Your browser is old and dusty. Try Google Chrome!

Details for slr1183

ORF slr1183
Accession NP_443019.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Forward -389 -375 11.111 0.253
NP_440557.1_1 Forward -205 -186 15.8307 0.0588
NP_440795.1_7 Forward -205 -198 14.6904 0.0123
NP_440795.1_7 Reverse -198 -205 14.6904 0.0123
NP_440795.1_7 Reverse -230 -237 7.51227 0.24
NP_441418.1_6 Forward -206 -187 -30.0898 0.256
NP_442291.1_5 Forward -207 -191 -4.07137 0.263
NP_440897.1_6 Reverse -197 -216 -1.08295 0.187
NP_441453.1_4 Reverse -197 -205 16.539 0.00633
NP_441453.1_4 Forward -206 -198 16.539 0.00633
NP_442151.1_6 Forward -206 -192 18.5841 0.0071
NP_442151.1_6 Reverse -197 -211 8.84938 0.164
NP_441818.1_1 Reverse -198 -209 15.4961 0.0264
NP_440226.1_1 Reverse -197 -216 5.50599 0.154
NP_440226.1_1 Forward -206 -187 4.52268 0.188
NP_442169.1_1 Forward -348 -329 -1.57384 0.265
NP_440120.1_4 Forward -64 -50 16.5192 0.273
NP_442655.1_1 Forward -211 -192 -0.688862 0.252
NP_441721.1_6 Forward -64 -45 11.3075 0.281
NP_442173.1_1 Forward -205 -197 15.4574 0.00633
NP_442173.1_1 Reverse -198 -206 15.4574 0.00633
NP_442173.1_6 Forward -353 -339 18.3875 0.0787
NP_442752.1_4 Forward -206 -199 13.8055 0.0199
NP_442752.1_4 Reverse -197 -204 13.8055 0.0199
NP_443027.1_4 Forward -208 -198 11.0914 0.107
NP_443027.1_4 Reverse -227 -237 8.73149 0.191
NP_443027.1_4 Reverse -195 -205 7.25653 0.24
NP_442975.1_10 Reverse -193 -207 19.3701 0.00397
NP_440784.1_7 Forward -205 -198 15.9687 0.0123
NP_440784.1_7 Reverse -198 -205 15.9687 0.0123
NP_442861.1_4 Reverse -16 -35 -1.27961 0.297
NP_440061.1_9 Reverse -195 -209 17.2068 0.0173
NP_440061.1_9 Reverse -317 -331 5.40719 0.286
NP_440061.1_9 Forward -391 -377 5.21053 0.293
NP_441054.1_4 Forward -216 -198 -1.75081 0.208
NP_442062.1_8 Reverse -197 -207 17.3846 0.00193
NP_442062.1_8 Forward -206 -196 10.3048 0.0493
NP_440761.1_4 Forward -211 -192 -12.7836 0.257
NP_441859.1_3 Reverse -346 -365 7.17681 0.164
NP_441859.1_3 Reverse -196 -215 2.35861 0.262
NP_440304.1_4 Reverse -195 -205 10.8948 0.051
NP_440304.1_4 Forward -208 -198 1.84832 0.299
NP_442242.1_4 Forward -205 -198 14.3954 0.0124
NP_442242.1_4 Reverse -198 -205 14.3954 0.0124
NP_441619.1_8 Reverse -191 -205 7.47213 0.277
NP_441208.1_9 Reverse -194 -208 4.91614 0.282
NP_442742.1_9 Reverse -303 -322 -14.3569 0.3
NP_442110.1_7 Forward -206 -192 11.701 0.0593
NP_441925.1_4 Reverse -319 -338 2.55527 0.155
NP_441083.1_5 Reverse -197 -207 20.3345 0.00053
NP_441083.1_5 Forward -206 -196 11.2881 0.0159
NP_441083.1_5 Reverse -319 -329 3.42162 0.172
NP_441083.1_5 Reverse -329 -339 2.92996 0.187
NP_441738.1_2 Forward -204 -197 15.28 0.0102
NP_441738.1_2 Reverse -199 -206 15.28 0.0102
NP_441558.1_5 Forward -208 -189 22.7139 0.00172
NP_441558.1_5 Reverse -37 -56 4.916 0.267
NP_440209.1_1 Reverse -197 -205 18.1123 0.00295
NP_440209.1_1 Forward -206 -198 18.1123 0.00295
NP_442889.1_8 Reverse -194 -208 9.43874 0.0989
NP_442889.1_8 Reverse -60 -74 4.91554 0.247
NP_442889.1_8 Forward -209 -195 3.73557 0.273
NP_440447.1_6 Forward -214 -196 12.6055 0.0824
NP_441713.1_1 Forward -212 -193 -5.31042 0.113
NP_440178.1_7 Forward -207 -188 -22.715 0.272
NP_442570.1_3 Forward -329 -310 -5.11376 0.24
NP_442570.1_3 Forward -391 -372 -9.44032 0.299
NP_442570.1_3 Forward -208 -189 -9.53865 0.299
NP_441716.1_1 Reverse -197 -211 4.81781 0.248
NP_441327.1_5 Forward -314 -305 14.356 0.192
NP_442111.1_4 Forward -207 -193 11.406 0.0509
NP_440906.1_5 Forward -205 -198 15.8704 0.0124
NP_440906.1_5 Reverse -198 -205 15.8704 0.0124
NP_440747.1_10 Forward -209 -197 16.7552 0.0019
NP_440747.1_10 Reverse -194 -206 5.54551 0.0128
NP_440747.1_10 Reverse -377 -389 -12.1541 0.227
NP_441130.1_10 Forward -208 -194 4.81781 0.265
NP_442973.1_5 Reverse -188 -207 11.5042 0.238
NP_441486.1_1 Reverse -194 -208 5.70279 0.0351
NP_441486.1_1 Forward -209 -195 -1.96703 0.175
NP_441486.1_1 Reverse -73 -87 -4.7203 0.205
NP_442330.1_3 Reverse -212 -231 13.3725 0.0921
NP_442634.1_4 Forward -208 -194 -1.67204 0.149
NP_442848.1_5 Reverse -183 -201 4.14905 0.276
NP_443018.1_3 Forward -205 -198 14.8871 0.0123
NP_443018.1_3 Reverse -198 -205 14.8871 0.0123
