 -325 1.2582 0.15
NP_440474.1_8 Reverse -381 -395 17.6002 0.0432
NP_440474.1_8 Forward -388 -374 6.88214 0.215
NP_440474.1_8 Forward -317 -303 6.39049 0.227
NP_442168.1_5 Reverse -381 -400 -4.03212 0.299
NP_440954.1_4 Reverse -50 -69 -2.85214 0.275
NP_440943.1_4 Forward -326 -314 15.2803 0.194
NP_442006.1_2 Forward -398 -381 2.79211 0.09
NP_440483.1_1 Reverse -192 -211 -6.68705 0.252
NP_442243.1_1 Forward -384 -366 0.0184138 0.238
NP_442038.1_1 Forward -145 -126 0.196116 0.278
NP_441570.1_1 Forward -389 -371 0.0191479 0.0424
NP_441570.1_1 Reverse -380 -398 -0.472507 0.0472
NP_441078.1_4 Forward -389 -380 19.6659 0.0007
NP_441078.1_4 Reverse -380 -389 19.6659 0.0007
NP_442348.1_2 Forward -80 -71 10.8161 0.251
NP_440707.1_6 Reverse -372 -391 12.4867 0.214
NP_440526.1_3 Reverse -381 -392 11.7595 0.0646
NP_440526.1_3 Forward -388 -377 1.92649 0.267
NP_441432.1_8 Reverse -379 -388 16.8143 0.00595
NP_441432.1_8 Forward -390 -381 8.25953 0.0755
NP_441432.1_8 Reverse -334 -343 2.65466 0.292
NP_442320.1_8 Forward -395 -381 14.4542 0.0132
NP_442344.1_7 Reverse -381 -400 -6.78538 0.172
NP_441732.1_2 Reverse -376 -392 -15.2811 0.145
NP_440313.1_6 Reverse -236 -255 15.1424 0.285
NP_442003.1_4 Forward -388 -369 9.14423 0.3
NP_440760.1_1 Reverse -380 -399 -21.6334 0.24
NP_440760.1_1 Reverse -49 -68 -23.2067 0.288
NP_442797.1_7 Forward -397 -379 -0.275845 0.282
NP_440913.1_1 Reverse -378 -396 12.1139 0.168
NP_442489.1_7 Forward -389 -380 20.1576 0.000695
NP_442489.1_7 Reverse -380 -389 20.1576 0.000695
NP_440559.1_1 Reverse -381 -390 8.75118 0.0586
NP_440559.1_1 Forward -388 -379 8.65285 0.0586
NP_441659.2_8 Forward -389 -379 20.9245 0.000805
NP_441659.2_8 Reverse -380 -390 11.9764 0.0147
NP_441022.1_1 Reverse -126 -135 11.3544 0.284
NP_442913.1_10 Forward -398 -379 10.6192 0.0421
NP_442913.1_10 Reverse -371 -390 -3.04881 0.198
NP_442008.1_2 Forward -287 -268 6.09597 0.223
NP_440118.1_2 Reverse -171 -190 -1.67217 0.298
NP_442776.1_1 Reverse -310 -329 4.22769 0.278
NP_440779.1_5 Reverse -380 -397 4.16874 0.0577
NP_442346.1_5 Reverse -379 -389 16.303 0.00248
NP_442346.1_5 Forward -319 -309 10.9931 0.078
NP_442346.1_5 Forward -390 -380 9.02648 0.118
NP_440545.1_3 Forward -393 -376 -3.50107 0.206
NP_440486.1_4 Forward -84 -66 3.75572 0.226
NP_440459.1_2 Forward -327 -310 8.7903 0.249
NP_440459.1_2 Reverse -272 -289 8.00365 0.272
