Your browser is old and dusty. Try Google Chrome!

Details for slr1194

ORF slr1194
Accession NP_440693.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_443032.1_8 Reverse -282 -301 10.2259 0.17
NP_442291.1_5 Reverse -161 -177 -1.90808 0.204
NP_442291.1_5 Forward -125 -109 -2.79306 0.226
NP_441453.1_7 Reverse -7 -14 14.1988 0.175
NP_441623.1_1 Reverse -256 -274 1.59244 0.211
NP_442877.1_2 Forward -384 -365 0.884433 0.272
NP_441818.1_9 Forward -240 -221 3.34271 0.18
NP_441818.1_9 Reverse -336 -355 1.27776 0.191
NP_441818.1_9 Forward -228 -209 -1.67217 0.2
NP_441818.1_9 Forward -234 -215 -8.45701 0.277
NP_441818.1_9 Forward -170 -151 -8.55534 0.277
NP_440150.1_2 Reverse -318 -337 6.68515 0.256
NP_442655.1_2 Forward -347 -328 1.0811 0.288
NP_443002.1_5 Forward -356 -338 17.9146 0.192
NP_442752.1_4 Forward -171 -164 5.34899 0.221
NP_443027.1_4 Forward -173 -163 6.27322 0.286
NP_442062.1_8 Forward -171 -161 3.51995 0.267
NP_440304.1_4 Reverse -103 -113 5.5849 0.201
NP_440916.1_1 Forward -256 -242 11.111 0.206
NP_439918.1_2 Forward -195 -176 -0.688862 0.236
NP_439918.1_2 Forward -234 -215 -2.26216 0.242
NP_439918.1_2 Reverse -336 -355 -3.93378 0.263
NP_440132.1_6 Forward -140 -121 11.6025 0.187
NP_442110.1_7 Forward -344 -330 2.35953 0.222
NP_441491.1_6 Reverse -193 -207 17.1227 0.204
NP_441082.1_10 Forward -239 -226 8.37742 0.275
NP_442726.1_7 Forward -392 -374 16.9321 0.0738
NP_441925.1_4 Reverse -132 -151 -7.27777 0.194
NP_441925.1_4 Reverse -139 -158 -8.85106 0.212
NP_441925.1_4 Reverse -131 -150 -10.4243 0.239
NP_441925.1_4 Reverse -145 -164 -15.2425 0.263
NP_441925.1_4 Reverse -140 -159 -17.6025 0.297
NP_440856.1_7 Forward -165 -146 -9.047 0.282
NP_441434.1_3 Forward -260 -241 -2.45882 0.262
NP_441738.1_2 Reverse -164 -171 8.00357 0.235
NP_440447.1_5 Reverse -6 -16 14.1397 0.277
NP_441713.1_1 Reverse -238 -257 -11.8986 0.237
NP_441770.1_4 Reverse -194 -213 -9.047 0.248
NP_442570.1_3 Forward -298 -279 -4.22878 0.228
NP_441327.1_5 Forward -11 -2 16.6177 0.111
NP_440851.1_6 Reverse -351 -368 2.79211 0.288
NP_442634.1_4 Reverse -103 -117 -2.75368 0.156
NP_441014.1_8 Reverse -139 -158 0.294447 0.218
NP_442848.1_5 Forward -260 -242 4.24738 0.276
NP_442848.1_5 Reverse -225 -243 0.805796 0.276
NP_442848.1_5 Reverse -146 -164 0.510803 0.276
NP_442730.1_8 Reverse -129 -148 5.80018 0.239
NP_441846.1_10 Forward -158 -139 -12.4886 0.19
NP_441846.1_10 Forward -141 -122 -13.6686 0.207
NP_441846.1_10 Forward -97 -78 -20.0601 0.256
NP_441846.1_10 Forward -165 -146 -21.4367 0.256
NP_441846.1_10 Forward -228 -209 -21.535 0.256
NP_441846.1_10 Forward -149 -130 -21.535 0.256