NP_441634.1_8 Forward -208 -194 5.01447 0.114
NP_440376.1_1 Forward -206 -197 19.4693 0.000692
NP_440376.1_1 Reverse -197 -206 19.4693 0.000692
NP_440376.1_1 Forward -389 -380 3.63797 0.2
NP_440376.1_1 Forward -193 -184 0.589713 0.267
NP_440376.1_1 Forward -327 -318 -0.393597 0.289
NP_441588.1_4 Forward -204 -194 16.2046 0.0369
NP_441588.1_4 Reverse -199 -209 6.46988 0.193
NP_442687.1_7 Reverse -196 -206 9.02648 0.0994
NP_442687.1_7 Forward -207 -197 8.92815 0.0994
NP_442687.1_8 Forward -133 -119 19.7641 0.121
NP_441077.1_2 Forward -37 -18 0.524783 0.299
NP_441077.1_6 Reverse -134 -150 8.97191 0.189
NP_440642.1_10 Forward -301 -287 3.44058 0.273
NP_440667.1_2 Forward -226 -207 -8.45701 0.289
NP_442658.1_1 Reverse -195 -205 13.0576 0.04
NP_442658.1_1 Forward -208 -198 7.94438 0.199
NP_442198.1_3 Forward -215 -196 15.6341 0.0939
NP_442782.1_2 Forward -199 -185 1.27789 0.281
NP_442205.1_10 Reverse -332 -346 20.6484 0.0585
NP_441414.1_9 Reverse -197 -216 12.2908 0.0162
NP_441487.1_6 Forward -121 -102 -0.4922 0.274
NP_442937.1_5 Forward -157 -138 7.66927 0.244
NP_441317.1_4 Forward -214 -200 9.27298 0.297
NP_441958.1_5 Reverse -196 -206 21.2195 0.000805
NP_441958.1_5 Forward -207 -197 12.2714 0.00183
NP_440373.1_2 Reverse -334 -353 13.5786 0.274
NP_439905.1_1 Reverse -198 -211 16.5389 0.0578
NP_439905.1_2 Forward -305 -291 7.9644 0.289
NP_443001.1_7 Forward -205 -186 1.37609 0.282
NP_440984.1_7 Forward -211 -197 11.2093 0.122
NP_440984.1_7 Reverse -192 -206 9.43936 0.127
NP_439990.1_5 Forward -211 -198 19.6855 0.00652
NP_439990.1_5 Reverse -192 -205 6.80412 0.221
NP_442911.1_2 Forward -216 -197 -3.44213 0.112
NP_442911.1_2 Reverse -187 -206 -4.32711 0.132
NP_441580.1_6 Reverse -218 -237 -6.88371 0.235
NP_440153.1_5 Forward -205 -191 5.21113 0.191
NP_442064.1_1 Forward -211 -192 -2.75381 0.146
NP_442064.1_4 Forward -210 -191 6.68515 0.246
NP_440993.1_2 Reverse -192 -208 2.8118 0.262
NP_440138.1_6 Reverse -192 -211 1.37531 0.284
NP_441099.1_5 Forward -216 -197 -10.6203 0.258
NP_440809.1_9 Forward -215 -197 -7.94566 0.225
NP_440475.1_1 Forward -215 -196 18.1709 0.0906
NP_441294.1_7 Reverse -193 -207 17.8896 0.00674
NP_441294.1_7 Reverse -180 -194 9.63458 0.236
NP_441294.1_7 Forward -242 -228 9.25063 0.256
NP_442438.1_10 Reverse -192 -206 -0.787057 0.279
NP_440484.1_1 Reverse -356 -375 9.7334 0.244
NP_440147.1_4 Reverse -195 -208 20.5705 0.00219
NP_440147.1_4 Forward -208 -195 8.18076 0.0546
NP_441175.1_7 Forward -206 -187 7.07928 0.239
NP_441550.1_8 Reverse -195 -205 15.3192 0.0132
NP_441550.1_8 Forward -208 -198 15.1225 0.0132
NP_441916.1_7 Forward -206 -196 18.9579 0.00144
NP_441916.1_7 Reverse -197 -207 10.3048 0.0261
NP_441916.1_10 Reverse -189 -208 4.22769 0.223
NP_441041.1_4 Forward -206 -187 -10.522 0.233
NP_441041.1_4 Forward -192 -173 -13.3736 0.285
NP_441041.1_7 Reverse -194 -206 17.7184 0.00706
NP_442396.1_5 Forward -210 -197 11.819 0.0913
NP_441725.1_4 Reverse -375 -389 16.2235 0.0693
NP_441725.1_5 Reverse -198 -208 2.04498 0.115
NP_441725.1_5 Forward -205 -195 1.94665 0.115
NP_439966.1_7 Forward -208 -198 15.3192 0.0152
NP_439966.1_7 Reverse -195 -205 6.27276 0.185
NP_440736.1_3 Reverse -188 -207 9.0459 0.145
NP_442941.1_3 Reverse -198 -208 19.2529 0.00262
NP_442941.1_3 Forward -205 -195 11.0914 0.0116
NP_440289.1_2 Reverse -194 -207 4.64084 0.0657
NP_440289.1_2 Forward -209 -196 -3.71729 0.267
NP_440983.1_5 Reverse -200 -219 5.80098 0.178
NP_442281.1_1 Reverse -192 -206 17.5018 0.00555
NP_442281.1_1 Reverse -375 -389 4.62054 0.187
NP_440177.1_9 Forward -397 -378 13.5691 0.226
NP_442256.1_2 Forward -208 -190 1.19912 0.109
NP_440437.1_1 Reverse -191 -210 -1.57384 0.205
NP_442288.1_3 Forward -55 -38 7.512 0.257
NP_442982.1_5 Reverse -187 -206 4.52268 0.172
NP_441644.1_6 Forward -206 -196 19.0557 0.000803
NP_441644.1_6 Reverse -197 -207 17.3841 0.00127
NP_442215.1_2 Forward -208 -192 9.7933 0.0533
NP_442215.1_2 Reverse -245 -261 -5.15301 0.246
NP_440253.1_2 Reverse -197 -215 3.65739 0.114
NP_440929.1_8 Forward -206 -197 19.2726 0.000701
NP_440929.1_8 Reverse -197 -206 19.2726 0.000701
NP_442933.1_2 Reverse -138 -156 5.82699 0.286
NP_442933.1_10 Forward -206 -197 17.601 0.00325