NP_441653.1_2 Forward -400 -381 11.0671 0.119
NP_441943.1_8 Reverse -74 -93 -5.99873 0.261
NP_441888.1_7 Reverse -44 -58 3.63784 0.225
NP_441948.1_4 Reverse -373 -391 15.8504 0.0224
NP_441948.1_4 Forward -396 -378 5.42735 0.0773
NP_441358.1_2 Reverse -275 -294 6.78429 0.275
NP_441833.1_4 Forward -388 -381 15.9687 0.0124
NP_441833.1_4 Reverse -381 -388 15.9687 0.0124
NP_442162.1_9 Forward -388 -381 16.2637 0.0124
NP_442162.1_9 Reverse -381 -388 16.2637 0.0124
NP_440224.1_1 Reverse -369 -388 0.982764 0.132
NP_442199.1_5 Reverse -372 -391 0.491109 0.172
NP_442140.1_3 Reverse -381 -391 17.4829 0.0159
NP_442140.1_3 Forward -388 -378 4.69992 0.238
NP_442140.1_3 Forward -317 -307 3.91327 0.271
NP_441671.1_10 Reverse -276 -295 0.392778 0.281
NP_440875.1_9 Reverse -382 -392 17.619 0.0104
NP_440875.1_9 Forward -387 -377 15.867 0.0233
NP_442547.1_5 Forward -327 -308 18.9904 0.193
NP_441813.1_5 Reverse -378 -388 18.1713 0.00743
NP_441813.1_5 Forward -391 -381 10.0098 0.0208
NP_442089.1_1 Reverse -377 -396 0.687771 0.252
NP_440590.1_4 Reverse -381 -394 11.9173 0.0173
NP_440590.1_4 Forward -388 -375 2.87088 0.0788
NP_440567.1_1 Reverse -381 -395 10.816 0.0323
NP_440567.1_1 Forward -388 -374 9.63603 0.0422
NP_442497.1_10 Forward -388 -379 17.601 0.00813
NP_442497.1_10 Reverse -381 -390 10.4228 0.0087
NP_440821.1_4 Forward -391 -381 18.7612 0.00422
NP_440821.1_4 Reverse -378 -388 2.24165 0.131
NP_441239.1_9 Forward -391 -379 16.0669 0.0175
NP_441239.1_9 Reverse -378 -390 15.5753 0.0186
NP_441892.1_1 Forward -398 -381 1.8088 0.147
NP_441892.1_1 Reverse -371 -388 1.71047 0.148
NP_440665.1_2 Reverse -196 -215 -5.60541 0.247
NP_441508.1_4 Reverse -225 -239 14.0489 0.287
NP_441017.1_6 Reverse -149 -163 14.0603 0.157
NP_442052.1_8 Forward -320 -310 16.6963 0.207
NP_440546.1_4 Forward -389 -379 13.5365 0.0459
NP_440546.1_4 Reverse -380 -390 11.8882 0.0679
NP_440462.1_6 Reverse -378 -388 18.7612 0.00454
NP_440462.1_6 Forward -391 -381 17.9746 0.00578
NP_440868.1_4 Forward -393 -381 9.77374 0.043
NP_440868.1_4 Reverse -376 -388 8.10212 0.0602
NP_440401.1_9 Forward -208 -201 14.5917 0.287
NP_441474.1_1 Forward -399 -380 1.86696 0.247
NP_441848.1_7 Forward -294 -275 -4.22953 0.288
NP_441084.1_6 Reverse -378 -392 12.4467 0.16
NP_440653.1_10 Reverse -310 -329 6.19431 0.217
NP_442039.1_4 Forward -388 -381 15.1821 0.0124