NP_440642.1_10 Reverse -5 -19 4.8172 0.25
NP_440642.1_10 Reverse -4 -18 2.26061 0.281
NP_441763.1_10 Reverse -215 -234 12.9783 0.125
NP_442161.1_3 Reverse -32 -51 9.43923 0.204
NP_440141.1_4 Forward -136 -117 -11.3086 0.298
NP_440141.1_8 Forward -298 -279 6.09597 0.271
NP_442782.1_2 Reverse -105 -119 3.04785 0.269
NP_442782.1_2 Reverse -244 -258 0.88457 0.282
NP_442205.1_9 Forward -87 -71 -2.89139 0.276
NP_440651.1_1 Reverse -229 -248 11.3075 0.231
NP_440373.1_5 Forward -300 -286 17.8958 0.237
NP_443001.1_7 Reverse -336 -355 8.35759 0.199
NP_440984.1_7 Reverse -134 -148 5.60446 0.248
NP_440985.1_10 Forward -99 -80 9.43923 0.299
NP_443055.1_6 Reverse -362 -380 -1.6532 0.281
NP_440147.1_4 Reverse -360 -373 3.95252 0.175
NP_441916.1_7 Forward -344 -334 11.8781 0.0261
NP_441916.1_7 Reverse -105 -115 2.92996 0.235
NP_442004.1_6 Reverse -245 -259 2.94952 0.254
NP_439966.1_7 Reverse -160 -170 12.3692 0.043
NP_439966.1_7 Forward -358 -348 5.87944 0.204
NP_440983.1_5 Reverse -220 -239 -6.68705 0.278
NP_442281.1_1 Forward -361 -347 1.86729 0.285
NP_442049.1_8 Forward -163 -144 16.0274 0.292
NP_441087.1_5 Reverse -218 -237 1.6703 0.257
NP_441087.1_6 Reverse -130 -148 2.47668 0.258
NP_441457.1_7 Forward -121 -102 5.11266 0.198
NP_442501.1_2 Reverse -137 -156 -0.983855 0.222
NP_442215.1_3 Forward -161 -143 18.3087 0.242
NP_442029.1_6 Forward -234 -215 9.43923 0.188
NP_442029.1_6 Reverse -342 -361 4.32602 0.271
NP_441751.2_8 Reverse -276 -290 -5.60527 0.223
NP_442292.1_5 Reverse -375 -394 -0.885524 0.257
NP_440511.1_1 Forward -295 -277 11.2289 0.184
NP_440511.1_1 Reverse -349 -367 8.57394 0.228
NP_440947.1_9 Forward -27 -8 8.65258 0.285
NP_441015.1_10 Reverse -377 -396 -10.0303 0.282
NP_441015.1_10 Forward -161 -142 -11.6036 0.298
NP_441876.1_9 Reverse -135 -145 11.5826 0.275
NP_442868.1_6 Forward -32 -22 0.275027 0.243
NP_442719.1_2 Reverse -131 -149 -11.9779 0.299
NP_442361.1_3 Reverse -329 -342 13.0973 0.159
NP_442808.1_1 Forward -365 -355 1.45457 0.285
NP_442775.1_6 Reverse -330 -349 14.0608 0.268
NP_442775.1_6 Forward -246 -227 10.7175 0.277
NP_442542.1_9 Reverse -328 -342 4.62054 0.292
NP_442050.1_1 Forward -152 -133 12.2908 0.22
NP_440038.1_4 Forward -352 -333 -1.27885 0.3
NP_440601.1_8 Forward -247 -228 16.4134 0.175
NP_440558.1_2 Reverse -135 -154 -4.42544 0.245
NP_440558.1_2 Reverse -211 -230 -6.98204 0.284
NP_441518.1_3 Forward -305 -286 -14.4552 0.276
NP_442650.1_2 Reverse -323 -337 2.65453 0.254
NP_441590.1_4 Reverse -140 -159 2.9486 0.29
NP_441433.1_8 Forward -21 -2 -3.24547 0.276
NP_442777.1_3 Reverse -132 -150 6.99988 0.195