NP_442933.1_10 Reverse -197 -206 17.601 0.00325
NP_441751.2_8 Reverse -198 -212 2.75286 0.0759
NP_441751.2_8 Forward -205 -191 -2.06536 0.132
NP_442554.1_4 Reverse -349 -368 6.88262 0.291
NP_442554.1_8 Forward -205 -195 16.4013 0.0065
NP_442554.1_8 Reverse -198 -208 16.2046 0.0065
NP_441762.1_7 Forward -207 -195 0.333971 0.0747
NP_441762.1_7 Reverse -196 -208 -6.64753 0.284
NP_442142.1_4 Reverse -194 -207 10.3434 0.0744
NP_442142.1_4 Forward -209 -196 4.83694 0.209
NP_442142.1_4 Reverse -174 -187 3.95196 0.239
NP_442292.1_1 Reverse -198 -207 18.486 0.00229
NP_442292.1_1 Forward -205 -196 17.5026 0.00435
NP_441525.1_1 Reverse -235 -248 15.1623 0.21
NP_442476.1_6 Reverse -198 -212 12.1926 0.0509
NP_440895.1_6 Forward -212 -199 10.4424 0.202
NP_441711.1_4 Reverse -188 -207 6.68596 0.147
NP_441523.1_6 Reverse -193 -212 2.16274 0.299
NP_443009.1_5 Forward -207 -196 14.5128 0.02
NP_443009.1_5 Reverse -196 -207 10.1862 0.0792
NP_443009.1_5 Reverse -379 -390 3.69644 0.282
NP_442408.2_5 Reverse -197 -216 16.4649 0.266
NP_441715.1_4 Reverse -198 -208 17.3846 0.0106
NP_441715.1_4 Forward -205 -195 7.35486 0.108
NP_441198.1_5 Forward -204 -191 11.7201 0.255
NP_441198.1_8 Reverse -195 -205 12.783 0.116
NP_441198.1_8 Reverse -227 -237 10.7322 0.247
NP_440379.1_5 Reverse -220 -239 -10.1286 0.276
NP_441468.1_1 Forward -205 -198 15.8704 0.0124
NP_441468.1_1 Reverse -198 -205 15.8704 0.0124
NP_441015.1_10 Forward -343 -324 -9.34199 0.282
NP_441015.1_10 Reverse -224 -243 -11.2103 0.292
NP_441673.1_1 Forward -206 -197 20.8459 0.000698
NP_441673.1_1 Reverse -197 -206 20.8459 0.000698
NP_441826.1_2 Reverse -191 -205 7.76774 0.0848
NP_441330.1_1 Forward -394 -375 -15.4385 0.281
NP_442868.1_6 Forward -208 -198 19.2529 0.00563
NP_442868.1_6 Reverse -195 -205 0.963343 0.205
NP_442719.1_2 Reverse -51 -69 -11.6829 0.294
NP_442677.1_7 Reverse -372 -382 17.8763 0.237
NP_441612.1_2 Forward -23 -13 11.5505 0.21
NP_441612.1_2 Reverse -197 -207 8.54929 0.21
NP_442227.1_2 Forward -239 -220 0.786102 0.252
NP_443058.1_7 Reverse -114 -133 8.25926 0.217
NP_442361.1_3 Reverse -191 -204 8.57408 0.285
NP_442808.1_1 Reverse -196 -206 8.73102 0.0481
NP_442808.1_1 Forward -207 -197 8.63269 0.0481
NP_442808.1_1 Forward -239 -229 4.10949 0.207
NP_440145.1_3 Forward -216 -197 -0.197208 0.14
NP_442050.1_5 Forward -208 -198 14.3359 0.0206
NP_442050.1_5 Reverse -195 -205 9.22267 0.193
NP_442342.1_9 Forward -208 -192 2.61514 0.285
NP_441114.1_3 Reverse -179 -188 7.37455 0.239
NP_441878.1_6 Reverse -196 -206 10.5014 0.0176
NP_441878.1_6 Forward -207 -197 10.4031 0.0176
NP_441036.1_8 Reverse -196 -206 15.713 0.00724
NP_441036.1_8 Forward -207 -197 8.33817 0.174
NP_441557.1_5 Forward -206 -197 19.9609 0.000699
NP_441557.1_5 Reverse -197 -206 19.9609 0.000699
NP_442267.1_4 Forward -385 -366 5.30933 0.198
NP_442066.2_4 Forward -206 -187 -7.4737 0.28
NP_442066.2_9 Forward -210 -197 20.0788 0.00699
NP_441433.1_8 Forward -324 -305 2.75272 0.21
NP_442830.1_5 Forward -300 -286 4.52221 0.239
NP_442397.1_9 Reverse -184 -203 1.47442 0.283
NP_441574.1_1 Forward -350 -331 -6.58872 0.277
NP_441549.1_9 Forward -210 -192 -4.60241 0.198
NP_442347.1_2 Reverse -198 -207 12.4878 0.056
NP_442347.1_2 Forward -205 -196 3.34298 0.284
NP_442645.1_2 Forward -214 -195 -12.3902 0.144
NP_442888.1_6 Reverse -186 -205 9.73422 0.172
NP_442888.1_6 Forward -96 -77 3.34271 0.244
NP_442888.1_6 Reverse -173 -192 2.55606 0.252
NP_442888.1_7 Forward -223 -204 11.3075 0.281
NP_441037.1_4 Reverse -195 -205 15.0168 0.028
NP_441633.1_3 Forward -208 -195 3.36254 0.0699
NP_441633.1_3 Reverse -195 -208 -5.97891 0.236
NP_440136.1_2 Forward -205 -198 15.9687 0.0123
NP_440136.1_2 Reverse -198 -205 15.9687 0.0123
NP_442590.1_10 Forward -206 -187 8.94757 0.203
NP_442998.1_5 Forward -313 -303 15.713 0.149
NP_442998.1_5 Forward -11 -1 11.8781 0.176
NP_442998.1_5 Forward -62 -52 8.23984 0.267
NP_442998.1_10 Forward -204 -197 15.5754 0.0102
NP_442998.1_10 Reverse -199 -206 15.5754 0.0102
NP_440299.1_1 Forward -210 -197 10.9334 0.0529
NP_440299.1_1 Reverse -193 -206 4.93527 0.193
NP_441799.1_1 Forward -210 -196 14.5519 0.0228
NP_441799.1_1 Reverse -193 -207 8.16044 0.122