NP_442039.1_4 Reverse -381 -388 15.1821 0.0124
NP_442039.1_7 Forward -316 -306 14.0414 0.211
NP_441926.1_3 Forward -389 -373 5.36841 0.17
NP_442696.1_2 Reverse -379 -397 13.0972 0.129
NP_442696.1_6 Reverse -153 -172 -11.3086 0.235
NP_442837.1_3 Forward -388 -381 15.7721 0.0124
NP_442837.1_3 Reverse -381 -388 15.7721 0.0124
NP_442837.1_3 Forward -348 -341 9.18389 0.144
NP_440160.1_2 Reverse -269 -288 -2.36049 0.245
NP_442053.1_1 Forward -389 -380 18.3876 0.0007
NP_442053.1_1 Reverse -380 -389 18.3876 0.0007
NP_440505.1_3 Reverse -378 -388 17.188 0.00332
NP_440505.1_3 Forward -391 -381 14.1397 0.0235
NP_440505.1_7 Reverse -376 -395 -0.4922 0.271
NP_440013.1_1 Reverse -107 -126 7.17681 0.295
NP_440914.1_1 Forward -389 -379 16.3248 0.00196
NP_440914.1_1 Forward -318 -308 10.9573 0.116
NP_440914.1_1 Reverse -380 -390 8.6151 0.186
NP_440914.1_1 Reverse -335 -345 6.17532 0.293
NP_441011.1_8 Reverse -381 -390 16.9127 0.00602
NP_441011.1_8 Forward -388 -379 16.6177 0.00602
NP_441011.1_8 Reverse -108 -117 5.60459 0.247
NP_442533.1_1 Reverse -12 -31 -10.817 0.235
NP_442533.1_6 Forward -389 -380 17.2076 0.00137
NP_442533.1_6 Reverse -380 -389 17.2076 0.00137
NP_442232.1_3 Reverse -372 -391 -15.0452 0.288
NP_442322.1_4 Forward -286 -269 -1.53514 0.226
NP_442322.1_4 Forward -298 -281 -9.10659 0.287
NP_442322.1_4 Reverse -37 -54 -10.0899 0.298
NP_441482.1_7 Reverse -374 -388 -12.1934 0.29
NP_439944.1_9 Reverse -381 -391 10.4031 0.0887
NP_439944.1_9 Forward -388 -378 9.12481 0.1
NP_439944.1_9 Forward -317 -307 4.89658 0.292
NP_441697.1_1 Forward -281 -263 18.702 0.0649
NP_440816.1_2 Forward -314 -295 8.66165 0.238
NP_441028.1_6 Forward -88 -78 3.51951 0.292
NP_440116.1_8 Forward -388 -369 -2.55715 0.135
NP_440116.1_8 Reverse -381 -400 -7.4737 0.231
NP_441527.1_4 Reverse -229 -248 3.19856 0.119
NP_440115.1_6 Reverse -377 -387 4.89658 0.28
NP_440007.1_9 Reverse -331 -345 6.98109 0.213
NP_441972.1_5 Reverse -369 -388 -7.76869 0.252
NP_441972.1_5 Reverse -381 -400 -7.96535 0.256
NP_441106.1_1 Reverse -379 -388 18.486 0.0028
NP_441106.1_1 Forward -390 -381 18.191 0.0028
NP_442928.1_3 Reverse -267 -286 15.8021 0.205
NP_442306.1_10 Reverse -375 -394 -1.37718 0.0484
NP_442704.1_7 Forward -217 -198 11.7992 0.264
NP_441286.1_1 Reverse -379 -391 5.34885 0.0259
NP_441286.1_1 Forward -390 -378 -3.59927 0.145