NP_440738.1_5 Forward -367 -348 10.4225 0.124
NP_441308.1_8 Reverse -160 -170 8.73149 0.248
NP_441308.1_8 Forward -83 -73 7.94484 0.297
NP_442830.1_5 Reverse -138 -152 -1.37762 0.299
NP_442183.1_1 Forward -171 -157 14.7492 0.0286
NP_442183.1_3 Reverse -126 -145 14.1583 0.247
NP_441574.1_1 Reverse -335 -354 4.916 0.129
NP_442347.1_10 Reverse -282 -296 15.7319 0.224
NP_442965.1_2 Forward -96 -77 5.89931 0.159
NP_442965.1_2 Forward -289 -270 -6.49039 0.257
NP_442594.1_8 Forward -136 -117 4.52268 0.26
NP_442594.1_8 Forward -149 -130 1.57275 0.299
NP_441633.1_3 Reverse -151 -164 -5.68391 0.236
NP_440136.1_2 Forward -170 -163 3.97235 0.288
NP_442998.1_5 Forward -11 -1 9.91146 0.232
NP_440899.1_1 Reverse -336 -355 11.4328 0.164
NP_440256.1_1 Forward -174 -155 -5.40875 0.182
NP_440456.1_7 Forward -230 -216 9.93102 0.294
NP_441270.1_5 Forward -140 -121 16.6052 0.191
NP_440915.1_6 Forward -152 -138 -1.08205 0.22
NP_442158.1_4 Reverse -4 -14 13.7464 0.212
NP_441296.1_9 Reverse -78 -91 11.6217 0.231
NP_440717.1_3 Reverse -121 -135 7.07881 0.285
NP_440748.1_5 Forward -335 -316 -3.3438 0.296
NP_442993.1_1 Reverse -105 -121 -11.2495 0.24
NP_440677.1_6 Forward -157 -138 7.37428 0.298
NP_442386.1_9 Forward -357 -348 9.04574 0.175
NP_442386.1_9 Reverse -161 -170 7.86578 0.215
NP_442386.1_9 Reverse -280 -289 5.70251 0.241
NP_442386.1_10 Forward -291 -278 5.23083 0.262
NP_440327.1_6 Reverse -336 -355 15.4374 0.13
NP_440327.1_6 Forward -301 -282 4.81767 0.266
NP_440586.1_1 Forward -232 -213 -6.29373 0.299
NP_442251.1_6 Reverse -393 -400 7.11894 0.274
NP_440192.1_4 Forward -152 -133 9.39761 0.276
NP_440027.1_8 Reverse -69 -88 12.0933 0.209
NP_439937.1_9 Reverse -214 -231 -17.268 0.296
NP_440836.1_3 Forward -297 -278 18.7807 0.137
NP_440439.1_1 Forward -137 -124 5.13249 0.0934
NP_440439.1_1 Forward -174 -161 -0.669033 0.229
NP_440372.1_2 Forward -170 -163 4.07068 0.262
NP_440372.1_3 Forward -46 -32 13.476 0.255
NP_441789.1_7 Reverse -148 -167 -0.00131823 0.251
NP_440692.1_1 Reverse -56 -75 27.1388 0.000526
NP_440819.1_5 Forward -11 -3 7.68924 0.266
NP_440316.1_10 Forward -149 -139 8.1415 0.24
NP_440316.1_10 Forward -291 -281 6.66654 0.256
NP_441572.1_7 Reverse -99 -118 -3.63879 0.217
NP_442384.1_10 Reverse -376 -389 0.412608 0.291
NP_440693.1_8 Forward -92 -73 16.0274 0.229
NP_440693.1_10 Forward -163 -148 19.9411 0.272
NP_442790.1_4 Reverse -339 -358 -9.34199 0.183
NP_442262.1_10 Forward -370 -363 7.11894 0.287
NP_441689.1_5 Forward -173 -163 15.3192 0.0403
NP_440075.1_2 Forward -100 -81 4.916 0.288
NP_440282.1_10 Reverse -372 -391 -9.73531 0.288