NP_442802.1_6 Reverse -196 -215 -2.45882 0.204
NP_441007.1_5 Reverse -221 -240 10.1275 0.225
NP_441007.1_10 Reverse -224 -237 3.46087 0.182
NP_441007.1_10 Reverse -192 -205 2.57589 0.183
NP_441007.1_10 Forward -211 -198 1.29759 0.203
NP_442201.1_10 Reverse -186 -205 -14.0619 0.28
NP_440256.1_1 Reverse -194 -213 -2.85214 0.123
NP_440256.1_1 Forward -209 -190 -6.49039 0.213
NP_440256.1_1 Forward -392 -373 -10.227 0.297
NP_441559.1_8 Reverse -375 -389 4.22782 0.127
NP_441559.1_8 Forward -211 -197 -5.90027 0.271
NP_441559.1_8 Reverse -192 -206 -7.67023 0.297
NP_440915.1_6 Forward -210 -196 9.73436 0.039
NP_440915.1_6 Reverse -193 -207 4.42448 0.0953
NP_440915.1_6 Reverse -376 -390 -1.5737 0.239
NP_442158.1_4 Reverse -91 -101 12.0747 0.259
NP_442785.1_7 Reverse -195 -209 8.35772 0.298
NP_442452.1_8 Reverse -374 -388 11.9953 0.273
NP_441464.1_1 Reverse -376 -395 14.2574 0.174
NP_440695.1_5 Reverse -197 -216 6.4893 0.154
NP_442993.1_1 Forward -206 -190 -8.88958 0.176
NP_442993.1_1 Forward -186 -170 -8.98791 0.178
NP_440677.1_6 Forward -337 -318 8.06259 0.277
NP_442386.1_9 Forward -207 -198 13.8639 0.0289
NP_442386.1_9 Reverse -196 -205 6.39082 0.219
NP_441340.1_5 Forward -205 -198 15.6737 0.0124
NP_441340.1_5 Reverse -198 -205 15.6737 0.0124
NP_441340.1_5 Reverse -191 -198 8.8889 0.084
NP_442484.1_2 Forward -217 -198 -0.983855 0.281
NP_441248.1_10 Forward -114 -104 14.9073 0.277
NP_442240.1_2 Forward -205 -186 -20.0601 0.295
NP_442714.1_7 Reverse -198 -217 7.57094 0.16
NP_441160.1_5 Forward -217 -198 -5.80207 0.288
NP_440586.1_8 Forward -205 -198 13.2151 0.026
NP_440586.1_8 Reverse -198 -205 13.2151 0.026
NP_442251.1_6 Forward -205 -198 15.2804 0.0124
NP_442251.1_6 Reverse -198 -205 15.2804 0.0124
NP_442959.1_7 Reverse -328 -347 3.93269 0.205
NP_441262.1_3 Reverse -197 -204 14.7888 0.0223
NP_441262.1_3 Forward -206 -199 14.7888 0.0223
NP_440027.1_3 Reverse -364 -382 3.8533 0.263
NP_443051.1_1 Reverse -196 -205 19.5676 0.00335
NP_443051.1_1 Forward -207 -198 10.4228 0.00754
NP_439996.1_6 Forward -222 -203 16.0762 0.137
NP_439937.1_9 Reverse -300 -317 -9.7949 0.209
NP_439937.1_9 Reverse -196 -213 -14.5148 0.287
NP_440439.1_1 Forward -209 -196 1.59258 0.148
NP_439943.1_1 Reverse -2 -21 -7.96535 0.263
NP_440372.1_2 Forward -205 -198 16.3621 0.0124
NP_440372.1_2 Reverse -198 -205 16.3621 0.0124
NP_440372.1_3 Forward -102 -88 13.7625 0.233
NP_441138.1_5 Reverse -16 -29 6.17326 0.271
NP_441789.1_7 Reverse -328 -347 -4.1312 0.28
NP_440991.1_5 Forward -376 -357 17.109 0.267
NP_440819.1_5 Forward -118 -110 7.98423 0.228
NP_440819.1_5 Forward -12 -4 7.59091 0.272
NP_439977.1_5 Forward -212 -193 7.17762 0.123
NP_441572.1_7 Reverse -191 -210 -2.36049 0.193
NP_442384.1_10 Reverse -197 -210 19.2922 0.00338
NP_442384.1_10 Forward -206 -193 8.08242 0.0692
NP_441018.1_7 Forward -210 -191 6.78429 0.282
NP_442790.1_4 Forward -215 -196 -0.983855 0.0987
NP_442790.1_4 Forward -195 -176 -15.8318 0.297
NP_442262.1_10 Forward -205 -198 14.1988 0.0123
NP_442262.1_10 Reverse -198 -205 14.1988 0.0123
NP_441689.1_5 Reverse -195 -205 8.3377 0.132
NP_441689.1_5 Forward -208 -198 5.78111 0.197
NP_441814.1_5 Forward -194 -175 8.35759 0.249
NP_440344.1_10 Reverse -190 -207 -6.35267 0.113
NP_440282.1_3 Reverse -179 -198 -1.18052 0.298
NP_442556.1_10 Reverse -5 -24 13.6054 0.211
NP_440297.1_9 Reverse -198 -208 -0.118297 0.282
NP_440297.1_9 Forward -205 -195 -0.216628 0.282
NP_440350.1_5 Reverse -15 -34 -6.98204 0.299
NP_440894.1_10 Forward -211 -192 5.01433 0.24
NP_440999.1_9 Reverse -193 -207 4.32615 0.116
NP_440999.1_9 Forward -210 -196 -3.34366 0.291
NP_440888.1_2 Reverse -197 -211 15.1419 0.0122
NP_440888.1_2 Forward -206 -192 11.1104 0.0757
NP_440888.1_2 Forward -238 -224 8.06211 0.172
NP_440052.1_5 Forward -217 -198 -5.40875 0.287
NP_440575.1_8 Forward -58 -39 0.294447 0.185
NP_441543.1_2 Reverse -198 -207 16.9127 0.00359
NP_441543.1_2 Forward -205 -196 15.9293 0.00518
NP_442845.1_2 Reverse -191 -205 13.0776 0.0999
NP_442845.1_2 Forward -212 -198 5.89945 0.22
NP_442845.1_2 Reverse -184 -198 5.50613 0.231
NP_441918.1_7 Forward -357 -338 -0.983855 0.297
NP_442710.1_7 Forward -33 -14 -8.66439 0.299