NP_440670.1_8 Forward -389 -380 18.3876 0.000699
NP_440670.1_8 Reverse -380 -389 18.3876 0.000699
NP_441479.1_1 Forward -392 -373 19.174 0.0605
NP_440886.1_7 Forward -390 -380 17.7774 0.0011
NP_440886.1_7 Reverse -379 -389 8.04271 0.0805
NP_440886.1_7 Reverse -48 -58 5.48612 0.181
NP_442072.1_9 Forward -390 -372 -11.5839 0.0789
NP_442072.1_9 Reverse -379 -397 -11.7806 0.0798
NP_440907.2_8 Reverse -381 -391 17.4824 0.00685
NP_440907.2_8 Forward -388 -378 9.616 0.103
NP_441021.1_8 Reverse -375 -393 13.0972 0.0938
NP_441463.1_3 Forward -399 -380 -0.0988766 0.132
NP_441463.1_3 Reverse -370 -389 -5.11376 0.22
NP_442842.1_9 Forward -185 -166 15.3391 0.146
NP_441626.1_2 Forward -388 -381 15.7721 0.0124
NP_441626.1_2 Reverse -381 -388 15.7721 0.0124
NP_442238.1_6 Reverse -335 -354 19.5746 0.0546
NP_440107.1_5 Reverse -373 -392 -5.9004 0.225
NP_441401.1_1 Forward -213 -194 8.94757 0.289
NP_442615.1_1 Reverse -371 -389 0.707465 0.0979
NP_442615.1_1 Forward -398 -380 -4.79907 0.194
NP_441962.1_4 Forward -323 -304 -7.76869 0.194
NP_440855.1_5 Forward -287 -268 4.32522 0.285
NP_441431.1_2 Reverse -377 -391 10.9137 0.15
NP_441431.1_2 Forward -392 -378 9.24208 0.19
NP_441431.1_3 Reverse -274 -293 3.04771 0.275
NP_441836.1_2 Reverse -268 -287 3.53937 0.151
NP_441993.1_1 Reverse -380 -399 5.45515 0.201
NP_441993.1_1 Forward -395 -376 0.679741 0.294
NP_441174.1_1 Reverse -273 -288 11.8779 0.247
NP_440467.1_3 Forward -388 -369 15.358 0.137
NP_440114.1_10 Forward -389 -375 18.0925 0.0075
NP_440114.1_10 Reverse -380 -394 15.3392 0.0264
NP_440114.1_10 Forward -175 -161 5.80112 0.292
NP_442437.1_8 Reverse -369 -388 7.7676 0.242
NP_441510.2_7 Forward -301 -287 9.24208 0.292
NP_440766.1_5 Reverse -81 -93 7.94227 0.288
NP_439988.1_3 Reverse -384 -398 7.27608 0.277
NP_442743.1_1 Forward -293 -274 12.0933 0.241
NP_439910.1_2 Forward -397 -380 -21.299 0.183
NP_442867.1_8 Reverse -381 -400 5.01433 0.277
NP_440457.1_1 Reverse -376 -388 8.9871 0.0988
NP_442940.1_2 Forward -302 -283 0.196116 0.296
NP_440987.1_7 Reverse -177 -191 16.6175 0.198
NP_440798.1_6 Reverse -381 -394 12.3107 0.0468
NP_440798.1_6 Forward -388 -375 3.5592 0.15
NP_442509.1_9 Reverse -380 -390 16.2041 0.00739
NP_442509.1_9 Forward -389 -379 8.04271 0.192
NP_440554.1_4 Forward -388 -378 17.9746 0.0131
NP_440554.1_4 Reverse -381 -391 13.943 0.0218
NP_442862.1_3 Reverse -1 -18 5.44704 0.276