NP_442556.1_10 Reverse -253 -272 12.173 0.217
NP_440350.1_5 Reverse -252 -271 -4.22878 0.273
NP_442280.1_10 Reverse -84 -102 6.03883 0.28
NP_441592.1_4 Forward -317 -298 -2.26216 0.261
NP_441103.1_9 Reverse -127 -137 12.2942 0.299
NP_440888.1_2 Forward -253 -239 8.06211 0.172
NP_440888.1_2 Reverse -78 -92 7.66879 0.186
NP_442845.1_2 Forward -177 -163 15.1426 0.0752
NP_442845.1_2 Forward -296 -282 13.6676 0.0934
NP_442845.1_2 Forward -87 -73 10.1277 0.16
NP_441551.1_5 Reverse -74 -90 7.62932 0.243
NP_441178.1_6 Reverse -136 -155 4.81688 0.268
NP_441469.1_8 Reverse -161 -170 6.48957 0.227
NP_441462.1_5 Forward -229 -210 6.4893 0.223
NP_441462.1_5 Forward -143 -124 3.14605 0.29
NP_440277.1_4 Forward -127 -108 13.5691 0.234
NP_440519.1_8 Reverse -232 -248 1.04184 0.294
NP_440516.1_6 Reverse -139 -153 11.1104 0.217
NP_440673.1_2 Forward -290 -271 12.6333 0.142
NP_441884.1_9 Forward -253 -234 -21.9284 0.272
NP_441719.1_6 Reverse -136 -155 14.3549 0.226
NP_441004.1_1 Forward -289 -270 -13.0786 0.253
NP_441004.1_3 Reverse -241 -260 4.916 0.224
NP_441004.1_5 Forward -197 -183 8.45605 0.274
NP_440296.1_10 Forward -151 -132 3.93269 0.185
NP_442694.1_9 Reverse -5 -24 8.35759 0.277
NP_442206.1_2 Forward -245 -226 10.7175 0.254
NP_440864.1_9 Forward -245 -226 4.03102 0.119
NP_441851.1_10 Reverse -243 -253 3.91327 0.296
NP_441851.1_10 Reverse -161 -171 3.91327 0.296
NP_441683.1_7 Forward -291 -272 -5.11376 0.244
NP_440593.1_3 Forward -376 -357 -6.1954 0.271
NP_442689.1_8 Forward -59 -42 -7.82764 0.292
NP_442689.1_8 Forward -48 -31 -7.82764 0.292
NP_442314.1_1 Forward -159 -141 -1.35749 0.231
NP_442843.1_1 Forward -243 -224 -8.55534 0.255
NP_442843.1_1 Forward -170 -151 -8.55534 0.255
NP_442843.1_1 Reverse -194 -213 -10.522 0.278
NP_442843.1_1 Reverse -193 -212 -12.0953 0.298
NP_442168.1_5 Forward -355 -336 -0.000545616 0.259
NP_440588.1_2 Reverse -373 -392 -4.42544 0.216
NP_442006.1_2 Forward -148 -131 -18.644 0.294
NP_442006.1_3 Forward -263 -245 -7.65067 0.298
NP_440483.1_1 Reverse -349 -368 -3.44213 0.215
NP_442243.1_1 Reverse -280 -298 -1.55487 0.279
NP_440629.1_4 Reverse -215 -234 8.25926 0.271
NP_442797.1_7 Forward -225 -207 -1.55415 0.299
NP_442274.1_8 Reverse -123 -141 16.6238 0.223
NP_440199.1_10 Reverse -332 -342 6.46988 0.299
NP_441057.1_4 Reverse -338 -356 -4.20908 0.299
NP_440565.1_3 Reverse -144 -163 14.0324 0.299
NP_442008.1_2 Reverse -210 -229 2.65439 0.282
NP_440352.1_5 Forward -20 -1 10.125 0.278
NP_441629.1_3 Forward -392 -373 -2.55791 0.272
NP_440486.1_4 Reverse -8 -26 -2.83245 0.231
NP_440459.1_2 Forward -24 -7 7.41366 0.291
NP_442045.1_5 Reverse -135 -154 -0.885524 0.276