NP_441469.1_8 Reverse -196 -205 6.5879 0.227
NP_441469.1_8 Forward -207 -198 6.48957 0.227
NP_443064.1_6 Reverse -197 -207 12.5669 0.0796
NP_443064.1_6 Forward -206 -196 10.8217 0.13
NP_441306.1_10 Reverse -255 -269 18.8785 0.158
NP_442578.1_7 Forward -205 -198 14.5921 0.026
NP_442578.1_7 Reverse -198 -205 14.5921 0.026
NP_441462.1_2 Forward -206 -196 20.2362 0.000805
NP_441462.1_2 Reverse -197 -207 11.5831 0.00406
NP_441621.1_7 Reverse -218 -232 -5.11362 0.248
NP_443062.1_1 Reverse -197 -215 12.0562 0.0869
NP_443062.1_1 Forward -206 -188 8.15589 0.159
NP_440936.1_10 Forward -148 -129 12.1748 0.148
NP_442204.1_1 Reverse -193 -204 8.90846 0.0852
NP_442204.1_1 Reverse -220 -231 3.20526 0.266
NP_442204.1_1 Reverse -376 -387 1.53364 0.269
NP_442204.1_2 Forward -134 -115 5.50599 0.299
NP_440544.1_5 Reverse -16 -23 13.8024 0.28
NP_442872.1_1 Reverse -327 -346 -9.34199 0.241
NP_440516.1_2 Forward -212 -194 -2.53746 0.299
NP_440516.1_8 Forward -206 -197 16.9127 0.00442
NP_440516.1_8 Reverse -197 -206 16.9127 0.00442
NP_442428.1_5 Forward -205 -198 15.8704 0.0124
NP_442428.1_5 Reverse -198 -205 15.8704 0.0124
NP_442120.1_10 Forward -60 -41 -8.26035 0.23
NP_442120.1_10 Reverse -45 -64 -10.9153 0.261
NP_440673.1_3 Forward -204 -197 12.4288 0.0426
NP_440673.1_3 Reverse -199 -206 12.4288 0.0426
NP_440673.1_3 Reverse -179 -186 8.98723 0.203
NP_440673.1_3 Forward -354 -347 8.20058 0.234
NP_441052.1_2 Reverse -197 -207 19.9412 0.00106
NP_441052.1_2 Forward -206 -196 10.4031 0.0285
NP_441052.1_2 Forward -238 -228 3.81494 0.173
NP_442219.1_9 Reverse -198 -207 17.7976 0.00718
NP_442219.1_9 Forward -205 -196 8.25953 0.0681
NP_440436.1_4 Reverse -198 -207 17.2072 0.00233
NP_440436.1_4 Forward -205 -196 9.24241 0.0871
NP_440314.1_9 Reverse -198 -217 21.1406 0.00614
NP_442577.1_10 Reverse -352 -371 3.63691 0.285
NP_441719.1_4 Forward -205 -198 16.3621 0.0124
NP_441719.1_4 Reverse -198 -205 16.3621 0.0124
NP_441733.1_5 Reverse -324 -343 12.8808 0.294
NP_441363.1_4 Forward -274 -255 10.6192 0.249
NP_441004.1_1 Forward -192 -173 2.94938 0.106
NP_441004.1_1 Reverse -285 -304 -5.70374 0.179
NP_441004.1_1 Forward -343 -324 -14.0619 0.263
NP_441004.1_1 Forward -344 -325 -17.3068 0.29
NP_441004.1_4 Reverse -288 -298 10.7964 0.254
NP_442813.1_4 Forward -201 -182 -8.45701 0.299
NP_442366.1_3 Forward -207 -189 4.83737 0.0917
NP_442366.1_3 Reverse -189 -207 -5.68405 0.292
NP_442366.1_5 Reverse -194 -204 14.8275 0.0375
NP_441115.1_4 Forward -207 -189 11.0314 0.154
NP_442694.1_4 Forward -194 -185 12.5861 0.249
NP_442694.1_4 Forward -347 -338 11.4061 0.277
NP_440328.1_4 Reverse -191 -210 7.07928 0.124
NP_442312.1_1 Forward -198 -179 12.1925 0.266
NP_443054.1_2 Forward -208 -194 8.94771 0.104
NP_442430.1_10 Reverse -187 -206 11.2084 0.249
NP_441851.1_10 Forward -207 -197 15.8113 0.00552
NP_441851.1_10 Reverse -196 -206 8.53483 0.114
NP_442939.1_3 Reverse -119 -133 15.7678 0.257
NP_441542.1_4 Forward -362 -348 15.5359 0.235
NP_441542.1_4 Forward -351 -337 5.01447 0.264
NP_441668.1_4 Forward -196 -177 1.57275 0.212
NP_441668.1_4 Reverse -187 -206 -2.55715 0.291
NP_442515.1_1 Reverse -196 -210 11.701 0.0388
NP_441396.1_5 Forward -333 -324 8.65285 0.21
NP_441982.1_6 Forward -315 -306 11.053 0.288
NP_441349.1_6 Forward -59 -40 16.4207 0.159
NP_441349.1_10 Forward -216 -197 -6.68705 0.235
NP_441409.1_6 Forward -212 -193 -6.88371 0.14
NP_440432.1_9 Forward -205 -190 -3.06836 0.179
NP_440431.1_3 Reverse -196 -215 10.4225 0.0495
NP_442450.1_5 Reverse -195 -205 7.64985 0.13
NP_441078.1_4 Forward -206 -197 19.6659 0.0007
NP_441078.1_4 Reverse -197 -206 19.6659 0.0007
NP_441078.1_4 Reverse -380 -389 -1.86856 0.272
NP_442729.1_8 Forward -210 -197 10.639 0.125
NP_440707.1_9 Reverse -221 -240 0.294447 0.293
NP_441091.1_5 Reverse -346 -365 2.3594 0.29
NP_440526.1_3 Forward -205 -194 1.92649 0.267
NP_440526.1_3 Forward -237 -226 1.43483 0.267
NP_440526.1_3 Reverse -198 -209 1.04151 0.267
NP_441432.1_8 Reverse -196 -205 16.8143 0.00595
NP_441432.1_8 Forward -207 -198 16.8143 0.00595
NP_441432.1_8 Forward -187 -178 5.50626 0.151
NP_441333.1_1 Forward -145 -135 14.2591 0.217
NP_442320.1_8 Forward -212 -198 -2.36035 0.0871