NP_441885.1_5 Reverse -380 -390 11.4848 0.00668
NP_441885.1_5 Forward -389 -379 11.3864 0.00668
NP_440478.1_10 Forward -391 -377 7.86607 0.257
NP_442341.1_7 Reverse -379 -393 3.8345 0.21
NP_441756.1_5 Forward -393 -374 6.39097 0.175
NP_441173.1_6 Reverse -375 -394 12.4875 0.186
NP_442395.2_4 Forward -390 -371 1.96529 0.229
NP_442395.2_4 Reverse -69 -88 1.6703 0.235
NP_442534.1_7 Reverse -372 -391 13.1758 0.181
NP_440423.1_6 Forward -397 -378 -11.5053 0.178
NP_440423.1_6 Reverse -263 -282 -20.5517 0.261
NP_443000.1_7 Reverse -378 -388 20.3345 0.00223
NP_443000.1_7 Forward -391 -381 2.04498 0.226
NP_442513.1_5 Forward -397 -378 11.2084 0.266
NP_441842.1_10 Forward -396 -382 15.3392 0.044
NP_441842.1_10 Reverse -373 -387 10.6193 0.157
NP_440275.1_3 Forward -391 -381 17.9746 0.0082
NP_440275.1_3 Reverse -378 -388 16.1063 0.0155
NP_440091.1_1 Forward -393 -381 20.1968 0.00953
NP_440091.1_1 Reverse -376 -388 3.2839 0.163
NP_443010.1_10 Forward -392 -375 8.37555 0.16
NP_441359.1_5 Forward -399 -380 1.96607 0.283
NP_442451.1_2 Forward -397 -378 -9.14533 0.259
NP_441122.1_1 Forward -342 -327 8.92802 0.28
NP_439962.1_4 Forward -183 -164 -4.91709 0.272
NP_439962.1_4 Forward -397 -378 -6.68705 0.283
NP_439962.1_4 Reverse -269 -288 -8.85033 0.298
NP_439962.1_4 Forward -291 -272 -9.047 0.298
NP_440149.1_8 Reverse -380 -399 2.0644 0.115
NP_441105.1_3 Forward -173 -154 -7.67036 0.258
NP_440216.1_1 Forward -389 -375 26.9423 0.000481
NP_440216.1_1 Reverse -380 -394 16.1259 0.00307
NP_440216.1_9 Reverse -238 -247 6.09625 0.289
NP_440172.1_1 Forward -389 -379 17.5813 0.00421
NP_440172.1_1 Reverse -380 -390 8.73149 0.0586
NP_440172.1_1 Reverse -214 -224 6.17489 0.11
NP_442015.1_10 Forward -381 -368 -0.669033 0.277
NP_441226.1_7 Forward -388 -381 14.4934 0.0123
NP_441226.1_7 Reverse -381 -388 14.4934 0.0123
NP_441111.1_7 Forward -388 -380 18.7023 0.00294
NP_441111.1_7 Reverse -381 -389 18.7023 0.00294
NP_442379.1_10 Reverse -373 -390 -1.73112 0.223
NP_442379.1_10 Forward -396 -379 -3.00942 0.248
NP_441766.1_2 Forward -389 -380 17.5026 0.00297
NP_441766.1_2 Reverse -380 -389 17.5026 0.00297
NP_442252.1_1 Forward -265 -246 13.0775 0.295
NP_442252.1_3 Reverse -42 -60 21.7503 0.0404
NP_440416.1_1 Reverse -380 -399 -13.5702 0.281
NP_440416.1_9 Reverse -373 -392 -8.55534 0.117
NP_443052.1_8 Forward -399 -380 4.03102 0.0452