NP_442546.1_4 Forward -169 -151 13.9821 0.227
NP_442723.1_1 Reverse -271 -290 4.03023 0.276
NP_441813.1_5 Reverse -160 -170 3.42162 0.169
NP_441813.1_7 Reverse -225 -239 16.9119 0.144
NP_442472.1_1 Reverse -291 -310 19.7631 0.203
NP_441239.1_9 Reverse -137 -149 7.11881 0.169
NP_440400.1_1 Reverse -121 -140 4.22689 0.22
NP_441892.1_4 Reverse -240 -259 1.47442 0.266
NP_442044.1_1 Forward -393 -374 -12.5869 0.273
NP_441526.1_6 Forward -136 -117 4.22769 0.271
NP_440546.1_4 Forward -148 -138 10.143 0.109
NP_440546.1_4 Reverse -362 -372 9.27034 0.146
NP_440546.1_4 Forward -290 -280 6.65249 0.288
NP_440462.1_6 Forward -173 -163 4.89658 0.18
NP_442499.1_1 Forward -378 -359 3.53937 0.252
NP_441474.1_1 Reverse -209 -228 8.06178 0.212
NP_442402.1_10 Reverse -251 -261 13.2542 0.204
NP_442402.1_10 Forward -385 -375 11.1893 0.269
NP_442039.1_7 Forward -263 -253 11.6814 0.257
NP_442625.1_3 Reverse -381 -400 12.1925 0.22
NP_442696.1_6 Reverse -268 -287 -13.9635 0.295
NP_440505.1_3 Forward -261 -251 4.99491 0.252
NP_440520.1_1 Forward -149 -130 -3.54046 0.22
NP_441203.1_1 Forward -343 -324 -17.2085 0.283
NP_440914.1_1 Forward -356 -346 9.10306 0.186
NP_442533.1_1 Forward -146 -127 -11.4069 0.236
NP_442533.1_1 Forward -158 -139 -14.2585 0.241
NP_442533.1_1 Forward -174 -155 -17.7985 0.295
NP_442533.1_6 Reverse -281 -290 3.04799 0.228
NP_442533.1_6 Reverse -139 -148 3.04799 0.228
NP_442533.1_6 Reverse -162 -171 1.67135 0.293
NP_442541.1_10 Reverse -138 -152 9.14375 0.213
NP_442322.1_4 Reverse -131 -148 0.333137 0.21
NP_442322.1_9 Reverse -126 -144 10.3431 0.251
NP_441482.1_7 Reverse -156 -170 -5.40861 0.182
NP_442269.1_10 Reverse -336 -355 5.70265 0.238
NP_441028.1_6 Reverse -3 -13 10.1076 0.21
NP_441028.1_6 Reverse -276 -286 3.51951 0.292
NP_440116.1_10 Reverse -8 -27 20.8456 0.101
NP_441106.1_1 Reverse -104 -113 2.85133 0.255
NP_441216.1_5 Forward -367 -348 11.0117 0.298
NP_441825.1_4 Reverse -353 -363 14.7297 0.239
NP_439903.1_6 Forward -117 -98 0.490334 0.261
NP_439955.1_10 Reverse -215 -234 11.5033 0.282
NP_440083.1_3 Forward -237 -218 16.2241 0.0793
NP_439899.1_2 Reverse -55 -74 19.174 0.0191
NP_441808.1_2 Forward -27 -8 9.24257 0.235
NP_440907.2_8 Reverse -163 -173 3.91283 0.289
NP_442467.1_4 Reverse -162 -181 6.68596 0.282
NP_441431.1_3 Reverse -341 -360 5.89931 0.254
NP_440293.1_3 Forward -297 -278 -3.63879 0.251
NP_439988.1_3 Forward -152 -138 10.816 0.219
NP_439988.1_3 Forward -294 -280 8.16106 0.265
NP_439998.1_7 Reverse -129 -148 16.8141 0.206
NP_440457.1_1 Forward -152 -140 6.92215 0.108
NP_441801.1_4 Reverse -277 -287 2.63497 0.29