NP_442320.1_8 Reverse -191 -205 -3.54032 0.124
NP_441732.1_2 Reverse -193 -209 2.8118 0.0159
NP_441030.1_7 Reverse -185 -204 19.0757 0.12
NP_442003.1_9 Forward -326 -307 4.916 0.243
NP_440760.1_1 Forward -206 -187 -12.0953 0.091
NP_440760.1_1 Reverse -197 -216 -12.1936 0.0915
NP_441131.1_5 Forward -187 -168 5.01433 0.251
NP_440578.1_8 Forward -365 -346 15.7324 0.217
NP_442353.1_4 Reverse -191 -210 15.8299 0.0657
NP_442510.1_1 Forward -400 -381 12.9791 0.246
NP_441072.1_2 Forward -210 -191 10.7175 0.198
NP_442400.1_10 Forward -94 -81 8.56056 0.278
NP_442489.1_7 Forward -206 -197 20.1576 0.000695
NP_442489.1_7 Reverse -197 -206 20.1576 0.000695
NP_442489.1_7 Forward -389 -380 5.01461 0.0832
NP_442079.1_7 Reverse -198 -217 13.2741 0.0806
NP_440559.1_1 Reverse -198 -207 17.4043 0.00658
NP_440559.1_1 Forward -205 -196 8.65285 0.0586
NP_441659.2_8 Forward -206 -196 20.9245 0.000805
NP_441659.2_8 Reverse -197 -207 18.1713 0.00133
NP_442913.1_10 Reverse -188 -207 2.16274 0.131
NP_441968.1_1 Forward -100 -92 14.3753 0.286
NP_442776.1_1 Reverse -369 -388 11.6025 0.156
NP_442346.1_5 Forward -207 -197 16.6963 0.00248
NP_442346.1_5 Reverse -196 -206 16.303 0.00248
NP_440545.1_3 Reverse -193 -210 -4.18939 0.22
NP_441923.1_6 Reverse -218 -232 13.1759 0.203
NP_440459.1_2 Reverse -175 -192 13.4119 0.131
NP_440459.1_2 Reverse -188 -205 12.3302 0.151
NP_440459.1_2 Forward -208 -191 8.59364 0.254
NP_442603.1_7 Reverse -197 -211 16.9119 0.0273
NP_441585.1_5 Reverse -293 -312 -0.591301 0.296
NP_440449.1_6 Forward -384 -366 18.1767 0.0651
NP_440449.1_6 Reverse -189 -207 10.5901 0.152
NP_441833.1_4 Forward -205 -198 15.9687 0.0124
NP_441833.1_4 Reverse -198 -205 15.9687 0.0124
NP_440751.1_3 Reverse -312 -331 8.55343 0.275
NP_441329.1_6 Reverse -134 -153 8.92807 0.141
NP_441329.1_6 Forward -32 -13 7.4002 0.179
NP_441329.1_6 Forward -20 -1 6.54077 0.179
NP_442162.1_9 Forward -205 -198 16.2637 0.0124
NP_442162.1_9 Reverse -198 -205 16.2637 0.0124
NP_440671.1_4 Reverse -191 -205 7.76774 0.208
NP_442404.1_9 Reverse -304 -318 8.3571 0.296
NP_441044.1_4 Reverse -209 -227 7.4923 0.223
NP_442140.1_3 Reverse -198 -208 10.3048 0.0902
NP_442140.1_3 Forward -205 -195 6.66654 0.159
NP_440875.1_9 Forward -204 -194 7.69067 0.255
NP_441813.1_5 Forward -208 -198 18.1713 0.00743
NP_441813.1_5 Reverse -195 -205 8.63316 0.0367
NP_441813.1_7 Reverse -326 -340 12.782 0.212
NP_440594.1_8 Reverse -198 -211 12.2117 0.152
NP_442028.1_1 Forward -146 -133 7.70113 0.289
NP_440590.1_4 Reverse -198 -211 11.7207 0.0187
NP_440590.1_4 Forward -205 -192 10.8357 0.0239
NP_440567.1_1 Forward -205 -191 11.7993 0.0267
NP_440567.1_6 Forward -304 -285 9.14423 0.199
NP_440567.1_7 Reverse -50 -62 20.0979 0.197
NP_440035.1_1 Forward -76 -57 15.7324 0.189
NP_442497.1_10 Forward -205 -196 17.601 0.00813
NP_442497.1_10 Reverse -198 -207 10.4228 0.0087
NP_440821.1_4 Forward -208 -198 9.41981 0.0286
NP_440821.1_4 Reverse -195 -205 2.24165 0.131
NP_440821.1_5 Forward -95 -76 22.0256 0.0261
NP_441239.1_9 Reverse -195 -207 11.1504 0.0648
NP_441239.1_9 Forward -208 -196 5.25052 0.223
NP_442568.1_8 Reverse -350 -364 7.9644 0.296
NP_441892.1_1 Reverse -188 -205 5.9387 0.0995
NP_441892.1_1 Reverse -371 -388 -3.79607 0.249
NP_440665.1_1 Forward -235 -216 -15.3402 0.267
NP_442044.1_9 Forward -206 -187 2.3594 0.283
NP_440740.1_2 Forward -349 -330 13.7658 0.222
NP_440219.1_6 Reverse -79 -98 19.9598 0.203
NP_442643.1_1 Forward -212 -193 -12.5869 0.268
NP_441526.1_6 Reverse -227 -246 4.03102 0.271
NP_442138.1_9 Reverse -184 -203 10.815 0.208
NP_440546.1_4 Forward -206 -196 13.5365 0.0459
NP_440546.1_4 Reverse -197 -207 10.046 0.109
NP_440546.1_4 Reverse -190 -200 9.17338 0.151
NP_440546.1_4 Forward -199 -189 8.78555 0.171
NP_440675.1_1 Forward -209 -190 1.0811 0.299
NP_440462.1_6 Reverse -195 -205 10.5014 0.0396
NP_440462.1_6 Forward -208 -198 9.61647 0.0429
NP_442565.1_6 Forward -65 -51 17.0108 0.243
NP_440868.1_4 Forward -210 -198 9.97041 0.0405
NP_440868.1_4 Reverse -193 -205 -0.846001 0.282
NP_441848.1_4 Forward -17 -1 14.1396 0.174
NP_441848.1_4 Reverse -127 -143 7.64616 0.288
NP_440696.1_6 Forward -211 -192 3.83436 0.288