NP_443052.1_9 Forward -293 -274 -2.45882 0.238
NP_440072.1_5 Reverse -274 -292 -3.22577 0.277
NP_442154.1_1 Reverse -381 -399 -15.1238 0.218
NP_442154.1_1 Reverse -275 -293 -15.5171 0.22
NP_440261.1_5 Reverse -381 -394 -1.16069 0.0662
NP_440261.1_5 Forward -388 -375 -2.83231 0.0932
NP_440988.1_10 Reverse -333 -347 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCGCCCAAGCGGCGATCGCCTGTCGGAGTGCCATTAAAAACGGTATGGAATTGGATCGCATTGCCATTAATAAACTCATTGAGCAATGGCAACAATGTGATAATCCCCACACCTGCCCCCACGGTCGGCCCATCTACTTAGCTTTAGATGAATCTTCCTTGGCTCGTTTTTTCCGTAGAAATTGGCTGGTTAACCCCAAAACTTCTGGTTCTTGAATCGCCTTCAACCATTGGCGTTTTAGCTCGCTCTTGGTATCACGGGTAACAAATTTATGGAACGGAGCAGGGTTAACTATAAAGGCTAACCTGGTTTTGTCCCACGGCATTTTCGGACTAAGTCCCGGAAATAGCGGGTTTGAGCCTGGATTAGGCCCACCTTTCTCCAATTCTAGAAAACATT

CDS

GTGTCAGTACTCCTAGAAGGCATTTTTAACGGTTTAAGCACAAGTTCAGTGTTACTGATTGCTGCCCTGGGTTTGGCGATCGTCTTTGGTCTGATGGGGGTAATTAACCTGGCCCATGGGGAATTGATGATGTTGGGCGCTTACAGCACCTTTGTGGTGCAAAACCTCTTCCAGAGCCTCGGTGACCCTTGGTTTGACCTCTACATTTTTGCCGCTCTGCCCGTTGCTTTCCTGGTGGCGGCGATCGCCGGTCTAGTTTTGGAAAGACAGGTTATCCGCTACTTGTACGGCCGACCGCTGGAAACATTGCTGGCCACCTGGGGGGTGAGCCTGATTTTGCAACAGTTTGTCCGCAGTGTGAACTGGATTATGGTGCTGGTGGTGGGTATATTTTTGCTTTTATATTTCGGTGGCACCTGGTTAATTAAACGCCAGGCCGGTGGCAAACCTTGGTTAGGGAAAGCCCAAGTCATCCTTTTCTTTCTCTCAGCGGCGATCTCCGGCATTAGTGGTTTTGTGGTGGCCCAGGCCAATTCTCCCCTGTGGAATCGGGCTTGGTTTGGAGCTAGGAACGTCAATGTTAGTGCCCCCACTTGGTTGCGGGGGGGGCTTGCCATTGGCACTTTCCAGGTACCCTACACCAGGATTTTTATAATTTTCCTGACTCTGCTCTGTTTACTGGCGGTGTATCTAATTTTCTACCGTTCTAATTGGGGACTGAGAATTCGAGCCGTTACCCAAAACCGGGGTATGAGTGCTTGTTTGGGTATTCCCACTGGGCAGGTGGATGCTTTGACCTTTGCCCTTGGTTCTGGCCTAGCGGGCATTGCAGGCTGTGCCATTAGTTTTCTGGGGGCGGTGGGGCCCAACATTGGTCAAAACTACATTATCAATACCTTCATGGTGGTGGTGGTAGGGGGCGTAGGTAACCTACTCGGAACCATTATTGCTTCCCTGGCGATCGGTGTATCCAGTGACTTGATTGGTAGTGGCACCCTGATTCGTTTATTCCCCCCAGAGGGAGCATTGCAACCTCTGTACGAATTTTTTACCTTTTTTGCCACCACCAGTATGGCCAGGGTTTTAGTCTTCGCCCTGATTATCCTTTTTCTGCAAATCAAGCCAGCGGGTATTTTCCCTCCCAAAGGCCGGACGGCGGAATTGTAG

Protein

MSVLLEGIFNGLSTSSVLLIAALGLAIVFGLMGVINLAHGELMMLGAYSTFVVQNLFQSLGDPWFDLYIFAALPVAFLVAAIAGLVLERQVIRYLYGRPLETLLATWGVSLILQQFVRSVNWIMVLVVGIFLLLYFGGTWLIKRQAGGKPWLGKAQVILFFLSAAISGISGFVVAQANSPLWNRAWFGARNVNVSAPTWLRGGLAIGTFQVPYTRIFIIFLTLLCLLAVYLIFYRSNWGLRIRAVTQNRGMSACLGIPTGQVDALTFALGSGLAGIAGCAISFLGAVGPNIGQNYIINTFMVVVVGGVGNLLGTIIASLAIGVSSDLIGSGTLIRLFPPEGALQPLYEFFTFFATTSMARVLVFALIILFLQIKPAGIFPPKGRTAEL