NP_441436.1_2 Forward -287 -268 -2.95047 0.28
NP_442514.1_5 Reverse -138 -157 -5.60616 0.26
NP_440554.1_4 Reverse -163 -173 5.38824 0.15
NP_442862.1_3 Forward -233 -216 13.6085 0.176
NP_442703.1_4 Forward -371 -352 4.62021 0.283
NP_441173.1_9 Reverse -253 -261 10.9338 0.242
NP_440423.1_6 Forward -185 -166 -14.2585 0.224
NP_441561.1_7 Forward -367 -348 8.4551 0.244
NP_440275.1_3 Forward -32 -22 1.455 0.29
NP_440560.1_5 Reverse -119 -138 12.4143 0.211
NP_441902.1_3 Forward -181 -171 14.245 0.226
NP_443010.1_10 Forward -84 -67 7.98902 0.164
NP_441207.1_4 Forward -170 -151 9.43923 0.209
NP_440175.1_4 Forward -142 -123 -6.1954 0.166
NP_442495.1_4 Forward -291 -281 15.8113 0.115
NP_441105.1_3 Forward -301 -282 -7.86702 0.261
NP_440216.1_9 Forward -14 -5 11.6028 0.254
NP_440216.1_9 Forward -13 -4 7.27622 0.286
NP_442371.1_1 Forward -12 -2 14.0409 0.191
NP_441226.1_7 Reverse -163 -170 8.59356 0.197
NP_442379.1_10 Reverse -241 -258 -3.5994 0.264
NP_440244.1_1 Forward -150 -131 -4.52377 0.24
NP_439971.2_8 Forward -92 -78 21.8291 0.0297
NP_441766.1_2 Reverse -162 -171 3.34298 0.22
NP_443052.1_8 Reverse -11 -30 -9.53865 0.193
NP_443052.1_9 Reverse -139 -158 0.0977854 0.203
NP_442154.1_1 Forward -164 -146 -14.9272 0.218
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTAATCGTCCGCTAGGGTCTCCACCAAGTACACATCGCTCAAACCCCGATGCCAAAATCGACAGCCTTTGGGCACTTCAATGTCGTAATGCTTAAACACCAAATTGGTTAGGGCATGGGGAGCTAAGGTGGAATAAACACTGGGAAAAGCGTCCCCCGCTACTGTTGATTTTGGGGCCGGATTGGGAGCCGGAAAATCCACCACTGGATTAATGTCCGGTAGGGCAGAAAGGGATCGGAGTAGTTGCAGGGGGGGCATGGGGTCAAGGGGAGTGGTGAGGATGCAAAGCCGTCTCCTTTAGCTTAGAAAGGGAGGAGAAGGGGCTCCGTATTCTAAGCTACACTTCAGTTAGAGTTTGATTTAAATATCTGATGACCGCATAGTTGCCCAGGGAAAAATC

CDS

ATGGCCAATCGTACCCAAAGTCGTTACACCGATGTCCAAATTGCCACTTGGTTGAGGGGACTGCTGACCATTGCCTGGAGTGATGGGGACTTTGATGAATCGGAGCAACAAATGATCACCGGCCTCACCCAGGAGATGGGTTTTGGCAACAAGGAAGATGAGGTTCTATTCAAGACCATTACCCCGGCGGAATTACTAGAAGGCTTGGGGGACGACAAGGAAACGGCGGAAAACTTTCTCCGCACAGCGGTGTTGGTGGCGATCGCCGATGGCCTTTATTCCCCGGTGGAAGGAGAGCTATTGCGGGAATTTAGTCAAGCCCTGGGGATAAAAATTGACGCTTTGGAGTCATTAGAACATACCATCTGTGATCCCAACGGCGATCGAACCGAAATGGAGGAACATCCCCATCCCGATTTACTTCACCCCGTCAAGGATTGGCTGGACGGCATGGCCATCCACGATCCTCGTTTGGCCCATTTCATTTGTCATCTGGTGCCCCCCCAATGTCCCTTCGAGCGGGATGTTAAACTGTTTGGGCGCAAAATTGTTCATATTCCCCCTCTGTGCAAACTAAATCCTCTGTATGAACAGTTAATTGGTCTGAGGTTCCGGGCCCTTTCCTACCTGGCCGATGACTGCCAAGAGGACATCACGCCCTATATTTGA

Protein

MANRTQSRYTDVQIATWLRGLLTIAWSDGDFDESEQQMITGLTQEMGFGNKEDEVLFKTITPAELLEGLGDDKETAENFLRTAVLVAIADGLYSPVEGELLREFSQALGIKIDALESLEHTICDPNGDRTEMEEHPHPDLLHPVKDWLDGMAIHDPRLAHFICHLVPPQCPFERDVKLFGRKIVHIPPLCKLNPLYEQLIGLRFRALSYLADDCQEDITPYI