NP_442039.1_4 Forward -205 -198 15.1821 0.0124
NP_442039.1_4 Reverse -198 -205 15.1821 0.0124
NP_442679.1_1 Forward -24 -5 -4.72043 0.283
NP_442679.1_1 Forward -25 -6 -5.01543 0.288
NP_441926.1_3 Forward -206 -190 7.2367 0.17
NP_441926.1_3 Forward -186 -170 3.20513 0.236
NP_442837.1_3 Forward -205 -198 15.7721 0.0124
NP_442837.1_3 Reverse -198 -205 15.7721 0.0124
NP_440160.1_1 Reverse -126 -145 11.6819 0.21
NP_440160.1_5 Reverse -201 -211 15.0242 0.267
NP_442053.1_1 Forward -206 -197 18.3876 0.0007
NP_442053.1_1 Reverse -197 -206 18.3876 0.0007
NP_440505.1_3 Forward -208 -198 18.3679 0.00213
NP_440505.1_3 Reverse -195 -205 8.04317 0.147
NP_441102.1_1 Forward -205 -186 7.66927 0.214
NP_441252.1_6 Reverse -288 -295 11.9372 0.25
NP_442532.1_1 Reverse -133 -147 14.681 0.215
NP_442532.1_1 Forward -27 -13 14.0979 0.215
NP_442532.1_7 Forward -356 -342 1.57289 0.279
NP_440914.1_1 Reverse -197 -207 17.5935 0.000537
NP_440914.1_1 Forward -206 -196 16.3248 0.00196
NP_441011.1_8 Forward -205 -196 16.6177 0.00602
NP_441011.1_8 Reverse -198 -207 8.25953 0.144
NP_442533.1_6 Forward -206 -197 17.2076 0.00137
NP_442533.1_6 Reverse -197 -206 17.2076 0.00137
NP_442533.1_6 Forward -199 -190 2.55633 0.25
NP_440854.1_7 Forward -148 -134 16.8168 0.246
NP_443016.1_10 Forward -215 -196 15.8307 0.169
NP_441482.1_7 Reverse -374 -388 -3.44199 0.124
NP_441482.1_7 Reverse -191 -205 -10.2268 0.209
NP_441482.1_7 Forward -212 -198 -12.3901 0.295
NP_439944.1_9 Reverse -198 -208 10.5014 0.0887
NP_439944.1_9 Forward -205 -195 9.12481 0.1
NP_441028.1_6 Reverse -306 -316 7.45273 0.229
NP_441028.1_6 Reverse -5 -15 6.86274 0.23
NP_441028.1_6 Reverse -3 -13 6.76441 0.23
NP_441028.1_6 Reverse -15 -25 4.20782 0.278
NP_440116.1_8 Reverse -198 -217 -5.60541 0.194
NP_440116.1_8 Forward -205 -186 -9.047 0.267
NP_441527.1_4 Forward -34 -15 2.62561 0.127
NP_441527.1_4 Forward -22 -3 -6.15965 0.215
NP_441527.1_4 Reverse -134 -153 -10.4568 0.27
NP_441527.1_4 Forward -23 -4 -10.9342 0.277
NP_441527.1_4 Forward -37 -18 -11.6982 0.284
NP_441527.1_5 Reverse -195 -214 13.4738 0.297
NP_440115.1_6 Reverse -377 -387 10.4031 0.115
NP_440115.1_6 Forward -209 -199 6.76487 0.167
NP_440007.1_9 Forward -128 -114 5.1128 0.265
NP_440007.1_9 Reverse -193 -207 3.04785 0.277
NP_442728.1_7 Forward -131 -117 16.6175 0.196
NP_440608.1_6 Reverse -198 -217 4.62021 0.258
NP_441602.1_3 Forward -211 -192 6.39097 0.132
NP_440317.1_1 Forward -109 -90 12.4875 0.266
NP_441106.1_1 Reverse -196 -205 18.486 0.0028
NP_441106.1_1 Forward -207 -198 9.63616 0.0311
NP_439903.1_6 Forward -209 -190 -0.0996487 0.276
NP_442588.1_6 Forward -203 -184 1.17943 0.245
NP_441439.1_8 Forward -225 -206 14.8474 0.293
NP_441286.1_1 Forward -207 -195 5.93884 0.0258
NP_441286.1_1 Reverse -196 -208 3.48056 0.0467
NP_442674.1_1 Forward -20 -1 12.2118 0.227
NP_440670.1_8 Forward -206 -197 18.3876 0.000699
NP_440670.1_8 Reverse -197 -206 18.3876 0.000699
NP_442908.1_1 Reverse -110 -129 0.687771 0.277
NP_440886.1_7 Reverse -346 -356 9.41933 0.0805
NP_440886.1_7 Reverse -196 -206 8.04271 0.0805
NP_440886.1_7 Forward -207 -197 7.94438 0.0805
NP_440886.1_7 Forward -239 -229 4.99446 0.205
NP_440886.1_7 Reverse -328 -338 3.71617 0.267
NP_442614.1_2 Reverse -197 -211 9.04604 0.242
NP_442072.1_9 Forward -207 -189 15.4571 0.00314
NP_442401.1_2 Reverse -328 -347 16.9115 0.0964
NP_440907.2_8 Forward -205 -195 15.9091 0.0161
NP_442264.1_2 Forward -216 -199 5.54538 0.275
NP_441021.1_1 Forward -205 -186 -12.2919 0.283
NP_440841.1_4 Reverse -195 -214 -6.78538 0.215
NP_441463.1_3 Forward -216 -197 -8.65367 0.272
NP_442842.1_4 Forward -205 -186 10.1275 0.223
NP_441626.1_2 Forward -205 -198 15.7721 0.0124
NP_441626.1_2 Reverse -198 -205 15.7721 0.0124
NP_442209.1_8 Reverse -203 -222 15.0441 0.176
NP_442794.1_1 Forward -210 -198 7.31547 0.142
NP_442794.1_1 Reverse -193 -205 2.98891 0.286
NP_442615.1_1 Forward -215 -197 5.23069 0.0398
NP_442615.1_1 Reverse -188 -206 -1.45582 0.128
NP_440387.1_1 Forward -206 -190 8.515 0.0282
NP_441488.1_8 Reverse -192 -206 10.9137 0.146
NP_441836.1_2 Forward -212 -193 -5.01543 0.269
NP_441993.1_1 Reverse -191 -210 4.48058 0.22
NP_442084.1_6 Forward -167 -149 5.13236 0.269
NP_440814.1_4 Reverse -188 -207 -12.9802 0.254
NP_440114.1_10 Forward -206 -192 10.3243 0.148
NP_442698.1_10 Reverse -199 -218 -1.18052 0.297
NP_440287.1_5 Forward -238 -219 8.55343 0.286
NP_440287.1_6 Reverse -188 -207 2.94938 0.226
NP_442087.1_2 Reverse -197 -216 15.6322 0.169
NP_441272.1_4 Reverse -181 -200 0.58944 0.258
NP_440293.1_10 Forward -161 -142 0.687771 0.219
NP_442743.1_1 Forward -303 -284 5.11187 0.286
NP_439910.1_2 Reverse -189 -206 -21.594 0.183
NP_440502.1_3 Forward -296 -286 15.0561 0.2
NP_440457.1_1 Forward -210 -198 -0.74767 0.273
NP_440798.1_1 Forward -113 -95 10.8317 0.294
NP_440798.1_6 Forward -205 -192 3.95252 0.147
NP_441332.1_6 Forward -239 -229 11.4531 0.26
NP_441332.1_6 Forward -293 -283 11.1627 0.269
NP_442509.1_9 Reverse -197 -207 8.14104 0.192
NP_442509.1_9 Forward -206 -196 8.04271 0.192
NP_442439.1_8 Reverse -349 -368 10.5209 0.246
NP_442514.1_5 Forward -300 -281 -0.492971 0.184
NP_440554.1_4 Reverse -198 -208 8.92815 0.0646
NP_440554.1_4 Forward -205 -195 8.82982 0.0646
NP_442737.1_5 Reverse -270 -289 12.2003 0.265
NP_441885.1_5 Reverse -197 -207 20.9245 0.000538
NP_441885.1_5 Forward -206 -196 11.3864 0.00668
NP_440478.1_10 Reverse -195 -209 8.75105 0.257
NP_442341.1_7 Forward -207 -193 10.521 0.0625
NP_442341.1_7 Reverse -170 -184 4.62115 0.185
NP_442341.1_7 Reverse -183 -197 2.65453 0.249
NP_442341.1_9 Forward -208 -194 8.45543 0.17
NP_443000.1_3 Reverse -286 -305 10.1651 0.286
NP_443000.1_7 Forward -208 -198 19.9412 0.00223
NP_443000.1_7 Reverse -195 -205 10.6981 0.0345
NP_440275.1_3 Forward -208 -198 15.123 0.0182
NP_440275.1_3 Reverse -195 -205 9.02648 0.0563
NP_441307.1_4 Forward -340 -321 -1.37718 0.283
NP_441635.1_2 Reverse -131 -150 10.5514 0.283
NP_441207.1_7 Reverse -134 -148 7.7064 0.295
NP_442495.1_4 Forward -385 -375 15.9097 0.101
NP_441105.1_3 Reverse -186 -205 10.9142 0.0384
NP_441105.1_3 Forward -191 -172 -9.83364 0.297
NP_440216.1_1 Forward -206 -192 8.06273 0.0068
NP_440216.1_1 Reverse -197 -211 -0.787057 0.0284
NP_440216.1_9 Reverse -179 -188 5.50626 0.292
NP_440172.1_1 Forward -206 -196 17.5813 0.00421
NP_440172.1_1 Reverse -197 -207 15.0247 0.00945
NP_440172.1_1 Forward -199 -189 4.50326 0.184
NP_440172.1_1 Forward -186 -176 2.83163 0.264
NP_442015.1_10 Reverse -193 -206 3.65753 0.178
NP_442015.1_10 Forward -210 -197 2.67422 0.187
NP_441226.1_7 Forward -205 -198 14.4934 0.0123
NP_441226.1_7 Reverse -198 -205 14.4934 0.0123
NP_441111.1_7 Forward -205 -197 18.7023 0.00294
NP_441111.1_7 Reverse -198 -206 18.7023 0.00294
NP_442379.1_10 Reverse -190 -207 0.0388413 0.223
NP_441766.1_2 Forward -206 -197 17.5026 0.00297
NP_441766.1_2 Reverse -197 -206 17.5026 0.00297
NP_442417.1_5 Forward -206 -192 7.07942 0.197
NP_440072.1_5 Reverse -220 -238 4.73903 0.236
NP_442116.1_6 Forward -18 -1 11.7022 0.197
NP_442403.1_9 Forward -218 -199 1.96607 0.295
NP_442154.1_1 Forward -220 -202 -0.177514 0.109
NP_442154.1_1 Reverse -221 -239 -5.09406 0.127
NP_440261.1_5 Reverse -198 -211 5.03416 0.0478
NP_440261.1_5 Forward -205 -192 -10.5021 0.201
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAACAAAATCAGTGGATTGCCTGGGCTGGTACTCTGTTTTTTGGCATGATTGCGGCAGTTTTGCTGATTGGGGGGGGTCTGCATTTAGGGGAAAATCTGACTCCCTTGCCCCATCCTAAAAAGGATAGTCAATTGGTCACCACTGGTATTTACAGCATGGTCCGTCATCCCCTCTACGGCGGCGTGGTTTTTCTGGCGATCGCCTATGGCTTTTGGCAATGGAGTTTGACCCATTTAATCGGAGCAGTGGTGTTATTTATATTTTTTAATCTCAAAGCTAATCGGGAAGAAATTTGGCTCCAAGATAAATTTAACGACTATGGCAATTATCGAGACCAGGTGAAAAAGCTGATTCCTTGGCTTTATTAAAGGAATATGAAGAAAAATATGGGAAAAAACT

CDS

ATGTGGGATGAAAGATTTAGCCAGTCAGAATATGTTTACGGTACAGAACCGAATGATTTTTTGGTCAGTGTGGCCAATCAAATTCCCCAGGGAAAAATTCTTTGTTTAGCAGAAGGAGAAGGTCGTAATGCTTGTTTTTTAGCAAGTTTGGGTTATGAAGTGACCGCGGTGGATCAATCTTCGGTCGGTTTAGCCAAAGCAAAACAATTAGCCCAGGAAAAAGGTGTAAAAATTACCACTGTCCAGAGTAATTTAGCCGATTTTGACATTGTCGCGGATGCCTGGGAAGGCATTGTTTCCATTTTTTGCCATTTACCTTCTAGTTTAAGACAACAACTTTATCCCAAAGTTTATCAAGGCTTAAAACCTGGTGGAGTGTTTATTTTAGAAGGTTTTGCTCCAGAACAATTACAATACAACACCGGTGGCCCAAAGGATTTAGATCTATTGCCTAAGTTGGAAACGTTGCAGAGTGAATTGCCGAGTTTGAATTGGCTAATTGCCAACAATTTGGAACGAAATTTAGATGAGGGAGCTTACCATCAAGGGAAAGCCGCCCTAATTCAGCTATTGGGACAAAAGTAA

Protein

MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQK